43 CFR 7.20 - Public awareness programs.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Public awareness programs. 7.20 Section 7.20 Public Lands: Interior Office of the Secretary of the Interior PROTECTION OF ARCHAEOLOGICAL RESOURCES Uniform Regulations § 7.20 Public awareness programs. (a) Each Federal land manager will establish a program to increase public awareness of the...
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...
5 CFR 720.206 - Selection guidelines.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Selection guidelines. 720.206 Section 720... guidelines. This subpart sets forth requirements for a recruitment program, not a selection program... procedures and criteria must be consistent with the Uniform Guidelines on Employee Selection Procedures (43...
32 CFR 701.125 - Computer matching program.
2010-07-01
... counterintelligence matches done in the course of performing a background check for security clearances of Federal... 32 National Defense 5 2010-07-01 2010-07-01 false Computer matching program. 701.125 Section 701... OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.125 Computer matching program...
2010-01-01
... any other reliable statistical study. (e) Recruitment means the total process by which the Federal...) AFFIRMATIVE EMPLOYMENT PROGRAMS Federal Equal Opportunity Recruitment Program § 720.202 Definitions. For the... been determined. It includes both innovative internal and external recruitment actions. It is also...
45 CFR 2522.720 - How many years must my evaluation cover?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false How many years must my evaluation cover? 2522.720 Section 2522.720 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR... Evaluating Programs: Requirements and Procedures § 2522.720 How many years must my evaluation cover? (a) If...
41 CFR 105-71.125 - Program income.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Program income. 105-71... GOVERNMENTS 71.12-Post-Award Requirements/Financial Administration § 105-71.125 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees...
14 CFR 125.507 - Fuel tank system inspection program.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system inspection program. 125... Airworthiness and Safety Improvements § 125.507 Fuel tank system inspection program. (a) Except as provided in... fuel tank is installed under a field approval, before June 16, 2008, the certificate holder must submit...
FTY720 inhibits mesothelioma growth in vitro and in a syngeneic mouse model.
Szymiczek, Agata; Pastorino, Sandra; Larson, David; Tanji, Mika; Pellegrini, Laura; Xue, Jiaming; Li, Shuangjing; Giorgi, Carlotta; Pinton, Paolo; Takinishi, Yasutaka; Pass, Harvey I; Furuya, Hideki; Gaudino, Giovanni; Napolitano, Andrea; Carbone, Michele; Yang, Haining
2017-03-15
Malignant mesothelioma (MM) is a very aggressive type of cancer, with a dismal prognosis and inherent resistance to chemotherapeutics. Development and evaluation of new therapeutic approaches is highly needed. Immunosuppressant FTY720, approved for multiple sclerosis treatment, has recently raised attention for its anti-tumor activity in a variety of cancers. However, its therapeutic potential in MM has not been evaluated yet. Cell viability and anchorage-independent growth were evaluated in a panel of MM cell lines and human mesothelial cells (HM) upon FTY720 treatment to assess in vitro anti-tumor efficacy. The mechanism of action of FTY720 in MM was assessed by measuring the activity of phosphatase protein 2A (PP2A)-a major target of FTY720. The binding of the endogenous inhibitor SET to PP2A in presence of FTY720 was evaluated by immunoblotting and immunoprecipitation. Signaling and activation of programmed cell death were evaluated by immunoblotting and flow cytometry. A syngeneic mouse model was used to evaluate anti-tumor efficacy and toxicity profile of FTY720 in vivo. We show that FTY720 significantly suppressed MM cell viability and anchorage-independent growth without affecting normal HM cells. FTY720 inhibited the phosphatase activity of PP2A by displacement of SET protein, which appeared overexpressed in MM, as compared to HM cells. FTY720 promoted AKT dephosphorylation and Bcl-2 degradation, leading to induction of programmed cell death, as demonstrated by caspase-3 and PARP activation, as well as by cytochrome c and AIF intracellular translocation. Moreover, FTY720 administration in vivo effectively reduced tumor burden in mice without apparent toxicity. Our preclinical data indicate that FTY720 is a potentially promising therapeutic agent for MM treatment.
Al Rawaf, Haya Saad Abdulla; Fattah, Azza Khalil Abdel; Megeid, Fadia Yousif Abdel; Nazmy, Rania Mohammed Aziz; Alarifi, Sarah Nasser; Al Sulaihm, Hind Sulaiman
2017-01-01
This study aims at highlighting the role of Continuous Education Programs at the Saudi Universities in Religious, Social, and Health Literacy; King Saud University was taken as an example. To achieve the goals of the study two questionnaires were distributed among two samples from King Saud University; (101) of students, and (9) of continuous…
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Employment. 720.140 Section 720.140 Indians THE OFFICE OF... OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...
40 CFR 720.85 - Chemical identity.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Chemical identity. 720.85 Section 720... PREMANUFACTURE NOTIFICATION Confidentiality and Public Access to Information § 720.85 Chemical identity. (a... submits information to EPA under this part may assert a claim of confidentiality for the chemical identity...
34 CFR 75.720 - Financial and performance reports.
2010-07-01
... performance) and 34 CFR 74.52 (Financial reporting); and (2) 34 CFR 80.40 (Monitoring and reporting program performance) and 34 CFR 80.41 (Financial reporting). (b) A grantee shall submit these reports annually, unless... 34 Education 1 2010-07-01 2010-07-01 false Financial and performance reports. 75.720 Section 75...
Directory of Open Access Journals (Sweden)
Julius O Enoru
Full Text Available Parkinson's disease (PD is a neurodegenerative aging disorder in which postmortem PD brain exhibits neuroinflammation, as well as synucleinopathy-associated protein phosphatase 2A (PP2A enzymatic activity loss. Based on our translational research, we began evaluating the PD-repurposing-potential of an anti-inflammatory, neuroprotective, and PP2A stimulatory oral drug that is FDA-approved for multiple sclerosis, FTY720 (fingolimod, Gilenya®. We also designed two new FTY720 analogues, FTY720-C2 and FTY720-Mitoxy, with modifications that affect drug potency and mitochondrial localization, respectively. Herein, we describe the metabolic stability and metabolic profiling of FTY720-C2 and FTY720-Mitoxy in liver microsomes and hepatocytes. Using mouse, rat, dog, monkey, and human liver microsomes the intrinsic clearance of FTY720-C2 was 22.5, 79.5, 6.0, 20.2 and 18.3 μL/min/mg; and for FTY720-Mitoxy was 1.8, 7.8, 1.4, 135.0 and 17.5 μL/min/mg, respectively. In hepatocytes, both FTY720-C2 and FTY720-Mitoxy were metabolized from the octyl side chain, generating a series of carboxylic acids similar to the parent FTY720, but without phosphorylated metabolites. To assess absorption and distribution, we gave equivalent single intravenous (IV or oral doses of FTY720-C2 or FTY720-Mitoxy to C57BL/6 mice, with two mice per time point evaluated. After IV delivery, both FTY720-C2 and FTY720-Mitoxy were rapidly detected in plasma and brain; and reached peak concentrations at the first sampling time points. After oral dosing, FTY720-C2 was present in plasma and brain, although FTY720-Mitoxy was not orally bioavailable. Brain-to-plasma ratio of both compounds increased time-dependently, suggesting a preferential partitioning to the brain. PP2A activity in mouse adrenal gland increased ~2-fold after FTY720-C2 or FTY720-Mitoxy, as compared to untreated controls. In summary, FTY720-C2 and FTY720-Mitoxy both (i crossed the blood-brain-barrier; (ii produced metabolites
Hilal, Kholoud T.; Scott, Safiyyah; Maadad, Nina
2015-01-01
Since 2006, Saudi Arabian politicians, economists and sociologists have had to consider the implications of their country's King Abdullah Scholarship Program (KASP). Because Saudi Arabia has certain religious traditions and economic practices that are sensitive, international scholars are examining from different perspectives the outcomes and…
31 CFR 103.125 - Anti-money laundering programs for money services businesses.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Anti-money laundering programs for... Laundering Programs Anti-Money Laundering Programs § 103.125 Anti-money laundering programs for money..., and maintain an effective anti-money laundering program. An effective anti-money laundering program is...
5 CFR 720.203 - Responsibilities of the Office of Personnel Management.
2010-01-01
... Recruitment Program § 720.203 Responsibilities of the Office of Personnel Management. (a) The Office of... underrepresentation. The process for making such determinations is described in sections II and III (c) of the “Guidelines for the Development of a Federal Recruitment Program to Implement 5 U.S.C. 7201, as amended” (See...
DEFF Research Database (Denmark)
Dobat, Andres S.
2015-01-01
as a materialization of a stranger king myth, with the ship‐setting reproducing the narrative of the founding of the dynasty by an immigrant forefather, and the burial mounds conveying the idea of the foreign king taking possession of the locals’ land. In a broader erspective, the stranger king concept and the special...
45 CFR 287.125 - What supportive and job retention services may be provided under the NEW Program?
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false What supportive and job retention services may be provided under the NEW Program? 287.125 Section 287.125 Public Welfare Regulations Relating to Public... Operations § 287.125 What supportive and job retention services may be provided under the NEW Program? The...
25 CFR 720.110 - Self-evaluation.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Self-evaluation. 720.110 Section 720.110 Indians THE...-evaluation. (a) The agency shall, by August 24, 1987, evaluate its current policies and practices, and the... or organizations representing handicapped persons, to participate in the self-evaluation process by...
50 CFR 660.720 - Interim protection for sea turtles.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Interim protection for sea turtles. 660.720 Section 660.720 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... Migratory Fisheries § 660.720 Interim protection for sea turtles. (a) Until the effective date of §§ 660.707...
ALJAAD, Nawal H.
2015-01-01
The aim of this study was to identify the efficiency of the transitional programs at the College of Applied Studies and Community Service at King Saud University. Data collection relied on the educational achievement rates of the female students enrolled in the College of Applied Studies and also the regular students at the College of Education, King Saud University, majoring in kindergarten, special education, and psychology. The study was conducted on the whole population of the fifth level...
Distribution and habitat use of king rails in the Illinois and Upper Mississippi River valleys
Darrah, Abigail J.; Krementz, David G.
2009-01-01
The migratory population of the king rail (Rallus elegans) has declined dramatically during the past 40 years, emphasizing the need to identify habitat requirements of this species to help guide conservation efforts. To assess distribution and habitat use of king rails along the Illinois and Upper Mississippi valleys, USA, we conducted repeated call-broadcast surveys at 83 locations in 2006 and 114 locations in 2007 distributed among 21 study sites. We detected king rails at 12 survey locations in 2006 and 14 locations in 2007, illustrating the limited distribution of king rails in this region. We found king rails concentrated at Clarence Cannon National Wildlife Refuge, an adjacent private Wetlands Reserve program site, and B. K. Leach Conservation Area, which were located in the Mississippi River floodplain in northeast Missouri. Using Program PRESENCE, we estimated detection probabilities and built models to identify habitat covariates that were important in king rail site occupancy. Habitat covariates included percentage of cover by tall (> 1 m) and short (wetlands that were characterized by high water-vegetation interspersion and little or no cover by woody vegetation. Our results suggest that biologists can improve king rail habitat by implementing management techniques that reduce woody cover and increase vegetation-water interspersion in wetlands.
20 CFR 405.720 - Notice of agreement to expedite appeal.
2010-04-01
....720 Section 405.720 Employees' Benefits SOCIAL SECURITY ADMINISTRATION ADMINISTRATIVE REVIEW PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Expedited Appeals Process for Constitutional Issues § 405.720 Notice of agreement to expedite appeal. If we agree that you can use the expedited appeals process...
Radiation Protection program of king a bdulaziz university at Jeddah campus
International Nuclear Information System (INIS)
Mamoon, A.; Kamal, S.M.
2001-01-01
Because of the gradual increase in the number of radiation sources on king abdulaziz university campus such that it became difficult to supervise them separately, it became necessary to establish a radiation safety program on the campus. This program covers regulations for supervising and setting safety controls for safe handing housing and operating or using the radiation sources. Inventory of all sources on campus whether machine sources or isotope sources along with their work ares are recorded. Also all the technicians and users of these sources are identified and entered in special special forms along with the nature of the work they do with the respective radiation sources. The performance of the X-ray machines are checked with respect to their expected standard performance. The generated radioactive wastes from the various isotope uses are collected, managed and kept in temporary storage for long lived wastes or stored till complete decay for short half life isotopes. Surveillance of all work area radiation environments as well as monitoring of radiation workers doses are done routinely. Records of all these data are maintained and updated regularly. The university radiation safety committee (URSC), who is responsible for the functioning of the radiation safety program, also arranges several training courses for technicians and researchers and others on the safe uses of radiation sources
Consumption of 125I labelled fibrinogen in normal subjects
International Nuclear Information System (INIS)
Langer, B.; Camargo, E.E.; Reis, J.M.M. dos; Carvalho, N.; Leao, L.E.P.
1978-01-01
The metabolism of iodine- 125 labeled human fibrinogen is studied by using three different sets of the radiopharmaceutical (0.9, 1.3 and 1.84 iodine atoms/fibrinogen molecule ratios) in 19 normal subjects. An aliquot of 40 μCi of fibrinogem- 125 I is injected in each subject, on normal dietary conditions and blood samples are withdrawn at 30, 60, 180, 36 and 720 minutes after the injection and, thereafter, one daily sample during 10 days. The compartmental distribution of the tracer is defined by plotting plasma and serum sample counts on a semilogarithmic graph paper. A rapid phase and 3 compartments are obtained. A 'rapid' consumption half-life and a 'real' consumption half-life are defined. The fibrinogen clottability is followed up to the last blood sample by checking the ratios of serum and plasma radioactivities [pt
78 FR 54512 - Proposed Collection; Comment Request for Form 720
2013-09-04
... 720, Quarterly Federal Excise Tax Return. DATES: Written comments should be received on or before November 4, 2013 to be assured of consideration. ADDRESSES: Direct all written comments to Yvette Lawrence...: Quarterly Federal Excise Tax Return. OMB Number: 1545-0023. Form Number: 720. Abstract: Form 720 is used to...
Development and Effects of FTY720 Ophthalmic Solution on Corneal Allograft Survival.
Liu, Zhaochuan; Lin, Haotian; Huang, Chulong; Chen, Wan; Xiang, Wu; Geng, Yu; Chen, Weirong
2015-11-12
Fingolimod (FTY720), a novel class of sphingosine 1-phosphate receptor modulators, has received special interest among ophthalmologists, particularly given that oral administration of FTY720 has proven to effectively treat corneal graft rejection in animal models. However, no studies have examined the performance of FTY720 as an ophthalmic solution in reducing corneal rejection in high-risk corneal rejection models, and the stability and ocular irritation profile of FTY720 ophthalmic solution are also unknown. Thus, we developed 0.1%, 0.2% and 0.5% FTY720 ophthalmic solutions and evaluated their chemical stabilities under various storage conditions with high- performance liquid chromatography. To investigate the ocular irritancy of the FTY720 ophthalmic solution, New Zealand albino rabbits were subjected to the Draize test. Furthermore, classic, well-established rat allogenic penetrating keratoplasty models were used to investigate the anti-rejection efficacy of the tested FTY720 ophthalmic solutions. We found that the non-irritating 0.5% FTY720 ophthalmic solution could prolong corneal allograft survival in rats with significant efficacy for about one month. Furthermore, no significant concentration changes occurred in any of the types of FTY720 ophthalmic solutions within three months. These results revealed crucial profiles of FTY720 ophthalmic solutions and warrant further investigation and optimization of FTY720 in the anti-rejection therapy after keratoplasty.
Dragon-Kings, Black-Swans and Prediction (Invited)
Sornette, D.
2010-12-01
Extreme fluctuations or events are often associated with power law statistics. Indeed, it is a popular belief that "wild randomness'' is deeply associated with distributions with power law tails characterized by small exponents. In other words, power law tails are often seen as the epitome of extreme events (the "Black Swan'' story). Here, we document in very different systems that there is life beyond power law tails: power laws can be superseded by "dragon-kings'', monster events that occur beyond (or changing) the power law tail. Dragon-kings reveal hidden mechanisms that are only transiently active and that amplify the normal fluctuations (often described by the power laws of the normal regime). The goal of this lecture is to catalyze the interest of the community of geophysicists across all fields of geosciences so that the "invisible gorilla" fallacy may be avoided. Our own research illustrates that new statistics or representation of data are often necessary to identify dragon-kings, with strategies guided by the underlying mechanisms. Paradoxically, the monsters may be ignored or hidden by the use of inappropriate analysis or statistical tools that amount to cut a mamooth in small pieces, so as to lead to the incorrect belief that only mice exist. In order to stimulate further research, we will document and discuss the dragon-king phenomenon on the statistics of financial losses, economic geography, hydrodynamic turbulence, mechanical ruptures, avalanches in complex heterogeneous media, earthquakes, and epileptic seizures. The special status of dragon-kings open a new research program on their predictability, based on the fact that they belong to a different class of their own and express specific mechanisms amplifying the normal dynamics via positive feedbacks. We will present evidence of these claims for the predictions of material rupture, financial crashes and epileptic seizures. As a bonus, a few remarks will be offered at the end on how the dragon-king
The King Tapestries at Kronborg Castle
DEFF Research Database (Denmark)
Reindel, Ulrik
2015-01-01
In the 1580s, Frederik II (Danish-Norwegian king, reigned 1559-1588) had the Great Hall at Kronborg Castle, Elsinore, furnished with 43 tapestries portraying no fewer than 100 Danish kings. The tapestries were arranged chronologically, beginning with King Dan, the mythological founder of the king...
[King Injo's disease and burnt needle therapy].
Kim, In-Sook
2004-12-01
This paper investigates an interrelationship between burnt needle therapy and King Injo's disease. From 1633 (Year 11 in King Injo's reign) to May 5, 1649 (Year 27 in King Injo's reign), right before his death, King Injo was treated with burnt needles by Yi Hyeongik, an acupuncturist when the king had health problems. This study arises from two questions: why was King Injo often treated with burnt needles? and what effect did burnt needles have?Burnt needle therapy is a combined form of acupuncture and moxibustion. Yi Hyeongik was famous for eradicating pathogenic factors. He was appointed as a doctor in the Royal Hospital. The medical definition for pathogenic factors is that they are disease-causing factors. Understanding the pathogenic factor for King Injo's disease could make it possible to find the interrelationship between burnt needles and the king's disease. In the Joseon ear, the prevalent belief about diseases was that diseases could be caused by homeopathic magic. Some people thought homeopathic magic caused King Injo's disease. The actual reasons for King Injo's disease were the participation in the excessive rites of Queen Mother Inmok's funeral and the constant oppression from the Ching Dynasty after disgraceful defeat in the war. When King Injo started to be sick, homeopathic magic cases were found in the royal palace. The king's incurable disease was believed to have happened as a result of homeopathic magic. King Injo's suspicion toward Princess Jeongmyeong derived from her mother, Queen Mother Inmok. Moral justification for King Injo's coup was Gwanghaegun or Prince Gwanghae's immoral conduct toward Queen Mothe Inmok. After he was installed, King Injo obeyed the Queen Mother and showed her every attention. Meanwhile, he treated Princess Jeongmyeong with respect, maximized the moral justification for the coup, and solidified the royal authority. However, constant rebellions and treasons threatened King Injo. The king suspected that Queen Mother
A program plan addressing carpal tunnel syndrome: the utility of King's goal attainment theory.
Norgan, G H; Ettipio, A M; Lasome, C E
1995-08-01
1. Today's nurse is prepared to address the needs of groups of individuals who share common characteristics or risks (aggregates). Program planning skills and ability to use nursing theory can enhance the nurse's effectiveness in addressing the needs of such aggregates. 2. Carpal tunnel syndrome and other repetitive stress injuries are very costly to industry, both in terms of monetary loss and lost work hours. Such injuries can be reduced in the workplace through careful observation and communication of trends by the nurse. 3. The systems perspective of King's goal attainment theory guided the nurse in problem solving and facilitating the development of a workplace capable of responding to trends as they occur.
African Journals Online (AJOL)
p1243322
metaphor of king is used with a realistic claim in the Biblical texts and in the. Christian ..... love their king, whatever emotional bond there might occasionally be between them. .... green” and it would be senseless to ask what kind of power God has. It does ... attitude and behavior towards God, the focus here will be on God.
11 CFR 7.20 - Gifts, entertainment, and favors.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Gifts, entertainment, and favors. 7.20 Section... of Special Commission Employees § 7.20 Gifts, entertainment, and favors. Except as provided at 11 CFR... a gift, gratuity, loan, entertainment, or favor for himself or herself, or for another person...
Local delivery of FTY720 accelerates cranial allograft incorporation and bone formation.
Huang, Cynthia; Das, Anusuya; Barker, Daniel; Tholpady, Sunil; Wang, Tiffany; Cui, Quanjun; Ogle, Roy; Botchwey, Edward
2012-03-01
Endogenous stem cell recruitment to the site of skeletal injury is key to enhanced osseous remodeling and neovascularization. To this end, this study utilized a novel bone allograft coating of poly(lactic-co-glycolic acid) (PLAGA) to sustain the release of FTY720, a selective agonist for sphingosine 1-phosphate (S1P) receptors, from calvarial allografts. Uncoated allografts, vehicle-coated, low dose FTY720 in PLAGA (1:200 w:w) and high dose FTY720 in PLAGA (1:40) were implanted into critical size calvarial bone defects. The ability of local FTY720 delivery to promote angiogenesis, maximize osteoinductivity and improve allograft incorporation by recruitment of bone progenitor cells from surrounding soft tissues and microcirculation was evaluated. FTY720 bioactivity after encapsulation and release was confirmed with sphingosine kinase 2 assays. HPLC-MS quantified about 50% loaded FTY720 release of the total encapsulated drug (4.5 μg) after 5 days. Following 2 weeks of defect healing, FTY720 delivery led to statistically significant increases in bone volumes compared to controls, with total bone volume increases for uncoated, coated, low FTY720 and high FTY720 of 5.98, 3.38, 7.2 and 8.9 mm(3), respectively. The rate and extent of enhanced bone growth persisted through week 4 but, by week 8, increases in bone formation in FTY720 groups were no longer statistically significant. However, micro-computed tomography (microCT) of contrast enhanced vascular ingrowth (MICROFIL®) and histological analysis showed enhanced integration as well as directed bone growth in both high and low dose FTY720 groups compared to controls.
The True Lion King of Africa: The Epic History of Sundiata, King of Old Mali.
Paterno, Domenica R.
David Wisniewski's 1992 picture book version of the African epic of "Sundiata, Lion King of Mali" and the actual historical account of the 13th century Lion King, Sundiata, are both badly served by Disney's "The Lion King." Disney has been praised for using African animals as story characters; for using the African landscape as…
King Injo's Disease and Burnt Needle Therapy
Directory of Open Access Journals (Sweden)
KIM In-Sook
2004-12-01
Full Text Available This paper investigates an interrelationship between burnt needle therapy(번침 and King Injo'sdisease. From 1633 (Year 11 in King Injo's reign to May 5, 1649 (Year 27 King in Injo's reign, right before his death, King Injo(인조 was treated with burnt needles by Yi Hyeongik(이형익, an acupuncturist when the king had health problems. This study arises from two questions: why was King Injo often treated with burnt needles? and what effect did burnt needles have? Burnt needle therapy is a combined form of acupuncture and moxibustion. Yi Hyeongik was famous for eradicating pathogenic factors. He was appointed as a doctor in the Royal Hospital. The medical definition for pathogenic factors is that they are disease-causing factors. Understanding the pathogenic factor for King Injo's disease could make it possible to find the interrelationship between burnt needles and the king's disease. In the Joseon era, the prevalent belief about diseases was that diseases could be caused by homeopathic magic. Some people thought homeopathic magic caused King Injo's disease. The actual reasons for King Injo's disease were the participation in the excessive rites of Queen Mother Inmok's funeral and the constant oppression from the Ching Dynasty after disgraceful defeat in the war. When King Injo started to be sick, homeopathic magic cases were found in the royal palace. The king's incurable disease was believed to have happened as a result of homeopathic magic. King Injo's suspicion toward Princess Jeongmyeong(정명공주 derived from her mother, Queen Mother Inmok(인목대비. Moral justification for King Injo's coup was Gwanghaegun(광해군 or Prince Gwanghae's immoral conduct toward Queen Mother Inmok. After he was installed, King Injo obeyed the Queen Mother and showed her every attention. Meanwhile, he treated Princess Jeongmyeong with respect, maximized the moral justification for the coup, and solidified the royal authority. However, constant
Development and Effects of FTY720 Ophthalmic Solution on Corneal Allograft Survival
Zhaochuan Liu; Haotian Lin; Chulong Huang; Wan Chen; Wu Xiang; Yu Geng; Weirong Chen
2015-01-01
Fingolimod (FTY720), a novel class of sphingosine 1-phosphate receptor modulators, has received special interest among ophthalmologists, particularly given that oral administration of FTY720 has proven to effectively treat corneal graft rejection in animal models. However, no studies have examined the performance of FTY720 as an ophthalmic solution in reducing corneal rejection in high-risk corneal rejection models, and the stability and ocular irritation profile of FTY720 ophthalmic solution...
Li, Y; Zhou, T; Wang, Y; Ning, C; Lv, Z; Han, G; Morris, J C; Taylor, E N; Wang, R; Xiao, H; Hou, C; Ma, Y; Shen, B; Feng, J; Guo, R; Li, Y; Chen, G
2017-06-29
FTY720 (also called fingolimod) is recognized as an immunosuppressant and has been approved by the Food and Drug Administration to treat refractory multiple sclerosis. However, long-term administration of FTY720 potentially increases the risk for cancer in recipients. The underlying mechanisms remain poorly understood. Herein, we provided evidence that FTY720 administration potentiated tumor growth. Mechanistically, FTY720 enhanced extramedullary hematopoiesis and massive accumulation of myeloid-derived suppressor cells (MDSCs), which actively suppressed antitumor immune responses. Granulocyte-macrophage colony-stimulating factor (GM-CSF), mainly produced by MDSCs, was identified as a key factor to mediate these effects of FTY720 in tumor microenvironment. Furthermore, we showed that FTY720 triggers MDSCs to release GM-CSF via S1P receptor 3 (S1pr3) through Rho kinase and extracellular signal-regulated kinase-dependent pathway. Thus, our findings provide mechanistic explanation for the protumorigenic potentials of FTY720 and suggest that targeting S1pr3 simultaneously may be beneficial for the patients receiving FTY720 treatment.
21 CFR 720.4 - Information requested about cosmetic products.
2010-04-01
... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Information requested about cosmetic products. 720... (CONTINUED) COSMETICS VOLUNTARY FILING OF COSMETIC PRODUCT INGREDIENT COMPOSITION STATEMENTS § 720.4 Information requested about cosmetic products. (a) Form FDA-2512 requests information on: (1) The name and...
Randomized controlled trial of FTY720 versus MMF in de novo renal transplantation.
Tedesco-Silva, Helio; Pescovitz, Mark D; Cibrik, Diane; Rees, Michael A; Mulgaonkar, Shamkant; Kahan, Barry D; Gugliuzza, Kristene K; Rajagopalan, P R; Esmeraldo, Ronaldo de M; Lord, Hélène; Salvadori, Maurizio; Slade, Jennifer M
2006-12-27
Phase II trials of FTY720, a novel immunomodulator, have shown promise in preventing rejection with both standard and reduced cyclosporine exposure. This study was designed to confirm those findings. This one-year, multicenter, randomized, phase III study in 696 de novo renal transplant patients compared FTY720 5 mg plus reduced-dose cyclosporine (RDC) or FTY720 2.5 mg plus full-dose cyclosporine (FDC) with mycophenolate mofetil (MMF) plus FDC. All patients received concomitant corticosteroid therapy without antibody induction. The primary efficacy composite endpoint was the incidence of first treated biopsy-proven acute rejection (treated BPAR), graft loss, death or premature study discontinuation at month 12. FTY720 2.5 mg plus FDC was demonstrated to be non-inferior to MMF plus FDC as the primary efficacy endpoint (30.8% and 30.6%) was comparable. The FTY720 5 mg plus RDC treatment regimen was discontinued due to an increased incidence of acute rejection episodes (primary endpoint 43.3%). FTY720 was associated with significantly lower creatinine clearance with a mean difference at 12 months between FTY720 2.5 mg plus FDC and MMF plus FDC of 8 ml/min. While FTY720 2.5 mg plus FDC yielded similar efficacy to MMF plus FDC, the FTY720 5 mg plus RDC did not allow a 50% reduction in cyclosporine exposure. The associated lower creatinine clearance indicated that FTY720 combined with cyclosporine provided no benefit over standard care.
2010-04-01
... TREASURY LIQUORS LABELING AND ADVERTISING OF MALT BEVERAGES Labeling Requirements for Malt Beverages § 7.20... permission to relabel shall be accompanied by two complete sets of the old labels and two complete sets of...
32 CFR 720.20 - Service of process upon personnel.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Service of process upon personnel. 720.20... DELIVERY OF PERSONNEL; SERVICE OF PROCESS AND SUBPOENAS; PRODUCTION OF OFFICIAL RECORDS Service of Process and Subpoenas Upon Personnel § 720.20 Service of process upon personnel. (a) General. Commanding...
DEFF Research Database (Denmark)
Fattoum, Asma
2013-01-01
This study investigates the King vs. Rich dilemma that founder-CEOs face at IPO. When undertaking IPO, founders face two options. They can either get rich, but then run the risk of losing the control over their firms; or they can remain kings by introducing defensive mechanisms, but this is likel...
Gallagher, Mary Grace
2009-01-01
This year marks the 40th anniversary of the first Coretta Scott King Book Award, which encourages "the artistic expression of the black experience via literature and the graphic arts." The award, which began honoring illustrators in 1974, added the John Steptoe Award for New Talent in 1995. No doubt, past King award winners like Sharon Flake,…
20 CFR 404.720 - Evidence of a person's death.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Evidence of a person's death. 404.720 Section... INSURANCE (1950- ) Evidence Evidence of Age, Marriage, and Death § 404.720 Evidence of a person's death. (a) When evidence of death is required. If you apply for benefits on the record of a deceased person, we...
Views of Dr. Martin Luther King, Jr.
Davis, Alan H.
1990-01-01
Discusses views of Martin Luther King, Jr., including concepts of human rights, related counseling approaches, and ethics. Claims King's views provide helpful insights for counselors and clients. Concludes King invited individuals to view challenging life situations as moral opportunities. (Author/ABL)
24 CFR 572.125 - Replacement reserves.
2010-04-01
...) Homeownership Program Requirements-Implementation Grants § 572.125 Replacement reserves. (a) Purpose. A single replacement reserve may be established for the homeownership program only if HUD determines it is necessary to... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Replacement reserves. 572.125...
DEFF Research Database (Denmark)
Suwannakij, Sing
King and Eye explores the visual formation of kingship in Siam in its multifarious aspects. This dissertation identifies the leitmotifs in the dynamics between seeing the king and being seen by him, which burst forth in different eras. The visual sense has been a repository for the ontologization...... devices, most significantly the photographic and the cine cameras, but also encompassing other ocular apparatuses. The images produced through the contraptions were brought together under the royal eye at the apex, which in turn claimed its supremacy over space, time, and the vast and diverse population...
37 CFR 1.720 - Conditions for extension of patent term.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Conditions for extension of patent term. 1.720 Section 1.720 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES Adjustment and Extension of...
5 CFR 720.901 - Equal opportunity without regard to politics or marital status.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Equal opportunity without regard to politics or marital status. 720.901 Section 720.901 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... Regard to Politics or Marital Status § 720.901 Equal opportunity without regard to politics or marital...
King County Metro Battery Electric Bus Demonstration: Preliminary Project Results
Energy Technology Data Exchange (ETDEWEB)
2017-05-22
The U.S. Federal Transit Administration (FTA) funds a variety of research projects that support the commercialization of zero-emission bus technology. To evaluate projects funded through these programs, FTA has enlisted the help of the National Renewable Energy Laboratory (NREL) to conduct third-party evaluations of the technologies deployed under the FTA programs. NREL works with the selected agencies to evaluate the performance of the zero-emission buses compared to baseline conventional buses in similar service. The evaluation effort will advance the knowledge base of zero-emission technologies in transit bus applications and provide 'lessons learned' to aid other fleets in incrementally introducing next generation zero-emission buses into their operations. This report provides preliminary performance evaluation results from a demonstration of three zero-emission battery electric buses at King County Metro in King County, Washington. NREL developed this preliminary results report to quickly disseminate evaluation results to stakeholders. Detailed evaluation results will be published in future reports.
32 CFR 720.32 - Certificates of full faith and credit.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Certificates of full faith and credit. 720.32... Official Records § 720.32 Certificates of full faith and credit. The Judge Advocate General, the Deputy... full faith and credit certifying the signatures and authority of officers of the Department of the Navy...
21 CFR 556.720 - Tetracycline.
2010-04-01
..., FEEDS, AND RELATED PRODUCTS TOLERANCES FOR RESIDUES OF NEW ANIMAL DRUGS IN FOOD Specific Tolerances for Residues of New Animal Drugs § 556.720 Tetracycline. (a) Acceptable daily intake (ADI). The ADI for total... tissues of calves, swine, sheep, chickens, and turkeys, of 2 parts per million (ppm) in muscle, 6 ppm in...
Indian Academy of Sciences (India)
Elected: 1998 Honorary. King, Prof. Sir David Anthony Sc.D., FRS. Date of birth: 12 August 1939. Address: Chief Scientific Adivser & Head, Office of Science and Innovation, London SW1H 0ET, U.K.. Contact: Office: (+44-020) 7215 3821. Fax: (+44-020) 7215 0314. Email: mpst.king@dti.gsi.gov.uk, dak10@cus.cam.ac.uk.
Osornio, Ismael Jose Duran
2004-01-01
The leadership of the Norwegian Kings during the Medieval ‘Civil War’ plays a prominent part in social, political and economical life in high Medieval Norway. The objective of the present dissertation discusses how King Sverre Sigurdsson (1177-1202) and Haakon Haakonsson (1217-1263) are depicted in their Sagas. The work will be focus on four analytical tools: 1. The Kings’ Charisma; 2. The Kings’ Personal Abilities; 3. The Kings’ Bureaucracy; 4. The King’s closest Fellows. The thesis goal wil...
24 CFR 125.201 - Administrative Enforcement Initiative.
2010-04-01
... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...
Kinematics analysis technique fouettes 720° classic ballet.
Directory of Open Access Journals (Sweden)
Li Bo
2011-07-01
Full Text Available Athletics practice proved that the more complex the item, the more difficult technique of the exercises. Fouettes at 720° one of the most difficult types of the fouettes. Its implementation is based on high technology during rotation of the performer. To perform this element not only requires good physical condition of the dancer, but also requires possession correct technique dancer. On the basis corresponding kinematic theory in this study, qualitative analysis and quantitative assessment of fouettes at 720 by the best Chinese dancers. For analysis, was taken the method of stereoscopic images and the theoretical analysis.
Characterization of the complete mitochondrial genome of the king pigeon (Columba livia breed king).
Zhang, Rui-Hua; He, Wen-Xiao; Xu, Tong
2015-06-01
The king pigeon is a breed of pigeon developed over many years of selective breeding primarily as a utility breed. In the present work, we report the complete mitochondrial genome sequence of king pigeon for the first time. The total length of the mitogenome was 17,221 bp with the base composition of 30.14% for A, 24.05% for T, 31.82% for C, and 13.99% for G and an A-T (54.22 %)-rich feature was detected. It harbored 13 protein-coding genes, two ribosomal RNA genes, 22 transfer RNA genes, and one non-coding control region (D-loop region). The arrangement of all genes was identical to the typical mitochondrial genomes of pigeon. The complete mitochondrial genome sequence of king pigeon would serve as an important data set of the germplasm resources for further study.
5 CFR 720.204 - Agency programs.
2010-01-01
... continuing program for the recruitment of minorities and women for positions in the agency and its components... out as part of their periodic performance appraisals. (b) Programs established under this subpart must... underrepresentation in the agency work force. ...
Kim, M.; Lee, I.; Lee, J.; Park, B.; Mayer, B.; Kaufman, A. J.; Park, S.; Kim, G.; Lee, K.
2008-12-01
Isotopic compositions of sulfur (δ34S) and oxygen (δ18O) were measured for the sulfate of the fresh water near the King Sejong Station, King George Island, Antarctica. Sejong station is located in the Barton peninsular of the King George Island. The geology around King Sejong station mainly composed of basalt-andesite, quart monzodiorite, and granodiorite. Lapilli tuff, conglomerate, sandstone, and siltstone occur along the southern and eastern shore of the Barton peninsula. Lapilli tuff also occurs on the highland located on southeastern part of the Barton peninsula. The δ34S values of sulfate extracted from fresh water samples at King Sejong Station range from 13.7 to 16.3 per mil excluding 1 sample. These sulfur values are very narrow in their range compared with those from anthropogenic sources. These sulfur values are 5 to 7 per mil lower than those of typical present seawater. Considering the rocks occurring near the King Sejong station, these sulfur isotopic values do not seem to be related to any evaporites of certain age. In Antarctic region the natural source of sulfate dissolved in water could be originated from marine biogenic source (DMS), sea-salt, volcanic source, or other continental sources. Most of the δ34S values of sulfate at King Sejong station seems to indicate the dominance of marine biogenic origin for the source of sulfur. The δ18O values of sulfate extracted from fresh water samples at King Sejong Station range from 1.9 to 6.4 per mil excluding 1 sample. These oxygen isotope values are lower than those of the sulfate in the present seawater by 6 per mil. However, both sulfur and oxygen isotope values strongly represent the influence of the seawater sulfate. One sample have 2.6 and -1.1 per mil in its δ34S and δ18O values, respectively, that are quite different from the isotopic values of other samples. This sample was collected in the highland far from the King Sejong station. Therefore this sample might reflect the composition of
Goldie Brangman Remembers the Operation to Save Dr King.
Koch, Evan; Brangman, Goldie
2015-12-01
In September 1958 the Rev Dr Martin Luther King Jr was stabbed and nearly assassinated. Surgeons at Harlem Hospital in New York City removed a 17.8-cm (7-in)-long letter opener from Dr King's chest. Certified Registered Nurse Anesthetist Goldie Brangman remembers this event because she participated in Dr King's anesthetic. This article correlates Brangman's memories with published accounts of the event. It also places the event within the context of the modern civil rights movement that Dr King led.
John Davies of Hereford, the King of Denmark & Shakespeare's Meeting of Kings: Praise Beyond Praise
DEFF Research Database (Denmark)
Sterrett, Joseph William
2016-01-01
This article traces the response and style of John Davies of Hereford, 'an ordinary man' as he celebrated an extraordinary event, the state visit of the King of Denmark to the court of James I in 1606. It then draws comparisons to Shakespeare's meeting of kings some seven or eight years later...... at the beginning of the late history play, All is True, suggesting that the earlier poet's experience influenced the latter....
Kikuchi, Takashi; Maekawa, Yukina; Tomio, Arisa; Masumoto, Yuki; Yamamoto, Taishi; In, Yasuko; Yamada, Takeshi; Tanaka, Reiko
2016-11-01
Six new ergostane-type steroids; (22E)-3β,5α,6α,11-tetrahydroxy-9(11)-seco-ergosta-7,22-dien-9-one (1), (22E)-8,14-epoxyergosta-6,22-diene-3β,5α,9α-triol (2), (22E)-4α,5α-epoxyergosta-7,22-diene-3β,6β-diol (3), (22E)-3β,4β,5α-trihydroxyergosta-7,22-dien-6-one (4), (22E)-ergosta-7,22-diene-3β,5β,6α-triol (5), and (22E)-6β-methoxyergosta-7,22-diene-3β,5α-diol 3-O-β-d-glucopyranoside (6) were isolated from the fruiting bodies of king trumpet mushroom (Pleurotus eryngii), along with fourteen known compounds (7-20). All isolated compounds were evaluated for their inhibitory effects on macrophage activation using a nitric oxide production inhibition assay. Copyright © 2016. Published by Elsevier Inc.
24 CFR 125.501 - Fair Housing Organizations Initiative.
2010-04-01
... Initiative. 125.501 Section 125.501 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.501 Fair Housing Organizations Initiative. (a) The Fair Housing Organizations Initiative of the FHIP provides funding to develop or expand the ability of...
Prescribed burning in the Kings River Ecosystem Project Area: lessons learned
David S. McCandliss
2002-01-01
The prescribed fire program on the Sierra National Forest is in its infancy. Prescription burning was initiated in 1994 in two 32,000-acre watersheds in the Kings River District of the Sierra National Forest. Primary objectives are to return fire to a more historical role in forest ecosystems and to provide opportunities for scientists from the Pacific Southwest...
King Kong tuli unenäost / Alar Niineväli
Niineväli, Alar
2005-01-01
Hiigelgorilla King Kongi sünd kinolinal 1933.a. Merian C. Cooperi õudusfilmis "King Kong" ja koletise hilisemad tulemised, ka koos jaapanlaste Godzillaga (1962) ja Tarzaniga india filmis "Tarzan ja King Kong" (1965)
Single-dose FTY720 pharmacokinetics, food effect, and pharmacological responses in healthy subjects
Kovarik, John M; Schmouder, Robert; Barilla, Denise; Wang, Yibin; Kraus, Gerolf
2004-01-01
Aims FTY720 is a sphingosine-1-phosphate receptor agonist that redirects lymphocytes from the circulation to lymph nodes without impairing lymphocyte function. It is being developed as an immunomodulator for the prevention of acute rejection after organ transplantation. This study was performed to provide guidance on administration with respect to meals and to measure pharmacologic responses in healthy subjects. Methods In this randomized, two-period, crossover study, 14 healthy subjects received placebo on day −1 of each period with baseline circadian measurements of lymphocyte count and heart rate. Subjects subsequently received a single 1 mg oral dose of FTY720 on day 1 under fasting conditions and after a high fat meal. Blood FTY720 concentrations, lymphocyte count, and supine heart rate were assessed over an 8 day period after each FTY720 dose. The effect of food on FTY720 pharmacokinetics was assessed by standard bioequivalence testing. Results Both the peak concentration (0.65 ± 0.17 vs 0.64 ± 0.18 ng ml−1) and total exposure (AUC 149 ± 65 vs 139 ± 43 ng ml−1 h) did not differ significantly between fasting and fed states, respectively. The corresponding fed/fasting ratios and 90% confidence intervals were 1.00 (0.86, 1.17) for Cmax and 0.98 (0.86, 1.11) for AUC. Under both treatment conditions peripheral blood lymphocyte count decreased from baseline by 38 ± 9% over the first 2 days postdose and then increased towards predose values over the subsequent week. Whereas a circadian rhythm in supine heart rate was preserved in the presence of FTY720, the heart rate vs time curve was shifted downwards by 10% over the first day postdose and then recovered to prestudy values by days 3–5 postdose. These changes were asymptomatic. Conclusions Single 1 mg doses of FTY720 were well tolerated in healthy subjects and elicited a moderate decrease in peripheral blood lymphocyte count and a transient decrease in heart rate consistent with its pharmacological
Wang, Junjuan; Wang, Jiaqiu; Lu, Ping; Cai, Youzhi; Wang, Yafei; Hong, Lan; Ren, Hao; Heng, Boon Chin; Liu, Hua; Zhou, Jing; Ouyang, Hongwei
2015-09-01
FTY720 has recently been approved as an oral drug for treating relapsing forms of multiple sclerosis, and exerts its therapeutic effect by acting as an immunological inhibitor targeting the sphingosine-1-phosphate (S1P) receptor subtype (S1P1) of T cells. Recently studies demonstrated positive efficacy of this drug on spinal cord injury (SCI) in animal models after systemic administration, albeit with significant adverse side effects. We hereby hypothesize that localized delivery of FTY720 can promote SCI recovery by reducing pathological astrogliosis. The mechanistic functions of FTY720 were investigated in vitro and in vivo utilizing immunofluorescence, histology, MRI and behavioral analysis. The in vitro study showed that FTY720 can reduce astrocyte migration and proliferation activated by S1P. FTY720 can prolong internalization of S1P1 and exert antagonistic effects on S1P1. In vivo study of SCI animal models demonstrated that local delivery of FTY720 with polycaprolactone (PCL) membrane significantly decreased S1P1 expression and glial scarring compared with the control group. Furthermore, FTY720-treated groups exhibited less cavitation volume and neuron loss, which significantly improved recovery of motor function. These findings demonstrated that localized delivery of FTY720 can promote SCI recovery by targeting the S1P1 receptor of astrocytes, provide a new therapeutic strategy for SCI treatment. Copyright © 2015 Elsevier Ltd. All rights reserved.
10 CFR 26.125 - Licensee testing facility personnel.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Licensee testing facility personnel. 26.125 Section 26.125 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Licensee Testing Facilities § 26.125... reports, if any; results of tests that establish employee competency for the position he or she holds...
Pessoa’s myth of the King Sebastian reinterpreted
Monika Świda
2013-01-01
The present paper depicts alterations undergone by the sleeping king motif (sebastianism) in the writings of Fernando Pessoa. The data to conduct the study were collected in thematic anthologies and several unpublished pieces. The myth of the King Sebastian was given a congregational dimension by Pessoa, thus conveying his cultural and identity project subsumed under the metaphor of the spiritual empire. Pessoa introduces some readjustments in the way the historical king is to be conceived of...
75 FR 34307 - King Kamehameha Day, 2010
2010-06-16
... Kamehameha Day, 2010 By the President of the United States of America A Proclamation Two hundred years ago, King Kamehameha the Great brought the Hawaiian Islands together under a unified government. His courage...'s concern for public safety.'' On this bicentennial King Kamehameha Day, we celebrate the history...
Directory of Open Access Journals (Sweden)
Emilio Satoshi Hara
Full Text Available Dental pulp cells (DPCs are known to be enriched in stem/progenitor cells but not well characterized yet. Small non-coding microRNAs (miRNAs have been identified to control protein translation, mRNA stability and transcription, and have been reported to play important roles in stem cell biology, related to cell reprogramming, maintenance of stemness and regulation of cell differentiation. In order to characterize dental pulp stem/progenitor cells and its mechanism of differentiation, we herein sorted stem-cell-enriched side population (SP cells from human DPCs and periodontal ligament cells (PDLCs, and performed a locked nucleic acid (LNA-based miRNA array. As a result, miR-720 was highly expressed in the differentiated main population (MP cells compared to that in SP cells. In silico analysis and a reporter assay showed that miR-720 targets the stem cell marker NANOG, indicating that miR-720 could promote differentiation of dental pulp stem/progenitor cells by repressing NANOG. Indeed, gain-and loss-of-function analyses showed that miR-720 controls NANOG transcript and protein levels. Moreover, transfection of miR-720 significantly decreased the number of cells positive for the early stem cell marker SSEA-4. Concomitantly, mRNA levels of DNA methyltransferases (DNMTs, which are known to play crucial factors during stem cell differentiation, were also increased by miR-720 through unknown mechanism. Finally, miR-720 decreased DPC proliferation as determined by immunocytochemical analysis against ki-67, and promoted odontogenic differentiation as demonstrated by alizarin red staining, as well as alkaline phosphatase and osteopontin mRNA levels. Our findings identify miR-720 as a novel miRNA regulating the differentiation of DPCs.
40 CFR 1065.720 - Liquefied petroleum gas.
2010-07-01
... may use fuel that your in-use engines normally use, such as commercial-quality liquefied petroleum gas... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Liquefied petroleum gas. 1065.720... CONTROLS ENGINE-TESTING PROCEDURES Engine Fluids, Test Fuels, Analytical Gases and Other Calibration...
21 CFR 720.2 - Times for filing.
2010-04-01
... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) COSMETICS VOLUNTARY FILING OF COSMETIC PRODUCT INGREDIENT COMPOSITION STATEMENTS § 720.2 Times for filing. Within 180 days after forms are made available to the industry, Form FDA 2512 should be filed for each cosmetic...
32 CFR 720.23 - Naval prisoners as witnesses or parties in civilian courts.
2010-07-01
... assume responsibility for the prisoner while he is in its custody; and (3) that the civilian authority... civilian courts. 720.23 Section 720.23 National Defense Department of Defense (Continued) DEPARTMENT OF THE... civilian courts. (a) Criminal actions. When Federal or State authorities desire the attendance of a naval...
The King's Ring: A Matter of Trust
DEFF Research Database (Denmark)
Sterrett, Joseph William
2018-01-01
This essay examines the material and social effects of an exchange of trust between a king, Henry VIII, and his counsellor, Thomas Cranmer in Shakespeare and Fletcher’s All is True. The ring that the King gives Cranmer is both nothing and everything: nothing in that it could be anything, any ring...
Sideband Separating Mixer for 600-720 GHz
Khudchenko, Andrey; Hesper, Ronald; Barychev, Andrey; Gerlofma, Gerrit; Mena, Patricio; Zijlstra, Tony; Klapwijk, Teun; Spaans, Marco; Kooi, Jacob W.; Zhang, C; Zhang, XC; Siegel, PH; He, L; Shi, SC
2010-01-01
The ALMA Band 9 receiver cartridge (600-720 GHz) based on Dual Sideband (DSB) superconductor-insulator-superconductor (SIS) mixer is currently in full production. In the case of spectral line observations, the integration time to reach a certain signal-to-noise level can be reduced by about a factor
Directory of Open Access Journals (Sweden)
Nahla Khamis Ragab Ibrahim
2011-03-01
Full Text Available Summary: The present study was conducted to assess knowledge and attitude of unmarried female students in King Abdul-Aziz University (KAU towards premarital screening (PMS program, to determine predictors of high students’ knowledge scores and to improve their knowledge about PMS through conduction of an educational campaign. Multi-stage stratified random sample method was used with recruitment of 1563 students from all faculties of KAU, during the educational year 2008–2009. The Pre-test included 30 knowledge items and 14 attitude statements with student's response through a 5-point Likert scale. Health education was conducted using audiovisual aids through pre-designed educational materials. Statistical analysis was done by SPSS version 16. Results: Students’ knowledge about the program was generally low before the educational campaign. The predictors of high knowledge scores were being a health science student (aOR = 4.15; 95% CI: 2.97–5.81, age ≥20 years (aOR = 2.78; 95% CI: 2.01–3.85, family history of hereditary diseases and income ≥10,000 SR/month. Regarding attitude, almost all students (99.0% agreed on the importance of PMS. After the educational program, students’ knowledge about PMS was markedly improved. The mean students’ knowledge score was 9.85 ± 5.36 in Pre-test and improved to 18.45 ± 4.96 in Post-test, with a highly statistical significant difference (paired t = 25.40, p < 0.000. Conclusion and recommendations: The educational program was successful in improving students’ knowledge about the PMS. Conduction of similar educational programs and adding PMS in the curriculum of secondary and university education are recommended. Keywords: Premarital, Screening, University students, Educational program, Jeddah, KSA
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Nantucket Sound, Vineyard Sound, Buzzards Bay, Narragansett Bay, MA, Block Island Sound and easterly entrance to Long Island Sound, NY. 7.20 Section 7.20... Atlantic Coast § 7.20 Nantucket Sound, Vineyard Sound, Buzzards Bay, Narragansett Bay, MA, Block Island...
78 FR 5247 - Martin Luther King, Jr., Federal Holiday, 2013
2013-01-24
..., 2013 Martin Luther King, Jr., Federal Holiday, 2013 By the President of the United States of America A... thousands upon thousands rallying for jobs and freedom, the Reverend Dr. Martin Luther King, Jr., delivered... Constitution and the laws of the United States, do hereby proclaim January 21, 2013, as the Martin Luther King...
The Newest Monument: The Martin Luther King, Jr. National Memorial
Social Studies and the Young Learner, 2011
2011-01-01
This article features the newest monument, the Martin Luther King, Jr. National Memorial. The memorial on the National Mall in Washington, D.C., honoring Dr. Martin Luther King, Jr. will be an engaging landscape experience to convey four fundamental and recurring themes throughout Dr. King's life--democracy, justice, hope, and love. Natural…
African Journals Online (AJOL)
p1243322
the “king” metaphor for God is conceptually explained in terms of the relationship ... key metaphors, then it is essential to a God-talk that is grounded in the .... Jesus are both king (cf Eph 5:5), which means that God shares his kingship with the ...
41 CFR 101-4.125 - Effect of other requirements.
2010-07-01
... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.125 Effect of... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effect of other requirements. 101-4.125 Section 101-4.125 Public Contracts and Property Management Federal Property Management...
24 CFR 125.401 - Private Enforcement Initiative.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Private Enforcement Initiative. 125... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.401 Private Enforcement Initiative. (a) The Private Enforcement Initiative provides funding on a single-year or multi-year basis, to investigate violations and...
Energy Technology Data Exchange (ETDEWEB)
Isturiz, J [Centre de Radiotherapie du Parc, Dijon (France)
2001-07-01
It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems. [Spanish] Trata sobre presentacion fisica de las fuentes, radioproteccion, modelo matematico de las fuentes I-125 modelo 6711, datos considerados en el programa de calculo, comprobacion experimental de la distribucion de dosis, tasa de exposicion y actividad aparente, tecnicas de utilizacion de las fuentes I-125; y los sistemas de planificacion del calculo de las dosis.
Simulation model for the Boeing 720B aircraft-flight control system in continuous flight.
1971-08-01
A mathematical model of the Boeing 720B aircraft and autopilot has been derived. The model is representative of the 720B aircraft for continuous flight within a flight envelope defined by a Mach number of .4 at 20,000 feet altitude in a cruise config...
32 CFR 720.21 - Members or civilian employees subpoenaed as witnesses in State courts.
2010-07-01
...) DEPARTMENT OF THE NAVY PERSONNEL DELIVERY OF PERSONNEL; SERVICE OF PROCESS AND SUBPOENAS; PRODUCTION OF OFFICIAL RECORDS Service of Process and Subpoenas Upon Personnel § 720.21 Members or civilian employees... (e.g., Medical Care Recovery Act cases), follow the procedures described in § 720.22. If State...
40 CFR 7.125 - Coordination with other agencies.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Coordination with other agencies. 7.125 Section 7.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL ASSISTANCE FROM THE ENVIRONMENTAL PROTECTION AGENCY Agency...
Directory of Open Access Journals (Sweden)
Anthony D. Foster
2017-01-01
Full Text Available Acute ischemia-reperfusion injury (IRI of the extremities leads to local and systemic inflammatory changes which can hinder limb function and can be life threatening. This study examined whether the administration of the T-cell sequestration agent, FTY720, following hind limb tourniquet-induced skeletal muscle IRI in a rat model would attenuate systemic inflammation and multiple end organ injury. Sprague-Dawley rats were subjected to 1 hr of ischemia via application of a rubber band tourniquet. Animals were randomized to receive an intravenous bolus of either vehicle control or FTY720 15 min after band placement. Rats (n=10/time point were euthanized at 6, 24, and 72 hr post-IRI. Peripheral blood as well as lung, liver, kidney, and ischemic muscle tissue was analyzed and compared between groups. FTY720 treatment markedly decreased the number of peripheral blood T cells (p<0.05 resulting in a decreased systemic inflammatory response and lower serum creatinine levels and had a modest but significant effect in decreasing the transcription of injury-associated target genes in multiple end organs. These findings suggest that early intervention with FTY720 may benefit the treatment of IRI of the limb. Further preclinical studies are necessary to characterize the short-term and long-term beneficial effects of FTY720 following tourniquet-induced IRI.
International Nuclear Information System (INIS)
Dubiez-Le Goff, Sophie; Couturier, Raphaeel; Guetaz, Laure; Burlet, Helene
2004-01-01
Powder metallurgy processed Udimet 720 is a high creep strength nickel-based superalloy considered for high temperature turbine disks for nuclear gas cooled reactors working under 700 deg. C. Both fine-grained and coarse-grained microstructures have been obtained by applying respectively a subsolvus or a supersolvus solution treatments, followed by ageing treatments. In both microstructures, the distribution of the strengthening γ' precipitates has been characterized by transmission electron microscopy (TEM). The creep curves of the coarse-grained microstructure show the three usual creep stages. On the contrary, the creep curves of the fine-grained microstructure show a transition directly from primary to apparent tertiary creep without any obvious steady state. According to TEM analyses, Orowan loops surround Udimet 720 CR γ' and U720 HS γ' at high stress whereas U720 HS γ' are sheared at low stress. To describe the behavior of the superalloy Udimet 720, a specific creep model is developed on the basis of McLean and Dyson models including physical damage parameters
Quantitative analysis of characteristics of structure of metal on ''Kvantimet-720''
International Nuclear Information System (INIS)
Voronin, Yu.V.; Doronicheva, V.P.; Zueva, I.B.; Charchyan, G.Z.
1977-01-01
A method is presented for determining the volume characteristics of the grain structure of a metal with the aid of the automatic ''Kvantimet-720'' apparatus. The sizes of grains of a metallic section are measured in the apparatus with the aid of random secants (chords). The scanning of a single image field is equivalent to the analysis of 720 parallel secants. The subject of the investigation are specimens of molybdenum after deformation and annealing, prepared as metallographic sections and etched chemically to bring forth the grain boundaries. The employed conditions are based on the principle of a ''largest'' chord, i.e., in each field of the image the ''Kvantimet-720'' takes accont of chords of dimensions larger than a dimension specified on each of the 8 channels of modulus of the size distributior. The obtained histograms of the distribution of true dimensions of grains indicate that the asymmetry of the distribution of grains after the deformation and the low-temperature annealings is due to a pronounced difference in the size of grains, said difference falling off in the course of recrystallization
[A study of treatise on medicine by King Sejo].
Hwang, Im-kyung; Hwang, Sang-lk
2003-12-01
This paper explores historical backgrounds and contents of Treatise on Medicine written by King Sejo (r. 1455-1468) including his views on traditional medicine and pharmacy in the early Chosen period. The Treatise declared by King Sejo in 1463 has been considered as an important and unique manual of medicine because it was the exclusive example written by the king of Chosen. It was the King Sejo' s era when the medical milieu in both social and medical aspects was highly encouraged thanks to the previous achievements by King Sejong the Great (r.1418-1450). King Sejo, in particular, who was much interested in practical learning called 'Miscellaneous Studies', emphasized on court medicine. His writing can be understood in such historical frame. Another reason why he wrote the Treatise can be said that he felt necessary for establishing the medical ethic codes for inefficient court medicine-officials. In personal background, he tried to find available remedies since he had been suffered from some chronic diseases. The contents of the Treatise can be broadly fallen to the clinical and ethical aspects. In the former one, the Treatise focuses on treatment without hesitation through the sharp and exact diagnosis by medical doctors. In the latter one, eight categories of medical doctors are discussed according to their moral degrees: sim'eui, sik'eui, yak'eui, hon'eui, kwang eui, mang'eui, sa'eui, and sal'eui. Finally, musim' ji-eui was supplemented. Among them, sal'eui, medicine-official lacking both medical ability and ethical attitude, was classified as the lowest degree; sim'eui, medicine-official sincerely making his all efforts for patients, was thought to be a paragon of medical morality. In conclusion, the Treatise on Medicine by King Sejo played an important role as a manual for the principle of medical practice and for the instruction to enhance ethical attitude among medicine-officials.
DEFF Research Database (Denmark)
Barnow, Niels Finn
2001-01-01
The City of the Divine King deals with urban systems and urban architecture in the river kingdoms of the Near East and the agrarian societies of the Orient. The book is part of a larger work comprising studies of the antique Greek world and the Roman Empire and the later developments of cities...... and villages in medieval Europe. The City of the Divine King is followed by volume 2: The City of the Landowner, about the Greco-Roman World, and volume 3: The City of the Merchant, about the medieval urban development in Europe....
Evolution of king crabs from hermit crab ancestors
Cunningham, C. W.; Blackstone, N. W.; Buss, L. W.
1992-02-01
KING crabs (Family Lithodidae) are among the world's largest arthropods, having a crab-like morphology and a strongly calcified exoskeleton1-6. The hermit crabs, by contrast, have depended on gastropod shells for protection for over 150 million years5,7. Shell-living has constrained the morphological evolution of hermit crabs by requiring a decalcified asymmetrical abdomen capable of coiling into gastropod shells and by preventing crabs from growing past the size of the largest available shells1-6. Whereas reduction in shell-living and acquisition of a crab-like morphology (carcinization) has taken place independently in several hermit crab lineages, and most dramatically in king crabs1-6, the rate at which this process has occurred was entirely unknown2,7. We present molecular evidence that king crabs are not only descended from hermit crabs, but are nested within the hermit crab genus Pagurus. We estimate that loss of the shell-living habit and the complete carcinization of king crabs has taken between 13 and 25 million years.
Human resources managers as custodians of the King III code
Directory of Open Access Journals (Sweden)
Frank de Beer
2015-05-01
Full Text Available The objective of this research was to perform an exploratory study on the knowledge and understanding of the King III code among Human Resources (HR managers in South African companies. The King III code is a comprehensive international corporate governance regime which addresses the financial, social, ethical and environmental practices of organisations. HR management plays a role in managing corporate governance by using the King III code as a guideline. The main research questions were: Does HR management know, understand, apply, and have the ability to use the King III code in terms of ethical decision-making? What role does HR management play in corporate governance? A random sample of available HR managers, senior HR consultants and HR directors was taken and semi-structured interviews were conducted. The results indicated that the respondents had no in-depth knowledge of the King III code. They did not fully understand the King III code and its implications nor did they use it to ensure ethical management. The themes most emphasised by the participants were: culture, reward and remuneration, policies and procedures and performance management. The participants emphasised the importance of these items and HR’s role in managing them.
Widespread and evolutionary analysis of a MITE family Monkey King in Brassicaceae.
Dai, Shutao; Hou, Jinna; Long, Yan; Wang, Jing; Li, Cong; Xiao, Qinqin; Jiang, Xiaoxue; Zou, Xiaoxiao; Zou, Jun; Meng, Jinling
2015-06-19
Miniature inverted repeat transposable elements (MITEs) are important components of eukaryotic genomes, with hundreds of families and many copies, which may play important roles in gene regulation and genome evolution. However, few studies have investigated the molecular mechanisms involved. In our previous study, a Tourist-like MITE, Monkey King, was identified from the promoter region of a flowering time gene, BnFLC.A10, in Brassica napus. Based on this MITE, the characteristics and potential roles on gene regulation of the MITE family were analyzed in Brassicaceae. The characteristics of the Tourist-like MITE family Monkey King in Brassicaceae, including its distribution, copies and insertion sites in the genomes of major Brassicaceae species were analyzed in this study. Monkey King was actively amplified in Brassica after divergence from Arabidopsis, which was indicated by the prompt increase in copy number and by phylogenetic analysis. The genomic variations caused by Monkey King insertions, both intra- and inter-species in Brassica, were traced by PCR amplification. Genomic sequence analysis showed that most complete Monkey King elements are located in gene-rich regions, less than 3kb from genes, in both the B. rapa and A. thaliana genomes. Sixty-seven Brassica expressed sequence tags carrying Monkey King fragments were also identified from the NCBI database. Bisulfite sequencing identified specific DNA methylation of cytosine residues in the Monkey King sequence. A fragment containing putative TATA-box motifs in the MITE sequence could bind with nuclear protein(s) extracted from leaves of B. napus plants. A Monkey King-related microRNA, bna-miR6031, was identified in the microRNA database. In transgenic A. thaliana, when the Monkey King element was inserted upstream of 35S promoter, the promoter activity was weakened. Monkey King, a Brassicaceae Tourist-like MITE family, has amplified relatively recently and has induced intra- and inter-species genomic
Den radikale Kings skandinaviske drøm
DEFF Research Database (Denmark)
Brøndal, Jørn
2013-01-01
I dag forgudes Martin Luther King for sin racemæssige vision. Derimod aner de fleste amerikanere ikke noget om hans økonomiske ideer, og hvis de gjorde, ville mange af dem utvivlsomt affeje dem som alt for radikale......I dag forgudes Martin Luther King for sin racemæssige vision. Derimod aner de fleste amerikanere ikke noget om hans økonomiske ideer, og hvis de gjorde, ville mange af dem utvivlsomt affeje dem som alt for radikale...
The philosophical premises of the second King Report on corporate governance
Directory of Open Access Journals (Sweden)
G.J. Rossouw
2005-07-01
Full Text Available This article focuses on the philosophical presuppositions of the second King Report on corporate governance for South Africa (hereafter referred to as the King II Report. Especially in the “Introduction and Background” section of the King II Report it is clear that the Report is premised upon a specific understanding of the present-day corporation and its moral obligations. The purpose of this article is to commit what Charles Taylor called “an act of retrieval” in which the philosophical premises of the King II Report will be unearthed and exposed. It will be argued that the view of the present-day corporation that underlies the King II Report could be related back to a number of debates on the notion of the comtemporary corporation and its moral responsibilities that have been played out since the 1970s. It will be indicated how these debates provide the philosophical foundations for the view of the comtemporary corporation and its moral obligations that is espoused in the King II Report. The claim made in the Report that the African world view and culture influenced the Report’s notion of corporate governance will also be critically reviewed. Finally it will be attempted to evaluate to what extent the recommendations of the King II Report live up to its own philosophical premises.
Chilean Antarctic Stations on King George Island
Directory of Open Access Journals (Sweden)
Katsutada Kaminuma
2000-07-01
Full Text Available The purpose of my visit to Chilean Antarctic Stations was to assess the present status of geophysical observations and research, as the South Shetland Island, West Antarctica, where the stations are located, are one of the most active tectonic regions on the Antarctic plate. The Instituto Antartico Chileno (INACH kindly gave me a chance to stay in Frei/Escudero Bases as an exchange scientist under the Antarctic Treaty for two weeks in January 2000. I stayed in Frei Base as a member of a geological survey group named "Tectonic Evolution of the Antarctic Peninsula" which was organized by Prof. F. Herve, University of Chile, from January 05 to 19,2000. All my activity in the Antarctic was organized by INACH. During my stay in Frei Base, I also visited Bellingshausen (Russian, Great Wall (China and Artigas (Uruguay stations. All these stations are located within walking distance of Frei Base. King Sejong Station (Korea, located 10km east from Frei Base, and Jubany Base (Argentine, another 6km south-east from King Sejong Station, were also visited with the aid of a zodiac boat that was kindly operated for us by King Sejong Station. All stations except Escudero Base carry out meteorological observations. The seismological observations in Frei Base are operated by Washington State University of the U. S. monitoring of earthquake activity and three-component geomagnetic observations are done at King Sejong and Great Wall stations. Earth tide is monitored at Artigas Base. Continuous monitoring of GPS and gravity change are planned at King Sejong Station in the near future. Scientific research activities of each country in the area in the 1999/2000 Antarctic summer season were studied and the logistic ability of all stations was also assessed for our future international cooperation.
Rama in the royal title of the Hungarian kings
Directory of Open Access Journals (Sweden)
Živković Tibor D.
2004-01-01
Full Text Available The region (župa of Rama was enlisted in the official title of the Hungarian kings around 1138, as it is known from an official document. The exact answer to the question under which circumstances it happened has never been reached. It is most probable that Rama was not just other name for Bosnia as it was proposed in historiography, neither was a part of Bosnia conquered by military action of the Hungarian king around 1135. Having in mind that Rama was a part of the principality of Raška during the Early Middle Ages, it is quite possible that Rama became part of the official title of the Hungarian kings through some direct connections between ruling families of Hungary and Raška. The most probable answer could be reached through the examination of these relations. Namely, a daughter of Raška's župan, Uroš I, Helena, was married to the Hungarian crown prince Bela in 1129, when Rama was, most probably, part of Helena's dowry. When the crown prince became king of Hungary in 1131, Rama was included in his royal title. Later on during the Middle Ages Rama became part of Bosnia giving ground to the Hungarian kings to claim whole Bosnia as their heritage. .
76 FR 3819 - Martin Luther King, Jr., Federal Holiday, 2011
2011-01-20
... with the same strength, persistence, and determination exhibited by Dr. King, guided by the enduring... closer to Dr. King's vision of all Americans living and working together as one beloved community. NOW...
Dr. Martin Luther King, Jr. as Spiritual Leader
Directory of Open Access Journals (Sweden)
Andrea Pierce
2013-09-01
Full Text Available The purpose of this paper is to explore Dr. Martin Luther King Jr.’s spiritual leadership through his “I Have a Dream” speech. The paper explores the three characteristics of spiritual leadership as posed by Fry’s (2003 spiritual leadership theory: vision, hope/faith and altruistic love. The research draws upon these characteristics through qualitative content analysis of Dr. Martin Luther King Jr.’s “I Have a Dream” speech to illustrate Dr. King’s leadership as that of a spiritual leader. The research advances the spiritual leadership theory by establishing Dr. Martin Luther King Jr. as a spiritual leader. Through the illustration of Dr. King’s spiritual leadership, the characteristics of a spiritual leader are given tangible understanding.
Energy Technology Data Exchange (ETDEWEB)
Ando, Seiichiro, E-mail: andosei78102@biscuit.ocn.ne.jp [Department of Rheumatology and Internal Medicine, Juntendo University School of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Amano, Hirofumi; Amano, Eri; Minowa, Kentaro; Watanabe, Takashi; Nakano, Soichiro; Nakiri, Yutaka; Morimoto, Shinji; Tokano, Yoshiaki [Department of Rheumatology and Internal Medicine, Juntendo University School of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Lin, Qingshun; Hou, Rong; Ohtsuji, Mareki; Tsurui, Hiromichi; Hirose, Sachiko [Department of Pathology, Juntendo University School of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan); Takasaki, Yoshinari [Department of Rheumatology and Internal Medicine, Juntendo University School of Medicine, 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421 (Japan)
2010-04-09
FTY720 is a novel investigational agent targeting the sphingosine 1-phosphate (S1P) receptors with an ability to cause immunosuppression by inducing lymphocyte sequestration in lymphoid organs. Systemic lupus erythematosus (SLE) is refractory autoimmune disease characterized by the production of a wide variety of autoantibodies and immune complex (IC)-mediated lupus nephritis. Among several SLE-prone strains of mice, BXSB is unique in terms of the disease-associated monocytosis in periphery and the reduced frequency of marginal zone B (MZ B) cells in spleen. In the present study, we examined the effect of FTY720 on lupus nephritis of BXSB mice. FTY720 treatment resulted in a marked decrease in lymphocytes, but not monocytes, in peripheral blood, and caused relocalization of marginal zone B (MZ B) cells into the follicle in the spleen. These changes did not affect the production of autoantibodies, thus IgG and C3 were deposited in glomeruli in FTY720-treated mice. Despite these IC depositions, FTY720-treated mice showed survival advantage with the improved proteinuria. Histological analysis revealed that FTY720 suppressed mesangial cell proliferation and inflammatory cell infiltration. These results suggest that FTY720 ameliorates lupus nephritis by inhibiting the end-stage inflammatory process following IC deposition in glomeruli.
International Nuclear Information System (INIS)
Ando, Seiichiro; Amano, Hirofumi; Amano, Eri; Minowa, Kentaro; Watanabe, Takashi; Nakano, Soichiro; Nakiri, Yutaka; Morimoto, Shinji; Tokano, Yoshiaki; Lin, Qingshun; Hou, Rong; Ohtsuji, Mareki; Tsurui, Hiromichi; Hirose, Sachiko; Takasaki, Yoshinari
2010-01-01
FTY720 is a novel investigational agent targeting the sphingosine 1-phosphate (S1P) receptors with an ability to cause immunosuppression by inducing lymphocyte sequestration in lymphoid organs. Systemic lupus erythematosus (SLE) is refractory autoimmune disease characterized by the production of a wide variety of autoantibodies and immune complex (IC)-mediated lupus nephritis. Among several SLE-prone strains of mice, BXSB is unique in terms of the disease-associated monocytosis in periphery and the reduced frequency of marginal zone B (MZ B) cells in spleen. In the present study, we examined the effect of FTY720 on lupus nephritis of BXSB mice. FTY720 treatment resulted in a marked decrease in lymphocytes, but not monocytes, in peripheral blood, and caused relocalization of marginal zone B (MZ B) cells into the follicle in the spleen. These changes did not affect the production of autoantibodies, thus IgG and C3 were deposited in glomeruli in FTY720-treated mice. Despite these IC depositions, FTY720-treated mice showed survival advantage with the improved proteinuria. Histological analysis revealed that FTY720 suppressed mesangial cell proliferation and inflammatory cell infiltration. These results suggest that FTY720 ameliorates lupus nephritis by inhibiting the end-stage inflammatory process following IC deposition in glomeruli.
Computerized dosimetry of I-125 sources model 6711
International Nuclear Information System (INIS)
Isturiz, J.
2001-01-01
It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems [es
Research microbiologist Dawn King works in EPA’s National Exposure Research Laboratory where she identifies and assesses the health risk of microbial pathogens in water. This is her researchers at work profile.
Martin Luther King, Jr., General Hospital and community involvement.
Humphrey, M M
1973-07-01
Community involvement is not just one facet of the new Martin Luther King, Jr., General Hospital's existence. It is the mainstream from which all other activities flow. In addition to meeting the conventional needs of a conventional hospital staff with the core collection of texts and journals, this library goes one step further. It acts as a resource for its community health workers, dietitians, and nurses in their various outreach programs. It serves as a stimulus for the high school or community college student who may be curious about a health career. It also finds time to provide reading material for its patients.
Tedesco-Silva, Helio; Szakaly, Peter; Shoker, Ahmed; Sommerer, Claudia; Yoshimura, Norio; Schena, Francesco Paolo; Cremer, Malika; Hmissi, Abdel; Mayer, Hartmut; Lang, Philippe
2007-10-15
FTY720 is a novel immunomodulator that was developed to produce optimal graft protection with improved safety and tolerability. Phase II studies have demonstrated the efficacy of FTY720 up to the doses of 2.5 mg with full-dose cyclosporine (FDC). This multicenter, double-blind, Phase IIb, randomized study evaluated the safety and efficacy of 5 mg FTY720 (n=87; Group 1) vs. 2.5 mg FTY720 (n=90; Group 2) vs. mycophenolate mofetil (MMF; n=94; Group 3) in de novo renal transplant patients receiving FDC and prednisone. The primary efficacy endpoint was the occurrence of treated biopsy-proven acute rejection, graft loss, death, or premature study discontinuation (composite endpoint) within 6 months. The primary endpoint was superior in Group 1 (24%) and statistically noninferior in Group 2 compared to Group 3 (24.1% vs. 29.2% vs. 39.4%; P=0.025 and 0.0039, respectively). FTY720 plus FDC was generally well tolerated, with a similar incidence of adverse events across all groups. FTY720 was associated with higher incidence of bradycardia (Group 1: 26.4%, P=0.0002 and Group 2: 15.6%, P=0.046, vs. Group 3: 6.4%), respiratory disorders (Group 1: 40.2%, not significant [P=NS] and Group 2: 34.4%, P=NS vs. Group 3: 28.7%). One macular edema occurred in Group 2. Lower creatinine clearances were observed with FTY720 versus MMF (Group 1: 52.4 ml/min, P=NS and Group 2: 51.7 ml/min, P=0.039 vs. Group 3: 62.5 ml/min). Although FTY720 with FDC provided adequate protection from acute rejection the safety profile was less favorable for adverse events than current standard immunosuppression in de novo renal transplant patients.
Geochemical interpretation of Kings Mountain, North Carolina, orientation area
International Nuclear Information System (INIS)
Price, V.; Ferguson, R.B.
1977-01-01
An orientation study has been made of uranium occurrences in the area of Kings Mountain, North Carolina. This is one of the orientation studies of known uranium occurrences that are being conducted in several geologic provinces and under various climatic (weathering) conditions to provide the technical basis for design and interpretation of NURE geochemical reconnaissance programs. The Kings Mountain area was chosen for study primarily because of the reported presence of high-uranium monazite. This 750-mi 2 area is in the deeply weathered southern Appalachian Piedmont and spans portions of the Inner Piedmont, Kings Mountain, and Charlotte geologic belts. Uranium concentration maps for ground and surface water samples clearly outline the outcrop area of the Cherryville Quartz Monzonite with highs up to 10 ppb uranium near the reported uraninite. Several surface water samples appear to be anomalous because of trace industrial contamination. Uranium concentration maps for -100 to +200 mesh stream sediments indicate the area of monazite abundance. Several samples with >100 ppM uranium content appear to be high in uranium-rich resistate minerals. When the uranium content of sediment samples is ratioed to the sum of Hf, Dy, and Th, the anomaly pattern shifts to coincide with uranium highs in ground and surface water samples. False anomalies from concentrations of monazite (Ce,ThPO 4 ), xenotime (Y,DyPO 4 ), and zircon (Zr,HfSiO 4 ) in stream sediment samples can thus be eliminated. Residual anomalies should be related to unusual uranium enrichment of these common minerals or to the presence of an uncommon uranium-rich mineral. Tantalum, beryllium, and tin in stream sediments correspond to high concentrations of uranium in stream and ground water but not to uranium in sediments. In an initial reconnaissance, several media should be sampled, and it is essential to correct uranium in sediments for the sample mineralogy
A Palisade Fit for a King: Ideal architecture in King Harald Bluetooth's Jelling
DEFF Research Database (Denmark)
Jessen, Mads Dengsø; Holst, Mads Kähler; Lindblom, Charlotta
2014-01-01
family named on the rune stones in Jelling and in particular to the reign of King Harald Bluetooth. In addition to the structure and date of the palisade, the article will present the tentative results from a series of analyses regarding the construction, composition, function and demolition...
DEFF Research Database (Denmark)
Brisch, Nicole
2013-01-01
throughout history. This is not a new point but remains all too often underappreciated when discussing the blurring of lines between human and god as evidenced in the deification of kings. In ancient Mesopotamia, one of the oldest high civilizations in the world, it was a short-lived but nevertheless...
Black swans and dragon kings: A unified model
Eliazar, Iddo
2017-09-01
The term “black swan” is a metaphor for outlier events whose statistics are characterized by Pareto's Law and by Zipf's Law; namely, statistics governed by power-law tails. The term “dragon king” is a metaphor for a singular outlier event which, in comparison with all other outlier events, is in a league of its own. As an illustrative example consider the wealth of a family that is sampled at random from a medieval society: the nobility constitutes the black-swan category, and the royal family constitutes the dragon-king category. In this paper we present and analyze a dynamical model that generates, universally and jointly, black swans and dragon kings. According to this model, growing from the microscopic scale to the macroscopic scale, black swans and dragon kings emerge together and invariantly with respect to initial conditions.
75 FR 53018 - Proposed Collection; Comment Request for Form 720
2010-08-30
.... Abstract: Form 720 is used to report (1) excise taxes due from retailers and manufacturers on the sale or... are no changes being made to the form at this time. Type of Review: Extension of a currently approved...
Stick balancing, falls and Dragon-Kings
Cabrera, J. L.; Milton, J. G.
2012-05-01
The extent to which the occurrence of falls, the dominant feature of human attempts to balance a stick at their fingertip, can be predicted is examined in the context of the "Dragon-King" hypothesis. For skilled stick balancers, fluctuations in the controlled variable, namely the vertical displacement angle θ, exhibit power law behaviors. When stick balancing is made less stable by either decreasing the length of the stick or by requiring the subject to balance the stick on the surface of a table tennis racket, systematic departures from the power law behaviors are observed in the range of large θ. This observation raises the possibility that the presence of departures from the power law in the large length scale region, possibly Dragon-Kings, may identify situations in which the occurrence of a fall is more imminent. However, whether or not Dragon-Kings are observed, there is a Weibull-type survival function for stick falling. The possibility that increased risk of falling can, at least to some extent, be predicted from fluctuations in the controlled variable before the event occurs has important implications for the development of preventative strategies for the management of phenomena ranging from earthquakes to epileptic seizures to falls in the elderly.
Simplified operation manual PA-720 particle counter
International Nuclear Information System (INIS)
Draper, V.F.
1980-01-01
The model PA-720 Automatic Particle Size Analyzer is a simple, relatively high speed device designed to provide accurate size distributions in both tabular and graphic forms. This model has two dynamic ranges; 50 to 2500 microns and 200 to 1600 microns. This is an abbreviated version of the manufacturer's operating manual. It provides all the necessary information for the novice and experienced user. For more detailed explanations and servicing procedures one should reference the full manual
Keiler, J.; Richter, S.; Wirkner, C.S.
2015-01-01
The emergence of king crabs from a hermit crab-like ancestor is one of the most curious events in decapod evolution. King crabs comprise two taxa, Lithodidae and Hapalogastridae, and while lithodids have formed the focus of various anatomical studies, the internal anatomy of hapalogastrids has never
The Applicability of Governance at King Saud University in Riyadh
Kentab, Mohammad Y.
2018-01-01
The problem of the study revolves around the application of the requirements of governance at King Saud University. The study aims to identify the extent of governance requirements at King Saud University as seen by faculty members through transparency, accountability, organizational structure, laws, regulations, and justice. To achieve the…
Bentley, Dana Frantz; Souto-Manning, Mariana
2016-01-01
This collaborative classroom research study examines the ways in which preschoolers made sense of same-sex marriage through a critical reading of the book "King and King" by De Haan and Nijland. Acknowledging the importance of community in doing critical and political work, this article details the ways in which a preschool teacher and a…
7 CFR 1260.125 - Industry information.
2010-01-01
... Promotion and Research Order Definitions § 1260.125 Industry information. Industry information means information and programs that will lead to the development of new markets, marketing strategies, increased... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...
Bowers, D T; Chhabra, P; Langman, L; Botchwey, E A; Brayman, K L
2011-11-01
Nanofiber scaffolds could improve islet transplant success by physically mimicking the shape of extracellular matrix and by acting as a drug-delivery vehicle. Scaffolds implanted in alternate transplant sites must be prevascularized or very quickly vascularized following transplantation to prevent hypoxia-induced islet necrosis. The local release of the S1P prodrug FTY720 induces diameter enlargement and increases in length density. The objective of this preliminary study was to evaluate length and diameter differences between diabetic and nondiabetic animals implanted with FTY720-containing electrospun scaffolds using intravital imaging of dorsal skinfold window chambers. Electrospun mats of randomly oriented fibers we created from polymer solutions of PLAGA (50:50 LA:GA) with and without FTY720 loaded at a ratio of 1:200 (FTY720:PLAGA by wt). The implanted fiber mats were 4 mm in diameter and ∼0.2 mm thick. Increases in length density and vessel diameter were assessed by automated analysis of images over 7 days in RAVE, a Matlab program. Image analysis of repeated measures of microvessel metrics demonstrated a significant increase in the length density from day 0 to day 7 in the moderately diabetic animals of this preliminary study (P < .05). Furthermore, significant differences in length density at day 0 and day 3 were found between recently STZ-induced moderately diabetic and nondiabetic animals in response to FTY720 local release (P < .05, Student t test). Driving the islet revascularization process using local release of factors, such as FTY720, from biodegradable polymers makes an attractive system for the improvement of islet transplant success. Preliminary study results suggest that a recently induced moderately diabetic state may potentiate the mechanism by which local release of FTY720 from polymer fibers increases length density of microvessels. Therefore, local release of S1P receptor-targeted drugs is under further investigation for improvement of
International Nuclear Information System (INIS)
Hu Shu; Gao Zhou; Jia Shaowei; Cheng Xianyi; Chen Junhui; Yin Weihua; Sun Desheng
2011-01-01
Twenty inpatients suffered from malignant tumors with twenty-four lesions were treated with 125 I permanent brachytherapy seed in Peking University Shenzhen Hospital, and the feasibility, curative effect and adverse effect of the treatment were observed. Before 125 I seeds implantation, the three-dimensional treatment planning was preconcerted. There were two methods to implant 125 I seeds. One was to insert the seeds in the location of residual focus and metastatic lesions of the tumors directly in ordinary operations or through laparoscopy under general anesthesia. The other w as to implant the seeds into the tumors through percutaneous needles by the guidance of CT scanning or color doppler ultrasonography under local anesthesia. The implantations for all of the 20 patients (24 lesions) were performed successfully. During and one week after the implantation, the distributions of the planted seeds were approximately the same as the scheduled three-dimensional treatment planning, and no seed migration was found. Adverse reactions during and after the operation were slight and recovered after correlative treatments. Clinical symptoms were palliated and ser um tumor marker decreased to a different extent among most patients. The complete remission (CR) rate is 20.00% (4/20 patients ), the partial emission (PR) rate is 35.00% (7/20 patients), the stable disease (SD) rate is 30.00% (6/20 patients), the progressive disease (PD) rate is 15.00% (3/20 patients), and the overall response rate (CR + PR) is 53.33% (8 patients). 125 I seeds implantation for targeted therapy is convenient, safe and effective on malignant tumor, and is well worth advanced application. (authors)
The labour ward analgesic service at King Edward VIII Hospital ...
African Journals Online (AJOL)
The labour ward analgesic service at King Edward VIII. Hospital, Durban. D. A. ROCKE, C. C. ROUT, H. D. RUSSELL, S. SINGH. Abstract The provision of analgesic services to the labour ward at King Edward VIII Hospital was studied during a I-week period. Of249 patients, 113 (45%) received no analgesia whatsoever.
1/13 the establishment of kingdoms and the identification of kings ...
African Journals Online (AJOL)
Dr Tanya du Plessis
disputes, but this article will focus on the newly-created positions of kings and queens. 2 .... (2) The person currently holding office as the King of the Zulu nation .... community (tribe) is no better than the colonial-apartheid recognition of tribes.
King and King: Learning to Treat Others Royally Through Diversity Education
Dube', Danielle
2009-01-01
Of the hate crimes reported to the FBI in 2007, 16.6% were the result of a sexual orientation bias. In the wake of horrific hate crimes such as the shooting and death of Lawrence King earlier this year, killed because of his sexual orientation, and the murder of Matthew Shepard ten years ago, homophobia and its effects must be addressed. A proposed solution to the problem is mandatory diversity education in public schools, with no parental opt out.
Articulating nurse practitioner practice using King's theory of goal attainment.
de Leon-Demare, Kathleen; MacDonald, Jane; Gregory, David M; Katz, Alan; Halas, Gayle
2015-11-01
To further understand the interactions between nurse practitioners (NPs) and patients, King's nursing theory of goal attainment was applied as the conceptual framework to describe the interactions between NPs and patients in the primary care setting. Six dyads of NPs and their patients were video- and audio-taped over three consecutive clinic visits. For the purposes of this arm of the study, the audio-taped interactions were transcribed and then coded using King's concepts in her theory of goal attainment. King's theory was applicable to describe NP practice. King's concepts and processes of nurse-patient interactions, such as disturbances, mutual goal setting, and transactions, were observed in NP-patient interactions. Disturbances during clinical encounters were essential in the progression toward goal attainment. Elements, such as social exchange, symptom reporting, role explanation, and information around clinical processes facilitated relationship building. NPs as practitioners need to be reflective of their own practice, embrace disturbances in the clinical encounter, and attend to these as opportunities for mutual goal setting. ©2015 American Association of Nurse Practitioners.
Opportunity Captures 'Lion King' Panorama
2004-01-01
[figure removed for brevity, see original site] Click on the image for Opportunity Captures 'Lion King' Panorama (QTVR) This approximate true-color panorama, dubbed 'Lion King,' shows 'Eagle Crater' and the surrounding plains of Meridiani Planum. It was obtained by the Mars Exploration Rover Opportunity's panoramic camera on sols 58 and 60 using infrared (750-nanometer), green (530-nanometer) and blue (430-nanometer) filters. This is the largest panorama obtained yet by either rover. It was taken in eight segments using six filters per segment, for a total of 558 images and more than 75 megabytes of data. Additional lower elevation tiers were added to ensure that the entire crater was covered in the mosaic. This panorama depicts a story of exploration including the rover's lander, a thorough examination of the outcrop, a study of the soils at the near-side of the lander, a successful exit from Eagle Crater and finally the rover's next desination, the large crater dubbed 'Endurance'.
His Majesty King Abdullah II of the Hashemite Kingdom of Jordan.
Patrice Loïez
2003-01-01
Photo 03: King of Jordan visited some ATLAS installations. From left to right: Maurice Bourquin, President of the CERN Council, Luciano Maiani, Director-General of CERN, King Abdullah II of Jordan, Herwig Schopper, President of the SESAME Council and Peter Jenni, ATLAS spokesman.
King Harald V and Queen Sonja of Norway visit CERN
Maximilien Brice
2006-01-01
Norway's King Harald V and Queen Sonja take a tour of the ATLAS detector with CERN's Director-General Robert Aymar in April 2006. During their visit the royal party met with members of CERN's Norwegian community. A group of about 40 students greeted the royal motorcade with a belting rendition of 'The King's Song', Norway's royal anthem.
40 CFR 721.720 - Alkoxylated fatty acid amide, alkylsulfate salt.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Alkoxylated fatty acid amide... Specific Chemical Substances § 721.720 Alkoxylated fatty acid amide, alkylsulfate salt. (a) Chemical... as an alkoxylated fatty acid amide, alkylsulfate salt (PMN P-97-136) is subject to reporting under...
45 King: A Story of the Southern Home
Deluca, Paul Matthew Webb
2014-01-01
The house at 45 King St. in Charleston, South Carolina is more than a home. It is a story of the home. A story told through history, through a vision exhibited in architectural drawings, and through the social heritage closest to my heart. 45 King is a story for the South; the story of its grandeur, its climate, its natural beauty, its hospitality, its comfort, and its veils. It is a story that was told yesterday and one that is still told today. Like an oral history, the telling of it may...
78 FR 39599 - Safety Zone; Independence Day Fireworks, Kings Beach, CA
2013-07-02
... Zone; Independence Day Fireworks, Kings Beach, CA AGENCY: Coast Guard, DHS. ACTION: Notice of... Fireworks, Kings Beach, CA in the Captain of the Port, San Francisco area of responsibility during the dates... from the hazards associated with the fireworks display. During the enforcement period, unauthorized...
13 CFR 125.4 - Government property sales assistance.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Government property sales... CONTRACTING PROGRAMS § 125.4 Government property sales assistance. (a) The purpose of SBA's Government property sales assistance program is to: (1) Insure that small businesses obtain their fair share of all...
Three Kings and the Bright Star of Fame
Directory of Open Access Journals (Sweden)
Emalyn J. Bullis
2013-12-01
Full Text Available Many phenomena in music history as well as in American history have helped develop and shape the types of music listened to today, but none have been so fresh as looking back to twentieth-century popular music and the several key individuals that “ruled” in this area. These “rulers” were hailed as “kings” firstly as a media ploy, but the American public did nothing but encourage the titles. This is somewhat confusing considering American’s pride in their democratic political system but history shows that in several key American cultural changes the “Kings” crowned in the music sphere are representative of these changes. While not difficult to determine who these individuals are, as most of them were hailed and recognized as “Kings” to their respective audiences. Benny Goodman, the King of Swing, in the 1920’s and 30’s helped usher in and popularize the Swing movement. Elvis Presley, the King of Rock and Roll, capitalized (intentionally or not on the move towards combining African-American sounds such as blues and jazz with folk, gospel, and soul, thus creating a whole new and extremely popular sound. Michael Jackson, the King of Pop, was practically born into fame with his involvement with the ‘Jackson 5,’ but that did not stop him from rising up the ladder of fame in his solo career to change the face of pop music forever. There were also many artists that surrounded these “kings,” a court, if you will, that allowed their new styles to proliferate throughout American culture, and sometimes even surpassed them musically. However, as icons, these men stand on their own for their achievements in music and their ability to change and adapt to the culture around them. By looking at the three Kings of American pop culture’s past, it is possible to see the direction of America’s culture in general from the 1920’s on and perhaps see the trajectory of music of the USA today
Creep mechanisms of U720Li disc superalloy at intermediate temperature
International Nuclear Information System (INIS)
Yuan, Y.; Gu, Y.F.; Cui, C.Y.; Osada, T.; Tetsui, T.; Yokokawa, T.; Harada, H.
2011-01-01
Highlights: → Crept microstructures of U720Li at 725 deg. C/630 MPa have been investigated by TEM. → Orowan looping process combining dislocation slip and climb and partial dislocations shearing precipitates were the main creep mechanisms. → Grain boundary sliding occurred at last creep stage. → Three methods were suggested to improve the creep property at relatively high temperature. - Abstract: The microstructures of U720Li disc superalloy have been investigated by transmission electron microscopy (TEM) before and after creep test at 725 deg. C/630 MPa. The evolution of the crept microstructures was marked as three different stages (I, II and III) corresponding to gradually increased strain 0.1%, 5% and 27%, respectively. At stage I, dislocations bypassed secondary γ' via Orowan loops. At stage II, partial dislocations started to shear secondary γ', leaving stacking fault (SF) behind and microtwins formed in part of grains. At stage III, grain boundary sliding occurred due to very large strain and increased effective stress. The results indicated that the creep mechanisms of U720Li at 725 deg. C/630 MPa evolved with gradually increased strain. Orowan looping process combining dislocation slip and climb and partial dislocations shearing precipitates were the main creep mechanisms. It is suggested that decreasing the interparticle spacing of secondary γ', strengthening secondary γ' and decreasing stacking fault energy (SFE) of γ matrix may be effective methods to improve the creep property at relatively higher temperatures.
Tumor therapy with 125I-octreotide and 125I-UdR
International Nuclear Information System (INIS)
Fan, W.; Zhu, R.; Yang, C.; Sun, J.J.; Xu, Y.J.; Zhang, Y.J.; Wu, M.J.; Wang, D.J.
2005-01-01
Purpose: To determine the tumor cell damage effect with Auger-electron emitter 125 I in different chemical states. Methods: (1) [Tyr 3 ] octreotide (TOC) and UdR are labeled with 125 I,respectively. (2) Receptor analysis of 125 I-TOC on small cell lung cancer (SCLC) NCI-H446 cell lines is performed comparing with normal lymph cells. NCI-H446 cells added various dose of 125 I-TOC are incubated for different time with 125 I-Nal and non-labeled TOC as control. The capacity of NCI-H446 cell lines bound and internalization of 125 I TOC are determined. The radiation damage of tumor cells is measured by MTF methods. (3) The killing effects of 125 I-UdR in human pancreatic cancer cell line Bax-Pc and Sca-BER bladder carcinoma cells are evaluated with the similar methods. I-UdR penetrating into the Sca-BER cell nucleus is observed with confocal microscope. The grow suppression and clonogenic formation of Sca-BER cells after incubation with 125 I-UdR are analyzed. Proliferation fraction and S phase cell fraction of Sca-BER cell added 125 I-UdR is measured with flow cytometric analysis. Results: (1) Kd=(0.56∼2.0) x 10 -11 mol/L and B max =(1.17∼2.0) x 10 5 cell site are obtained by receptor analysis of 125 I-TOC on NCI-H446 cells. Comparatively, the difference between total binding and non-specific binding is low and there is no saturation of specific binding for normal lymphocyte. About 50% of 125 I-TOC is internalized into the NCI-H446 cell nucleus at 24h after incubation. The damige of NCI-H446 cells by 125 I-TOC is clearly observed. (2) The penetration amount of 125 I-UdR into cell nucleus increases with the incubate time when the concentration of 125 I-UdR is in the range of 10∼500 kBq/mL and reaches the peak fraction of 94% at 36 h after incubation. The radioactivity of 125 I-UdR is then achieved equelibration and no more increased with time. The linear correlation with γ=0.867∼0.978 between the concentration of 125 I-UdR in cell nucleus and the incubation time
King Chulalongkorn: biography and his activities in medicine and public health.
Charulukananan, Somrat; Sueblinvong, Tada
2003-06-01
King Rama V, or Chulalongkorn, was the fifth monarch of the Chakri Dynasty. He was one of the most beloved of the Thai kings due to his many activities including abolishing slavery without bloodshed and especially his skillful diplomacy which succeeded in steering Siam out of the grips of the colonial powers. His activities also included reform of the administration of the kingdom according to the European model and in bringing Siam into the modern era with such exquisite skills that he is still vividly remembered today. His reign also saw many developments in medicine and public health. The King's role in these areas, however, were clouded by his more visible activities in politics and diplomacy. The result is that the Thai public learned rather little about his role in these areas. This article aims at collecting this and to show the King's very important role in modernizing medicine and public health in Siam.
Matthew's Messianic Shepherd-king: In search of “the lost sheep of ...
African Journals Online (AJOL)
p1243322
the Messianic Shepherd-King expectation with its attending expectations for territorial ... Messianic Shepherd-King: In Search of the Lost Sheep of the House of Israel. September. 2007. Berlin: De Gruyter. ...... Exile in the early. Persian Period”.
Stirling Space Engine Program. Volume 2; Appendixes A, B, C and D
Dhar, Manmohan
1999-01-01
The objective of this program was to develop the technology necessary for operating Stirling power converters in a space environment and to demonstrate this technology in full-scale engine tests. Volume 2 of the report includes the following appendices: Appendix A: Heater Head Development (Starfish Heater Head Program, 1/10th Segment and Full-Scale Heat Pipes, and Sodium Filling and Processing); Appendix B: Component Test Power Converter (CTPC) Component Development (High-temperature Organic Materials, Heat Exchanger Fabrication, Beryllium Issues, Sodium Issues, Wear Couple Tests, Pressure Boundary Penetrations, Heating System Heaters, and Cooler Flow Test); Appendix C: Udimet Testing (Selection of the Reference Material for the Space Stirling Engine Heater Head, Udimet 720LI Creep Test Result Update, Final Summary of Space Stirling Endurance Engine Udimet 720L1 Fatigue Testing Results, Udimet 720l1 Weld Development Summary, and Udimet 720L1 Creep Test Final Results Summary), and Appendix D: CTPC Component Development Photos.
Fat King Penguins Are Less Steady on Their Feet.
Directory of Open Access Journals (Sweden)
Astrid S T Willener
Full Text Available Returning to the shore after a feeding sojourn at sea, king penguins often undertake a relatively long terrestrial journey to the breeding colony carrying a heavy, mostly frontal, accumulation of fat along with food in the stomach for chick-provisioning. There they must survive a fasting period of up to a month in duration, during which their complete reliance on endogenous energy stores results in a dramatic loss in body mass. Our aim was to determine if the king penguin's walking gait changes with variations in body mass. We investigated this by walking king penguins on a treadmill while instrumented with an acceleration data logger. The stride frequency, dynamic body acceleration (DBA and posture of fat (pre-fasting; 13.2 kg and slim (post fasting; 11 kg king penguins were assessed while they walked at the same speed (1.4 km/h on a treadmill. Paired statistical tests indicated no evidence for a difference in dynamic body acceleration or stride frequency between the two body masses however there was substantially less variability in both leaning angle and the leaning amplitude of the body when the birds were slimmer. Furthermore, there was some evidence that the slimmer birds exhibited a decrease in waddling amplitude. We suggest the increase in variability of both leaning angle and amplitude, as well as a possibly greater variability in the waddling amplitude, is likely to result from the frontal fat accumulation when the birds are heavier, which may move the centre of mass anteriorly, resulting in a less stable upright posture. This study is the first to use accelerometry to better understand the gait of a species within a specific ecological context: the considerable body mass change exhibited by king penguins.
Fat King Penguins Are Less Steady on Their Feet.
Willener, Astrid S T; Handrich, Yves; Halsey, Lewis G; Strike, Siobhán
2016-01-01
Returning to the shore after a feeding sojourn at sea, king penguins often undertake a relatively long terrestrial journey to the breeding colony carrying a heavy, mostly frontal, accumulation of fat along with food in the stomach for chick-provisioning. There they must survive a fasting period of up to a month in duration, during which their complete reliance on endogenous energy stores results in a dramatic loss in body mass. Our aim was to determine if the king penguin's walking gait changes with variations in body mass. We investigated this by walking king penguins on a treadmill while instrumented with an acceleration data logger. The stride frequency, dynamic body acceleration (DBA) and posture of fat (pre-fasting; 13.2 kg) and slim (post fasting; 11 kg) king penguins were assessed while they walked at the same speed (1.4 km/h) on a treadmill. Paired statistical tests indicated no evidence for a difference in dynamic body acceleration or stride frequency between the two body masses however there was substantially less variability in both leaning angle and the leaning amplitude of the body when the birds were slimmer. Furthermore, there was some evidence that the slimmer birds exhibited a decrease in waddling amplitude. We suggest the increase in variability of both leaning angle and amplitude, as well as a possibly greater variability in the waddling amplitude, is likely to result from the frontal fat accumulation when the birds are heavier, which may move the centre of mass anteriorly, resulting in a less stable upright posture. This study is the first to use accelerometry to better understand the gait of a species within a specific ecological context: the considerable body mass change exhibited by king penguins.
The Words of Martin Luther King, Jr.
Today's Education, 1979
1979-01-01
Excerpts from speeches by Dr. Martin Luther King, Jr., are reprinted. Topics discussed include discrimination, the South, education, nonviolent resistance, poverty, economic opportunity, and world peace. (LH)
Feeding performance of king Mackerel, Scomberomorus cavalla.
Ferguson, Amber R; Huber, Daniel R; Lajeunesse, Marc J; Motta, Philip J
2015-08-01
Feeding performance is an organism's ability to capture and handle prey. Although bite force is a commonly used metric of feeding performance, other factors such as bite pressure and strike speed are also likely to affect prey capture. Therefore, this study investigated static bite force, dynamic speeds, and predator and prey forces resulting from ram strikes, as well as bite pressure of the king mackerel, Scomberomorus cavalla, in order to examine their relative contributions to overall feeding performance. Theoretical posterior bite force ranged from 14.0-318.7 N. Ram speed, recorded with a rod and reel incorporated with a line counter and video camera, ranged from 3.3-15.8B L/s. Impact forces on the prey ranged from 0.1-1.9 N. Bite pressure, estimated using theoretical bite forces at three gape angles and tooth cross-sectional areas, ranged from 1.7-56.9 MPa. Mass-specific bite force for king mackerel is relatively low in comparison with other bony fishes and sharks, with relatively little impact force applied to the prey during the strike. This suggests that king mackerel rely on high velocity chases and high bite pressure generated via sharp, laterally compressed teeth to maximize feeding performance. © 2015 Wiley Periodicals, Inc.
FTY720 on the way from the base camp to the summit of the mountain: relevance for remyelination
Kipp, M.; Amor, S.
2012-01-01
FTY720 (fingolimod; Gilenya®), a sphingosine 1-phosphate (S1P) receptor modulator, is the first oral disease-modifying therapy to be approved for the treatment of relapsing-remitting multiple sclerosis. FTY720 is rapidly converted in vivo to the active S-fingolimod-phosphate, which binds to S1P
A New Reading of Shakespeare's King John.
Usher, Peter D.
1995-12-01
Shakespeare wrote King John c.1594, six years after the defeat of the Spanish Armada, and ~ 50 years after publication of the Copernican heliocentric hypothesis. It is said to be the most unhistorical of the History Plays, ``anomalous'', ``puzzling'', and ``odd'', and as such it has engendered far more than the customary range of interpretive opinion. I suggest that the play alerts Elizabethans not just to military and political threats, but to a changing cosmic world view, all especially threatening as they arise in Catholic countries. (a) Personification characterizes the play. John personifies the old order, while Arthur and the Dauphin's armies personify the new. I suggest that Shakespeare decenters King John just as Copernicus decentered the world. (b) Hubert menaces Arthur's eyes for a whole scene (4.1), but the need for such cruelty is not explained and is especially odd as Arthur is already under sentence of death (3.3.65-66). This hitherto unexplained anomaly suggests that the old order fears what the new might see. (c) Eleanor's confession is made only to Heaven and to her son the King (1.1.42-43), yet by echoing and word play the Messenger from France later reveals to John that he is privy to it (4.2.119-124). This circumstance has not been questioned heretofore. I suggest that the Messenger is like the wily Hermes (Mercury), chief communicator of the gods and patron of the sciences; by revealing that he moves in the highest circles, he tells John that he speaks with an authority that transcends even that of a king. The message from on high presages more than political change; it warns of a new cosmic and religious world order (d) Most agree that John is a weak king, so Shakespeare must have suspected flaws in the old ways. He would have known that Tycho Brahe's new star of 1572, the comet of 1577, and the 1576 model of his compatriot Thomas Digges, were shattering old ideas. (e) The tensions of the play are not resolved because in 1594 the new order was
Moessbauer Study of Sedimentary Rocks from King George Island, Antarctica
International Nuclear Information System (INIS)
Kuzmann, E.; Souza, P. A. de; Schuch, L. A.; Oliveira, A. C. de; Garg, R.; Garg, V. K.
2002-01-01
The separation of continents at the periphery of Antarctica occurred about 180 ma ago due to volcanic activity. Geological faults can be very important in the study of geological occurrences. Such geological faults occur across the Admiralty Bay, King George Island, and have been studied in detail previously. Controversial statements were given in earlier works, based on conventional geological investigations, as to whether altered 'Jurassic' and unaltered Tertiary rocks were separated by a major fault which goes across the Admiralty Bay, or whether there is no difference in the alteration of the rocks located at either side of the fault. The aim of our work is to investigate rock samples from the Admiralty Bay of King George Island, Antarctica, from different locations on both sides of the geological fault. For these investigations 57 Fe Moessbauer spectroscopy and X-ray diffractometry were used. We have found that the phase composition, and the iron distribution among the crystallographic sites of iron-bearing minerals, are characteristic of the location of the rock samples from the Admiralty Bay of King George Island. There is a much higher amount of iron oxides in the rocks from the south part of the geological fault than in the north part. The differences in the mineral composition and iron distribution showed that the rocks in the southern part of the geological fault of King George Island are significantly altered compared to the rocks in the northern part. Our present results support and complement well the results obtained earlier on soils from King George Island.
Huu, Doanh Le; Matsushita, Takashi; Jin, Guihua; Hamaguchi, Yasuhito; Hasegawa, Minoru; Takehara, Kazuhiko; Fujimoto, Manabu
2013-06-01
Sphingosine 1-phosphate (S1P) exerts a variety of activities in immune, inflammatory, and vascular systems. S1P plays an important role in systemic sclerosis (SSc) pathogenesis. Regulation of S1P in fibrotic diseases as well as in SSc was recently reported. FTY720, an oral S1P receptor modulator, has been shown to be a useful agent for the prevention of transplant rejection and autoimmune diseases. Murine sclerodermatous chronic graft-versus-host disease (GVHD) is a model for human sclerodermatous chronic GVHD and SSc. We undertook this study to investigate the effects of FTY720 in murine sclerodermatous chronic GVHD. FTY720 was orally administered to allogeneic recipient mice from day 0 to day 20 (short-term, early-treatment group), from day 0 to day 42 (full-term, early-treatment group), or from day 22 to day 42 (delayed-treatment group) after bone marrow transplantation. Delayed administration of FTY720 attenuated, and early administration of FTY720 inhibited, the severity and fibrosis in murine sclerodermatous chronic GVHD. With early treatment, FTY720 induced expansion of splenic myeloid-derived suppressor cells, Treg cells, and Breg cells. Vascular damage in chronic GVHD was inhibited by FTY720 through down-regulating serum levels of S1P and soluble E-selectin. FTY720 inhibited infiltration of immune cells into skin. Moreover, FTY720 diminished the expression of messenger RNA for monocyte chemotactic protein 1, macrophage inflammatory protein 1α, RANTES, tumor necrosis factor α, interferon-γ, interleukin-6 (IL-6), IL-10, IL-17A, and transforming growth factor β1 in the skin. FTY720 suppressed the immune response by promoting the expansion of regulatory cells and reducing vascular damage and infiltration of immune cells into the skin. Taken together, these results have important implications for the potential use of FTY720 in the treatment of sclerodermatous chronic GVHD and SSc in humans. Copyright © 2013 by the American College of Rheumatology.
Rahman, Md Mostafizur; Prünte, Laura; Lebender, Leonard F; Patel, Brijeshkumar S; Gelissen, Ingrid; Hansbro, Philip M; Morris, Jonathan C; Clark, Andrew R; Verrills, Nicole M; Ammit, Alaina J
2016-11-16
Protein phosphatase 2A (PP2A) activity can be enhanced pharmacologically by PP2A-activating drugs (PADs). The sphingosine analog FTY720 is the best known PAD and we have shown that FTY720 represses production of pro-inflammatory cytokines responsible for respiratory disease pathogenesis. Whether its phosphorylated form, FTY720-P, also enhances PP2A activity independently of the sphingosine 1-phosphate (S1P) pathway was unknown. Herein, we show that FTY720-P enhances TNF-induced PP2A phosphatase activity and significantly represses TNF-induced interleukin 6 (IL-6) and IL-8 mRNA expression and protein secretion from A549 lung epithelial cells. Comparing FTY720 and FTY720-P with S1P, we show that unlike S1P, the sphingosine analogs do not induce cytokine production on their own. In fact, FTY720 and FTY720-P significantly repress S1P-induced IL-6 and IL-8 production. We then examined their impact on expression of cyclooxygenase 2 (COX-2) and resultant prostaglandin E 2 (PGE 2) production. S1P did not increase production of this pro-inflammatory enzyme because COX-2 mRNA gene expression is NF-κB-dependent, and unlike TNF, S1P did not activate NF-κB. However, TNF-induced COX-2 mRNA expression and PGE 2 secretion is repressed by FTY720 and FTY720-P. Hence, FTY720-P enhances PP2A activity and that PADs can repress production of pro-inflammatory cytokines and enzymes in A549 lung epithelial cells in a manner devoid of S1P agonism.
Reading Stephen King: Issues of Censorship, Student Choice, and Popular Literature.
Power, Brenda Miller, Ed.; Wilhelm, Jeffrey D., Ed.; Chandler, Kelly, Ed.
This collection of essays grew out of the "Reading Stephen King Conference" held at the University of Maine in 1996. Stephen King's books have become a lightning rod for the tensions around issues of including "mass market" popular literature in middle and high school English classes and of who chooses what students read.…
40 CFR 720.102 - Notice of commencement of manufacture or import.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Notice of commencement of manufacture... (CONTINUED) TOXIC SUBSTANCES CONTROL ACT PREMANUFACTURE NOTIFICATION Commencement of Manufacture or Import § 720.102 Notice of commencement of manufacture or import. (a) Applicability. Any person who commences...
Local seismic activity monitored at King Sejong Station, Antarctica
Lee,Duk Kee; Kim,Yea Dong; Nam,Sang Heon; Jin,Young Keun
1998-01-01
Source location estimation from single station earthquake data collected at King Sejong Station (62°13'3l"N, 58°47'07"W) from 1995 to 1996 provides seismic activity around King Sejong Station. Analysis of local events, less than 1.5°in angular epicentral distance, finds epicenters located near the Shackleton Fracture Zone, the South Shetland Platform, Deception Island, and North Bransfield Basin. Estimated magnitudes range from 2.2 to 4.5 on the Richter scale, averaging 4.0 in North Bransfiel...
Hamidi Shishavan, Mahdi; Bidadkosh, Arash; Yazdani, Saleh; Lambooy, Sebastiaan; van den Born, Jacob; Buikema, Hendrik; Henning, Robert H; Deelman, Leo E
2016-01-01
The sphingosine-1-phosphate (S1P) analog FTY720 exerts pleiotropic effects on the cardiovascular system and causes down-regulation of S1P receptors. Myogenic constriction is an important mechanism regulating resistance vessel function and is known to be modulated by S1P. Here we investigated myogenic constriction and vascular function of mesenteric arteries of rats chronically treated with FTY720. Wistar rats received FTY720 1mg/kg/daily for six weeks. At termination, blood pressure was recorded and small mesenteric arteries collected for vascular studies in a perfusion set up. Myogenic constriction to increased intraluminal pressure was low, but a sub-threshold dose of S1P profoundly augmented myogenic constriction in arteries of both controls and animals chronically treated with FTY720. Interestingly, endothelial denudation blocked the response to S1P in arteries of FTY720-treated animals, but not in control rats. In acute experiments, presence of FTY720 significantly augmented the contractile response to S1P, an effect that was partially abolished after the inhibition of cyclooxygenase (COX-)-derived prostaglandins. FTY720 down regulated S1P1 but not S1P2 in renal resistance arteries and in cultured human endothelial cells. This study therefore demonstrates the endothelium is able to compensate for the complete loss of responsiveness of the smooth muscle layer to S1P after long term FTY720 treatment through a mechanism that most likely involves enhanced production of contractile prostaglandins by the endothelium.
Directory of Open Access Journals (Sweden)
Wu JY
2018-03-01
Full Text Available Jun-Yi Wu,1,* Zhong-Xia Wang,1,* Guang Zhang,1 Xian Lu,1 Guang-Hui Qiang,2 Wei Hu,2 An-Lai Ji,3 Jun-Hua Wu,4 Chun-Ping Jiang1 1Department of Hepatobiliary Surgery, Affiliated Drum Tower Hospital of Nanjing University Medical School, Nanjing, Jiangsu, China; 2Department of Hepatobiliary Surgery, Drum Tower Clinical College of Nanjing Medical University, Nanjing, Jiangsu, China; 3Department of General Surgery, The Affiliated Hospital of Yangzhou University, Yangzhou University, Yangzhou, Jiangsu, China; 4Jiangsu Key Laboratory of Molecular Medicine, Medical School, Nanjing University, Nanjing, Jiangsu, China *These authors contributed equally to this work Purpose: FTY720, known as fingolimod, is a new immunosuppressive agent with effective anticancer properties. Although it was recently confirmed that FTY720 inhibits cancer cell proliferation, FTY720 can also induce protective autophagy and reduce cytotoxicity. Blocking autophagy with Beclin 1 siRNA after treatment with FTY720 promotes apoptosis. The objective of this study was to enhance the anticancer effect of FTY720 in hepatocellular carcinoma (HCC by targeted co-delivery of FTY720 and Beclin 1 siRNA using calcium phosphate (CaP nanoparticles (NPs.Materials and methods: First, the siRNA was encapsulated within the CaP core. To form an asymmetric lipid bilayer structure, we then used an anionic lipid for the inner leaflet and a cationic lipid for the outer leaflet; after removing chloroform by rotary evaporation, these lipids were dispersed in a saline solution with FTY720. The NPs were analyzed by transmission electron microscopy, dynamic light scattering and ultraviolet–visible spectrophotometry. Cancer cell viability and cell death were analyzed by MTT assays, fluorescence-activated cell sorting analysis and Western blotting. In addition, the in vivo effects of the NPs were investigated using an athymic nude mouse subcutaneous transplantation tumor model.Results: When the CaP NPs, called
Test of EMG-720 explosive magneto-cumulative generator
Energy Technology Data Exchange (ETDEWEB)
Popkov, N F; Pikar, A S; Ryaslov, E A [All-Russian Research Inst. of Experimental Physics, Sarov (Russian Federation); and others
1997-12-31
The results of testing of the 30 MJ explosive magnetocumulative generator EMG-720 are reported. This comparatively simple and inexpensive generator is destined for energizing a stationary electro-physical facility placed in a special explosion-protected bunker. The current increase coefficient and the energy increase factor of the generator are as high as 500 and 120, respectively. The generator operating time is 225 s, and its internal operating voltage is higher than 100 kV. (J.U.). 4 figs., 4 refs.
Pessoa’s myth of the King Sebastian reinterpreted
Directory of Open Access Journals (Sweden)
Monika Świda
2013-01-01
Full Text Available The present paper depicts alterations undergone by the sleeping king motif (sebastianism in the writings of Fernando Pessoa. The data to conduct the study were collected in thematic anthologies and several unpublished pieces. The myth of the King Sebastian was given a congregational dimension by Pessoa, thus conveying his cultural and identity project subsumed under the metaphor of the spiritual empire. Pessoa introduces some readjustments in the way the historical king is to be conceived of. In his theory, Sebastian becomes the figure of the individual effort on the way towards the national renewal. The messianic character of D. Sebastião is defeated in this theory despite having been associated with the figures of either Jesus or the Antichrist. The messiah of the Portuguese foundation myth is replaced with the idea of great man and the task to be carried out in this field, included the metaphor of the Fifth Empire, gains a cultural character. That is why Pessoa’s theories must no longer be interpreted in messianic terms. The Pessoa’s transformations of the sebastianism analyzed in this article are the starting point for the new national narration in the poetic cycle of "Mensagem".
Iodine-125 seeds for cancer treatment
Energy Technology Data Exchange (ETDEWEB)
Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Feher, Anselmo; Moura, Joao A.; Moura, Eduardo S.; Nagatomi, Helio R.; Manzoli, Jose E.; Souza, Carla D., E-mail: elisaros@ipen.b, E-mail: czeituni@pobox.co, E-mail: afeher@ipen.b, E-mail: jmoura31@yahoo.com.b, E-mail: esmoura@ipen.b, E-mail: hrnagato@ipen.b, E-mail: jemanzoli@ipen.b, E-mail: cdsouza@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Karam, Dib, E-mail: dib.karan@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades
2009-07-01
In Brazil, cancer has become one of the major public health problems. An estimate by the Health Ministry showed that 466,430 people had the disease in the country in 2008. The prostate cancer is the second largest death cause among men. The National Institute of Cancer estimated the occurrence of 50,000 new cases for 2009. Some of these patients are treated with Brachytherapy, using Iodine-125 seeds. By this technique, small seeds with Iodine-125, a radioactive material, are implanted in the prostate. The advantages of radioactive seed implants are the preservation of healthy tissues and organs near the prostate, besides the low rate of impotence and urinary incontinence. The Energy and Nuclear Research Institute - IPEN, which belongs to the Nuclear Energy National Commission - CNEN, established a program for the development of the technique and production of Iodine-125 seeds in Brazil. The estimate for the 125-Iodine seeds demand is of 8,000 seeds/month and the laboratory to be implanted will need this production capacity. The purpose of this paper is to explain the project status and show some data about the seeds used in the country. The project will be divided in two phases: technological development of a prototype and a laboratory implementation for the seeds production. (author)
Mandatory menu labeling in one fast-food chain in King County, Washington.
Finkelstein, Eric A; Strombotne, Kiersten L; Chan, Nadine L; Krieger, James
2011-02-01
As part of a comprehensive effort to stem the rise in obesity, King County, Washington, enforced a mandatory menu-labeling regulation requiring all restaurant chains with 15 or more locations to disclose calorie information at the point of purchase beginning in January 2009. The purpose of this study is to quantify the impact of the King County regulation on transactions and purchasing behavior at one Mexican fast-food chain with locations within and adjacent to King County. To examine the effect of the King County regulation, a difference-in-difference approach was used to compare total transactions and average calories per transaction between seven King County restaurants and seven control locations focusing on two time periods: one period immediately following the law until the posting of drive-through menu boards (January 2009 to July 2009) and a second period following the drive-through postings (August 2009 through January 2010). Analyses were conducted in 2010. No impact of the regulation on purchasing behavior was found. Trends in transactions and calories per transaction did not vary between control and intervention locations after the law was enacted. In this setting, mandatory menu labeling did not promote healthier food-purchasing behavior. Copyright © 2011 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.
King's theory of goal attainment: exploring functional status.
Caceres, Billy A
2015-04-01
Imogene King's Theory of Goal Attainment provides a schema for nurses interested in functional status. However, the lack of a uniform definition for functional status has hindered development of a concise understanding of this phenomenon. Functional status is particularly important to nurses who are concerned with the safety and wellbeing of clients. With healthcare's increased focus on client-family-centered care it is important to develop innovative approaches for evaluating functional status that incorporate the client-family perspective. King's focus on mutual decision-making is an underutilized resource that can provide great insight into the study and understanding of functional status. © The Author(s) 2015.
Martin Luther King Jr. contest winning posters to be displayed in downtown Blacksburg
Shannon, Kelly Baker
2010-01-01
Each year as part of the Martin Luther King Jr. celebration at Virginia Tech area kindergarten through 12th grade students are invited to participate in the annual Martin Luther King Jr. poster contest.
20 CFR 668.720 - What information must these planning documents contain?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What information must these planning... 166 Planning/Funding Process § 668.720 What information must these planning documents contain? (a) The... planning instructions issued by the Department, the comprehensive services plan must describe in narrative...
21 CFR 720.9 - Misbranding by reference to filing or to statement number.
2010-04-01
... SERVICES (CONTINUED) COSMETICS VOLUNTARY FILING OF COSMETIC PRODUCT INGREDIENT COMPOSITION STATEMENTS § 720... Administration of the firm or the product. Any representation in labeling or advertising that creates an...
Energy Technology Data Exchange (ETDEWEB)
Kaizl, Mira
2010-07-15
At Waghaeusel in the German state of Baden-Wuerttemberg, the local solar provider Wirsol Solar AG constructed a restaurant building for the Burger King GmbH. The building consumes comparably little energy and has a solar roof for photovoltaic power generation. Burger King hopes for good money and a clean image, while Wirsol Solar is hoping for new projects in Europe and in the USA. (orig.)
2010-07-01
... concerning the health and environmental effects of a substance. 720.50 Section 720.50 Protection of... environmental effects of a substance. (a) Test data on the new chemical substance in the possession or control... concerning the health and environmental effects of the new chemical substance that are known to or reasonably...
Synthesis of (125) I-lamivudine and (125) I-lamivudine-ursodeoxycholic acid codrug.
Motaleb, M A; Abo-Kul, M; Ibrahim, Samy M; Saad, Shokry M; Arafat, Muhammad
2016-09-01
The preparation of (125) I-lamivudine ((125) I-3TC) and (125) I-lamivudine-ursodeoxycholic acid codrug ((125) I-3TC-UDCA), suitable for comparative biodistribution studies, is described. The synthesis of the unlabeled precursor 3TC-UDCA proceeds in an 11.6% yield, and the radiolabelling yields for (125) I-3TC and (125) I-3TC-UDCA were 89 and 92%, respectively. The final products are radiochemically pure (greater than 98%). Copyright © 2016 John Wiley & Sons, Ltd.
When the King Becomes your Personal Enemy: W. T. Stead, King Leopold II, and the Congo Free State
Directory of Open Access Journals (Sweden)
Marysa Demoor
2013-04-01
mso-fareast-language:JA;} This paper will highlight an unknown but important episode in the life of the journalist W. T. Stead, which, intriguingly, remained unmentioned in Belgian, British, and colonial historiography. It concerns a face-to-face meeting between Stead and Leopold II, King of the Belgians, which certainly did not leave Stead the ‘friend of all Kings’, as the posthumous article published by the 'Daily Mirror' contended. Based on Stead’s own Character Sketches in the 'Review of Reviews', the paper will show how Stead’s perceptions of the scandalous government of the Congo Free State result to a large extent from his own meeting (probably towards the end of 1884 with King Leopold II, and the King’s refusal to cooperate with Britain in an improvised rescue of General Gordon in Sudan.
24 CFR 266.125 - Scope and nature of sanctions.
2010-04-01
... AUTHORITIES HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Housing Finance Agency Requirements § 266.125 Scope and nature of sanctions. (a) Actions by Designated...
Responses by king snakes (Lampropeltis getulus) to chemicals from colubrid and crotaline snakes.
Weldon, P J; Schell, F M
1984-10-01
Four litters of king snakes (Lampropeltis getulus), a snake-eating species, were tested for responses to chemicals from colubrid and crotaline snakes. King snakes presented with swabs rubbed against the dorsal skin of living snakes and with swabs treated with methylene chloride extracts of shed snake skins tongue-flicked more to swabs from a northern copperhead (Agkistrodon contortrix), a crotaline, than to swabs from some colubrid snakes or to blank swabs. Six out of 10 king snakes in one litter attacked and attempted to ingest swabs treated with snake skin chemicals, implicating these chemicals as feeding stimuli for these ophiophagous snakes. Ingestively naive king snakes presented with plain air and snake odors in an olfactometer tongue-flicked more to snake odors. This study and others suggest that crotaline and colubrid snakes can be distinguished by chemical cues.
Re-shaping King Lear: Space, Place, Costume, and Genre
Directory of Open Access Journals (Sweden)
Hattaway Michael
2017-06-01
Full Text Available Performance studies must enjoy parity of esteem with critical studies because they remind us of the plurality of “readings” that are generated by a Shakespearean text. Shakespeare seems to have apprehended this when, in Othello, he used a nonce-word, “denotement”, which applies to Othello’s reading of his wife in his mind’s eye. I examine other sequences in which we watch a character “reading” on-stage or imagined action, in Hamlet, Titus Andronicus, Cymbeline, Richard II, and Troilus and Cressida. In Hamlet this involves re-reading as well as generic displacement, which, I argue, is a way of rendering inwardness. As I test case, I analyse a production of King Lear by Shakespeare’s Globe, on a fairground stage, in which the king reshaped himself, became a folkloric figure, like a figure in Nashe’s Summer’s Last Will and Testament. The play itself was thus, indecorously, reshaped as “The Tale of King Lear”. “Dramatic truth”, therefore, in no way depends upon theatrical “realism”.
Ultraviolet reflecting photonic microstructures in the King Penguin beak.
Dresp, Birgitta; Jouventin, Pierre; Langley, Keith
2005-09-22
King and emperor penguins (Aptenodytes patagonicus and Aptenodytes forsteri) are the only species of marine birds so far known to reflect ultraviolet (UV) light from their beaks. Unlike humans, most birds perceive UV light and several species communicate using the near UV spectrum. Indeed, UV reflectance in addition to the colour of songbird feathers has been recognized as an important signal when choosing a mate. The king penguin is endowed with several highly coloured ornaments, notably its beak horn and breast and auricular plumage, but only its beak reflects UV, a property considered to influence its sexual attraction. Because no avian UV-reflecting pigments have yet been identified, the origin of such reflections is probably structural. In an attempt to identify the structures that give rise to UV reflectance, we combined reflectance spectrophotometry and morphological analysis by both light and electron microscopy, after experimental removal of surface layers of the beak horn. Here, we characterize for the first time a multilayer reflector photonic microstructure that produces the UV reflections in the king penguin beak.
Behavioral and physiological significance of minimum resting metabolic rate in king penguins.
Halsey, L G; Butler, P J; Fahlman, A; Woakes, A J; Handrich, Y
2008-01-01
Because fasting king penguins (Aptenodytes patagonicus) need to conserve energy, it is possible that they exhibit particularly low metabolic rates during periods of rest. We investigated the behavioral and physiological aspects of periods of minimum metabolic rate in king penguins under different circumstances. Heart rate (f(H)) measurements were recorded to estimate rate of oxygen consumption during periods of rest. Furthermore, apparent respiratory sinus arrhythmia (RSA) was calculated from the f(H) data to determine probable breathing frequency in resting penguins. The most pertinent results were that minimum f(H) achieved (over 5 min) was higher during respirometry experiments in air than during periods ashore in the field; that minimum f(H) during respirometry experiments on water was similar to that while at sea; and that RSA was apparent in many of the f(H) traces during periods of minimum f(H) and provides accurate estimates of breathing rates of king penguins resting in specific situations in the field. Inferences made from the results include that king penguins do not have the capacity to reduce their metabolism to a particularly low level on land; that they can, however, achieve surprisingly low metabolic rates at sea while resting in cold water; and that during respirometry experiments king penguins are stressed to some degree, exhibiting an elevated metabolism even when resting.
The Institute of Epileptology of King's College, University of London.
Reynolds, E H
1995-01-01
The Institute of Epileptology of King's College, London has arisen from need and from opportunity. The need is due to the relative neglect nationally and internationally of the most common serious brain disorder with important physical, psychological, and social complications. The relative neglect is reflected in services, research, charitable donations, public profile, and stigma and in a serious lack of professional education. The opportunity arose because of the existence in several medical institutions at Denmark Hill, London, of a group of medical and related colleagues with a special interest covering almost every aspect of this multidisciplinary disorder who agreed to combine their expertise in this initiative. The idea was born and developed in 1991-1992 and was supported by all the parent institutions: The Maudsley and King's College Hospitals, St. Piers Lingfield, The Institute of Psychiatry, King's College School of Medicine and Dentistry, and the School of Life, Basic Medical and Health Sciences, all under the umbrella of King's College, University of London. Further stimulus and help came from a group of dedicated supporters in private and public life. There are three strands to this initiative: (a) a charity, The Fund for Epilepsy; (b) the clinical Centre for Epilepsy, which was formally opened at the Maudsley Hospital in July 1994; and (c) the academic Institute of Epileptology for research and teaching, which was launched on November 15, 1994.
Briti publik armastab King Kongi / Andris Feldmanis
Feldmanis, Andris, 1982-
2006-01-01
Briti filmiajakiri Empire lugejate filmiauhinnad : parim film "King Kong" (Peter Jackson), parim režii Steve Box, Nick Park "Wallace & Gromit - libaküüliku needus", parim meesnäitleja Johnny Depp, parim naisnäitleja Thandie Newton
From Typology to Topography in Clarence King's "Mountaineering in the Sierra Nevada."
Hoekzema, Loren
The book "Mountaineering in the Sierra Nevada" by Clarence King, a late-ninteenth-century American geologist, writer, art critic, and romantic, is discussed in this paper. In the writing and revision of this book, King was attempting a metamorphosis of landscape description into popular reading as he moved from being a symbolic writer to…
76 FR 33025 - Proposed Collection; Comment Request for Form 720X
2011-06-07
... of Form 720X is the result of a project to provide a uniform standard for trust fund accounting.... Books or records relating to a collection of information must be retained as long as their contents may... information is necessary for the proper performance of the functions of the agency, including whether the...
Directory of Open Access Journals (Sweden)
Michael K. Schuhmann
2015-12-01
Full Text Available Breakdown of the blood-brain barrier (BBB is an early hallmark of multiple sclerosis (MS, a progressive inflammatory disease of the central nervous system. Cell adhesion in the BBB is modulated by sphingosine-1-phosphate (S1P, a signaling protein, via S1P receptors (S1P1. Fingolimod phosphate (FTY720-P a functional S1P1 antagonist has been shown to improve the relapse rate in relapsing-remitting MS by preventing the egress of lymphocytes from lymph nodes. However, its role in modulating BBB permeability—in particular, on the tight junction proteins occludin, claudin 5 and ZO-1—has not been well elucidated to date. In the present study, FTY720-P did not change the transendothelial electrical resistance in a rat brain microvascular endothelial cell (RBMEC culture exposed to inflammatory conditions and thus did not decrease endothelial barrier permeability. In contrast, occludin was reduced in RBMEC culture after adding FTY720-P. Additionally, FTY720-P did not alter the amount of endothelial matrix metalloproteinase (MMP-9 and MMP-2 in RBMEC cultures. Taken together, our observations support the assumption that S1P1 plays a dual role in vascular permeability, depending on its ligand. Thus, S1P1 provides a mechanistic basis for FTY720-P-associated disruption of endothelial barriers—such as the blood-retinal barrier—which might result in macular edema.
International Nuclear Information System (INIS)
Shinozuka, Eriko; Miyashita, Masao; Mizuguchi, Yoshiaki; Akagi, Ichiro; Kikuchi, Kunio; Makino, Hiroshi; Matsutani, Takeshi; Hagiwara, Nobutoshi; Nomura, Tsutomu; Uchida, Eiji; Takizawa, Toshihiro
2013-01-01
Highlights: ► SnoN modulated miR-720, miR-1274A, and miR-1274B expression levels in TE-1 cells. ► miR-720 and miR-1274A suppressed the expression of target proteins p63 and ADAM9. ► Silencing of SnoN significantly upregulated cell proliferation in TE-1 cells. ► Esophageal cancer tissues have lower SnoN expression levels than normal tissues. ► Esophageal cancer tissues have higher miR-720 expression levels than normal tissues. -- Abstract: It is now evident that changes in microRNA are involved in cancer progression, but the mechanisms of transcriptional regulation of miRNAs remain unknown. Ski-related novel gene (SnoN/SKIL), a transcription co-factor, acts as a potential key regulator within a complex network of p53 transcriptional repressors. SnoN has pro- and anti-oncogenic functions in the regulation of cell proliferation, senescence, apoptosis, and differentiation. We characterized the roles of SnoN in miRNA transcriptional regulation and its effects on cell proliferation using esophageal squamous cell carcinoma (ESCC) cells. Silencing of SnoN altered a set of miRNA expression profiles in TE-1cells, and the expression levels of miR-720, miR-1274A, and miR-1274B were modulated by SnoN. The expression of these miRNAs resulted in changes to the target protein p63 and a disintegrin and metalloproteinase domain 9 (ADAM9). Furthermore, silencing of SnoN significantly upregulated cell proliferation in TE-1 cells, indicating a potential anti-oncogenic function. These results support our observation that cancer tissues have lower expression levels of SnoN, miR-720, and miR-1274A compared to adjacent normal tissues from ESCC patients. These data demonstrate a novel mechanism of miRNA regulation, leading to changes in cell proliferation.
AFSC/RACE/SAP/Long: Data from: Embryo development in golden king crab, Lithodes aequispina.
National Oceanic and Atmospheric Administration, Department of Commerce — The data from this study, describes embryo development in Golden king crab, Lithodes aequispinus. Six female multiparous golden king crab were captured from the...
Mirza, Ather
2015-01-01
In February 2013, the University of Leicester staged what The Guardian described as "The most extraordinary press conference ever held at any UK university." This was part of a media and communications campaign that brought worldwide attention to the discovery of King Richard III by the University's archaeologists. How do you manage a…
3 CFR 8340 - Proclamation 8340 of January 15, 2009. Martin Luther King, Jr., Federal Holiday, 2009
2010-01-01
... Proclamation 8340 of January 15, 2009 Proc. 8340 Martin Luther King, Jr., Federal Holiday, 2009By the President of the United States of America A Proclamation On the Martin Luther King, Jr., Federal Holiday, we... Constitution and laws of the United States, do hereby proclaim January 19, 2009, as the Martin Luther King, Jr...
Sediment sources and transport in Kings Bay and vicinity, Georgia and Florida, July 8-16, 1982
Radtke, D.B.
1985-01-01
Water quality, bottom-material, suspended-sediment, and current velocity data were collected during July 1982 in Kings Bay and vicinity to provide information on the source and transport of estuarine sediments. Kings Bay and Cumberland Sound, the site of the Poseidon Submarine Base in southeast Georgia, are experiencing high rates of sediment deposition and accumulation, which are causing serious navigational and operational problems. Velocity, bathymetry, turbidity, and bottom-material data suggest sediment transported from lower Kings Bay is accumulating deposits of suspended sediment transported from Cumberland Sound on the floodtide and from upper Kings Bay and the tidal march drained by Marianna Creek on the ebbtide. Suspended-sediment discharges computed for consecutive 13-hr ebbtides and floodtides showed that a net quantity of suspended sediment was transported seaward from upper Kings Bay and Marianna Creek. A net landward transport of suspended sediment computed at the St. Marys Entrance indicated areas seaward of St. Marys Entrance may be supplying sediment to the shoaling areas of the estuary, including lower Kings Bay. (USGS)
McConnell, J.B.; Radtke, D.B.; Hale, T.W.; Buell, G.R.
1983-01-01
Water-quality, bottom-material, suspended-sediment, and current-velocity data were collected during November 1981 in Kings Bay and vicinity to provide information on the sources and transport of estuarine sediments. Kings Bay and Cumberland Sound , the site of the Poseidon Submarine Base in southeast Georgia, are experiencing high rates of sediment deposition and accumulation, which are causing serious navigational and operational problems. Velocity, bathymetry, turbidity, and bottom-material data suggest that the area in the vicinity of lower Kings Bay is accumulating deposits of suspended sediment transported from Cumberland Sound on the floodtide and from upper Kings Bay and the tidal marsh drained by Marianna Creek on the ebbtide. Suspended-sediment discharges computed for consecutive 13-hour ebbtides and floodtides showed that a net quantity of suspended sediment was transported seaward from upper Kings Bay and Marianna Creek. A net landward transport of suspended sediment computed at the St. Marys Entrance indicated areas seaward of St. Marys Entrance may be supplying sediment to the shoaling areas of the estuary, including lower Kings Bay. (USGS)
21 CFR 720.7 - Notification of person submitting cosmetic product ingredient statement.
2010-04-01
... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Notification of person submitting cosmetic product... AND HUMAN SERVICES (CONTINUED) COSMETICS VOLUNTARY FILING OF COSMETIC PRODUCT INGREDIENT COMPOSITION STATEMENTS § 720.7 Notification of person submitting cosmetic product ingredient statement. When Form FDA...
42 CFR 412.125 - Effect of change of ownership on payments under the prospective payment systems.
2010-10-01
... prospective payment systems. 412.125 Section 412.125 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM PROSPECTIVE PAYMENT SYSTEMS FOR INPATIENT HOSPITAL SERVICES Payments to Hospitals Under the Prospective Payment Systems § 412.125 Effect of change of...
Khan, Iftikhar A R; Al-Maghrabi, Mohammad; Kassim, Mohammad Salah; Tawfeeq, Mansour; Al-Saif, Faisal; Al-Oraifi, Ibrahim; Al-Qahtani, Mohammed; Alsaghier, Mohammad
2014-07-01
The success of a pediatric kidney transplantation program can only be judged by reviewing its results. We aim to audit our short-term outcome of pediatric kidney transplantation at the King Fahad Specialist Hospital-Dammam. A retrospective chart review was performed to collect data about recipient demographics, etiology of end-stage kidney disease, type of dialysis, type of donor and outcome. Between September 2008 and April 2012, 35 pediatric kidney trans-plantations (need to encourage preemptive transplantation and living donation in this population.
AHP 47: THE GREEDY KING AND TRICKY MAN
Directory of Open Access Journals (Sweden)
Lcags so lhun 'grub ལྕགས་སོ་ལྷུན་འགྲུབ། (Klu sgrub ཀླུ་སྒྲུབ།
2017-04-01
Full Text Available Rgya mo skyid (b. 1992 of Mdo ba Town, Reb gong (Thun rin, Tongren County, Rma lho (Huangnan Tibetan Autonomous Prefecture, Mtsho sngon (Qinghai Province, China told me this story in an apartment in Xi'an City, Shaanxi Province on 21 August, 2016. She said, "When I was about five years old, my grandfather (Kun bzang, b. 1939 told me many stories such as this before we went to bed every night. I forgot many stories, but this story is still very clear." There was once a greedy local king who collected taxes monthly. There was also a very poor man known as Tricky Tsag thul. The local king came to Tricky's home to punish him for not paying his taxes for several months. ...
An ideal for leadership - Psalm 72: The (wise king - Royal mediation of God�s universal reign
Directory of Open Access Journals (Sweden)
D. J. Human
2002-08-01
Full Text Available Psalm 72 propounds illuminating theological perspectives on leadership. The central figure in the psalm is the king. Throughout the Ancient Near East the king played a distinctive role, not only in contemporary politics, but also in religious life. Despite several differences from the other nations, kingship in Israel was rooted in the worldview of the ancient East. Yahweh, like other gods, commissioned the king for his tasks. The wise king in Israel, who alludes in Psalm 72 to the figure of Solomon, is obliged to rule with justice in order to maintain peace and prosperity in society.
Detection Limits Of The 125I Air Sampler ''RIS125''
International Nuclear Information System (INIS)
Belaish, I.; Levinson, S.; German, U.; Kravchik, T.
1999-01-01
A system for 125 I monitoring in air (RIS-125) was designed and manufactured at NRCN. The main features of the system are described elsewhere. The system can monitor 125 I air contamination in gaseous and aerosol forms. An air monitoring system should have a fast response and the lowest available Minimum Detectable Activity (MDA). The present work presents the characteristic MDA values of the system
Energy Technology Data Exchange (ETDEWEB)
Palmer, E. [Westinghouse Savannah River Company, AIKEN, SC (United States)
1996-03-01
Gunsite 720 Rubble Pit Unit is located on the west side of SRS. In the early to mid 1980`s, while work was being performed in this area, nine empty, partially buried drums, labeled `du Pont Freon 11`, were found. As a result, Gunsite 720 became one of the original waste units specified in the SRS RCRA Facility Assessment (RFA). The drums were excavated on July 30, 1987 and placed on a pallet at the unit. Both the drums and pallet were removed and disposed of in October 1989. The area around the drums was screened during the excavation and the liquid (rainwater) that collected in the excavated drums was sampled prior to disposal. No evidence of hazardous materials was found. Based on the review of the analytical data and screening techniques used to evaluate all the chemicals of potential concern at Gunsite 720 Rubble Pit Unit, it is recommended that no further remedial action be performed at this unit.
International Nuclear Information System (INIS)
Palmer, E.
1996-03-01
Gunsite 720 Rubble Pit Unit is located on the west side of SRS. In the early to mid 1980's, while work was being performed in this area, nine empty, partially buried drums, labeled 'du Pont Freon 11', were found. As a result, Gunsite 720 became one of the original waste units specified in the SRS RCRA Facility Assessment (RFA). The drums were excavated on July 30, 1987 and placed on a pallet at the unit. Both the drums and pallet were removed and disposed of in October 1989. The area around the drums was screened during the excavation and the liquid (rainwater) that collected in the excavated drums was sampled prior to disposal. No evidence of hazardous materials was found. Based on the review of the analytical data and screening techniques used to evaluate all the chemicals of potential concern at Gunsite 720 Rubble Pit Unit, it is recommended that no further remedial action be performed at this unit
Notch size effects on high cycle fatigue limit stress of Udimet 720
International Nuclear Information System (INIS)
Ren Weiju; Nicholas, Theodore
2003-01-01
Notch size effects on the high cycle fatigue (HCF) limit stress of Ni-base superalloy Udimet 720 were investigated on cylindrical specimens with three notch sizes of the same stress concentration factor K t =2.74. The HCF limit stress corresponding to a life of 10 6 cycles was experimentally determined at a stress ratio of 0.1 and a frequency of 25 Hz at room temperature. The stresses were calculated using finite element analysis (FEA) and the specimens analyzed using scanning electron microscopy (SEM). Test results show that at the same K t value, notch size can slightly affect the HCF limit stress of U720 when notch root plasticity occurs. FEA and SEM results reveal that the notch size effects are influenced by a complicated combination of the stress and plastic strain fields at the notch tip, the nominal stress, and the effects of prior plastic deformation on fatigue crack initiation
Religión y Paz en Martin Luther King Jr.
Mussio, Ria Stacy
2016-01-01
Esta tesis pretende mostrar el rol integral que la religión desempeñaba en la obtención de los derechos civiles para los afroamericanos y, también en el logro de la paz positiva. Martin Luther King Jr. y la mayoría de los manifestantes del movimiento eran cristianos, poniendo su fe en Dios, para el pleno disfrute de sus derechos humanos. King Jr., anclado en su fe, impulsó el avance de los derechos civiles, mediante la resistencia no violenta. El primer capítulo tiene como finalidad orientar ...
An Uncommon Complication with a Supraglottic Airway: The King LT.
Brown, Sara; Cherian, Verghese T; Greco, Katherine; Mets, Elbert; Budde, Arne
2016-02-15
General anesthesia was administered in an 18-year-old man for removal of hardware from his right knee using a King Laryngeal Tube supraglottic airway. An hour after extubation, he reported inability to swallow with no respiratory distress. Examination showed an edematous uvula, which took 3 days to subside with anti-inflammatory medication. During the positioning of the King Laryngeal Tube, it was pulled back to ensure adequate ventilation. The inflated cuff could have dragged the uvula and folded it on itself, leading to venous congestion and edema.
Synchronization and an application of a novel fractional order King Cobra chaotic system
Energy Technology Data Exchange (ETDEWEB)
Muthukumar, P., E-mail: muthukumardgl@gmail.com; Balasubramaniam, P., E-mail: balugru@gmail.com [Department of Mathematics, Gandhigram Rural Institute‐Deemed University, Gandhigram 624 302, Tamilnadu (India); Ratnavelu, K., E-mail: kuru052001@gmail.com [Faculty of Science, Institute of Mathematical Sciences, University of Malaya, 50603 Kuala Lumpur (Malaysia)
2014-09-01
In this paper, we design a new three dimensional King Cobra face shaped fractional order chaotic system. The multi-scale synchronization scheme of two fractional order chaotic systems is described. The necessary conditions for the multi-scale synchronization of two identical fractional order King Cobra chaotic systems are derived through feedback control. A new cryptosystem is proposed for an image encryption and decryption by using synchronized fractional order King Cobra chaotic systems with the supports of multiple cryptographic assumptions. The security of the proposed cryptosystem is analyzed by the well known algebraic attacks. Numerical simulations are given to show the effectiveness of the proposed theoretical results.
Archeology in Medicine: Digging up into the tophi of Popes, Dukes and Kings
Directory of Open Access Journals (Sweden)
G. Ceccarelli
2011-09-01
Full Text Available According to an Anglo-Saxon pun, “gout is the king of diseases and the disease of Kings”. In fact, it is well-known that in past times a quantity of famous persons, including Kings and Popes, were affected with this rheumatic disorder. In this paper biographical anecdotes on several Popes (Pius III, Julius II, Julius III, Clement VIII, Innocent XI, Clement XII and Pius VIII, King George IV and Queen Anne of England, as well as on some members of the Lorraine lineage, all suffering from gout, are sketched out. These historical data are briefly discussed in relation to the celebrated Hippocrates’s aphorisms on gout.
Lim, H. S.; Lee, J. Y.; Yoon, H.
2016-12-01
Soil temperatures, water temperatures, and weather parameters were monitored at a variety of locations in the vicinity of King Sejong station, King George Island, Antarctica, during summer 2010-2011. Thermal characteristics of soil and water were analysed using time-series analyses, apparent thermal diffusivity (ATD), and active layer thickness. The temperatures of pond water and nearby seawater showed the distinctive diurnal variations and correlated strongly with solar radiation (r = 0.411-0.797). Soil temperature (0.1-0.3 m depth) also showed diurnal fluctuations that decreased with depth and were directly linked to air temperature (r = 0.513-0.783) rather than to solar radiation; correlation decreased with depth and the time lag in the response increased by 2-3 hours per 0.1 m of soil depth. Owing to the lack of snow cover, summertime soil temperature was not decoupled from air temperature. Estimated ATD was between 0.022 and 29.209 mm2/sec, showed temporal and spatial variations, and correlated strongly with soil moisture content. The maximum estimated active layer thickness in the study area was a 41-70 cm, which is consistent with values reported in the previous work.
33 CFR 165.720 - Safety/Security Zone: St. Johns River, Jacksonville, FL.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: St. Johns... OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED... § 165.720 Safety/Security Zone: St. Johns River, Jacksonville, FL. (a) Location. The water and the land...
Sera-Shriar, Efram
2015-06-01
In 1848 the ethnologist, surgeon and Arctic explorer Richard King (1810-1876) published a three-part series on Inuit in the Journal of the Ethnological Society of London. This series provided a detailed history of Inuit from the eleventh century to the early nineteenth century. It incorporated a mixture of King's personal observations from his experience travelling to the Arctic as a member of George Back's expedition (1833-1835), and the testimonies of other contemporary and historical actors who had written on the subject. The aim was to historicise Inuit through the use of travel reports and show persistent features among the race. King was a monogenist and his sensitive recasting of Inuit was influenced by his participation in a research community actively engaged in humanitarian and abolitionist causes. The physician and ethnologist Thomas Hodgkin (1798-1866) argued that King's research on Inuit was one of the best ethnological approaches to emulate and that it set the standard for the nascent discipline. If we are to take seriously Hodgkin's claim, we should look at how King constructed his depiction of Inuit. There is much to be gained by investigating the practices of nineteenth-century ethnologists because it strengthens our knowledge of the discipline's past and shows how modern understandings of races were formed. Copyright © 2015 Elsevier Ltd. All rights reserved.
Five analogies between a King's Speech treatment and contemporary play therapies.
Terr, Lenore C
2012-01-01
Psychiatric patients frequently respond positively to play therapy, which may rely on psychoanalytic, Jungian, cognitive-behavioral, familial, school-based, or other theories. I wished to determine if there were unifying principles that tie together these various types of play treatments. The fact-based film, The King's Speech, vividly illustrates play utilized by Lionel Logue in his speech treatment (1926-1939) of the future King of England. In the film I found five analogies to the play therapy I employ in office practice. The play scenes in The King's Speech point to five unifying principles among contemporary play therapies: (1) the crucial nature of the relationship, (2) the centrality of having fun, (3) the occasional reliance on others, (4) the interjection of pithy talk, and (5) the usefulness of a little drama. No matter what theory a play therapist ascribes to, these five unifying principles should be kept in mind during treatment.
41 CFR 102-192.125 - What is the appropriate managerial level for an agency mail manager?
2010-07-01
... managerial level for an agency mail manager? 102-192.125 Section 102-192.125 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.125 What is the appropriate managerial level for an agency mail manager? The agency mail manager should be at a managerial...
13 CFR 125.12 - May an SDVO SBC have affiliates?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false May an SDVO SBC have affiliates... CONTRACTING PROGRAMS Eligibility Requirements for the SDVO SBC Program § 125.12 May an SDVO SBC have affiliates? A concern may have affiliates provided that the aggregate size of the concern and all its...
24 CFR 125.301 - Education and Outreach Initiative.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Education and Outreach Initiative... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.301 Education and Outreach Initiative. (a) The Education and Outreach Initiative provides funding for the purpose of developing, implementing, carrying out...
Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.
Directory of Open Access Journals (Sweden)
Elizabeth Adkins-Regan
Full Text Available Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis, a species in the same clade as the less monogamous Japanese quail (Coturnix japonica, the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.
Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.
Adkins-Regan, Elizabeth
2016-01-01
Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis), a species in the same clade as the less monogamous Japanese quail (Coturnix japonica), the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.
Ibrahim, Nahla Khamis; AlGhamdi, Manar Saleh; Al-Shaibani, Alanoud Nawaf; AlAmri, Fatima Ali; Alharbi, Huda Abdulrahman; Al-Jadani, Arwa Kheder; Alfaidi, Raghad Ahmed
2015-01-01
Objective: To determine the prevalence, predictors and outcome of dysmenorrhea among female medical students in King Abdulaziz University (KAU), Jeddah, Saudi Arabia. Methods: A cross-sectional study was conducted among 435 medical students at KAU, Jeddah selected through stratified random sample method. A pre-constructed, validated, self-administered questionnaire was used to collect personal and socio-demographic information. Data about menstrual history, stress, smoking were also collected. The severity of dysmenorrhea was scored by the “Visual Analogue Scale (VAS)”. Descriptive and analytical statistics were conducted. Results: The prevalence of dysmenorrhea was 60.9%. Logistic regression showed that heavy period was the first predictor of dysmenorrhea (aOR=1.94; 95% CI: 1.29- 2.91), followed by stress (aOR=1.90; 95% C.I.: 1.19-3.07). The prevalence of severe dysmenorrhea among the sufferers was 38.6%. Depressed mood was the commonest (80.8%) symptom accompanying dysmenorrhea. Regarding the outcome of dysmenorrhea, 67.5% of the sufferes reported emotional instability, while 28.3% reported absenteeism from the university. Conclusions: A high prevalence of dysmenorrhea was prevalent among medical students in King Abdulaziz University (KAU), Health promotion, screening programs, and stress management courses are recommended. PMID:26870088
77 FR 46771 - Notice of Permit Applications Received Under the Antarctic Conservation Act of 1978
2012-08-06
... handle adult penguins (Gentoo, Chinstrap and Adelie) to obtain small samples of body and tail feathers... Island; ASPA 125-King George Island; ASPA 126-Livingston Island; ASPA 128-Western shore of Admiralty Bay...; ASPA 117-Avian Island; ASPA 125-King George Island; ASPA 126-Livingston Island; ASPA 128-Western shore...
"King Corn": Teaching the Food Crisis
Swinehart, Tim
2012-01-01
"King Corn" is in so many ways the story of how government food policy has entirely remade the food landscape in the United States over the last 40 years. From the massive expansion of the number of acres of corn grown across the country, to the ever-increasing ways that corn is incorporated into the food production process, to the…
AFSC/RACE/SAP/Urban: Golden King Crab tagging
National Oceanic and Atmospheric Administration, Department of Commerce — The data is comprised of the records of individual male golden king crab (GKC) tagged at the Kodiak Laboratory. Initial size, shell condition and missing limbs was...
Hosseinpour-Feizi, Hojjat; Soleimanpour, Jafar; Sales, Jafar Ganjpour; Arzroumchilar, Ali
2011-01-01
The aim of this study was to investigate the interobserver agreement of the Lenke and King classifications for adolescent idiopathic scoliosis, and to compare the results of surgery performed based on classification of the scoliosis according to each of these classification systems. The study was conducted in Shohada Hospital in Tabriz, Iran, between 2009 and 2010. First, a reliability assessment was undertaken to assess interobserver agreement of the Lenke and King classifications for adolescent idiopathic scoliosis. Second, postoperative efficacy and safety of surgery performed based on the Lenke and King classifications were compared. Kappa coefficients of agreement were calculated to assess the agreement. Outcomes were compared using bivariate tests and repeated measures analysis of variance. A low to moderate interobserver agreement was observed for the King classification; the Lenke classification yielded mostly high agreement coefficients. The outcome of surgery was not found to be substantially different between the two systems. Based on the results, the Lenke classification method seems advantageous. This takes into consideration the Lenke classification's priority in providing details of curvatures in different anatomical surfaces to explain precise intensity of scoliosis, that it has higher interobserver agreement scores, and also that it leads to noninferior postoperative results compared with the King classification method.
The King-Denborough syndrome in the paediatric patient.
African Journals Online (AJOL)
We describe the management of two children with a diagnosis of King Denborough syndrome. ... the anaesthetic management of two cases of KDS presenting for sur- .... al suggest that the syndrome represents a phenotype that is common to.
Directory of Open Access Journals (Sweden)
Sait KH
2011-07-01
Full Text Available Khalid H SaitObstetrics and Gynecology Department, Faculty of Medicine, Gynecology Oncology Unit, King Abdulaziz University Hospital, Jeddah, Saudi ArabiaBackground: The purpose of this study was to review our experience and the challenges of using the da Vinci® surgical system robot during gynecological surgery at King Abdulaziz University Hospital.Methods: A retrospective study was conducted to review all cases of robot-assisted gynecologic surgery performed at our institution between January 2008 and December 2010. The patients were reviewed for indications, complications, length of hospital stay, and conversion rate, as well as console and docking times.Results: Over the three-year period, we operated on 35 patients with benign or malignant conditions using the robot for a total of 62 surgical procedures. The docking times averaged seven minutes. The mean console times for simple hysterectomy, bilateral salpingo-oophorectomy, and bilateral pelvic lymphadenectomy were 125, 47, and 62 minutes, respectively. In four patients, laparoscopic procedures were converted to open procedures, giving a conversion rate of 6.5%. All of the conversions were among the first 15 procedures performed. The average hospital stay was 3 days. Complications occurred in five patients (14%, and none were directly related to the robotic system.Conclusion: Our early experience with the robot show that with proper training of the robotic team, technical difficulty with the robotic system is limited. There is definitely a learning curve that requires performance of gynecological surgical procedures using the robot.Keywords: da Vinci robot, gynecological surgery, laparoscopy
Additional calcium carbonate into concentrate diet for sheep fed ensiled king grass as a based-diet
Directory of Open Access Journals (Sweden)
I-W Mathius
1997-10-01
Full Text Available In order to ascertain the effect of additional calcium carbonate into concentrate diet, on the performance of sheep fed ensiled king grass as a basal diet, a trial was conducted using 28 growing sheep ( average body weight 17 _+ 1 .4 kg. Based on body weight, the animals were grouped and randomized into four dietary treatments in block randomized design . Dietary treatments were (i chopped king grass + 400 g of concentrate, (ii ensiled king grass + 400 g concentrate + 0 % of calcium carbonate, (iii ensiled king grass + 400 g concentrate + 5 % calcium carbonate and (iv ensiled king grass + 400 g concentrate + 10 % calcium carbonate . Results showed that offering 5 % of calcium carbonate into concentrate diet increased (P 0 .05 for all groups . No differences in the apparent digestibility of the nutrient components were observed, but crude protein decreased significantly (P < 0 .05 . A significant relationship ( P < 0 .01 was found between nitrogen intake (NI and nitrogen retention (NR, and the equation was NR = - 0.1848 + 0.3788 NI ( r = 0.9 . Based on data found that feeding only ensiled king grass as a single diet could not meet the maintenance requirement of energy and protein, therefore, additional energy and crude protein sources is needed .
Morus, Iwan Rhys
2005-01-01
As recently as two hundred years ago, physics as we know it today did not exist. Born in the early nineteenth century during the second scientific revolution, physics struggled at first to achieve legitimacy in the scientific community and culture at large. In fact, the term "physicist" did not appear in English until the 1830s.When Physics Became King traces the emergence of this revolutionary science, demonstrating how a discipline that barely existed in 1800 came to be regarded a century later as the ultimate key to unlocking nature's secrets. A cultural history designed to provid
Phreatic explosions during basaltic fissure eruptions: Kings Bowl lava field, Snake River Plain, USA
Hughes, Scott S.; Kobs Nawotniak, Shannon E.; Sears, Derek W. G.; Borg, Christian; Garry, William Brent; Christiansen, Eric H.; Haberle, Christopher W.; Lim, Darlene S. S.; Heldmann, Jennifer L.
2018-02-01
Physical and compositional measurements are made at the 7 km-long ( 2200 years B.P.) Kings Bowl basaltic fissure system and surrounding lava field in order to further understand the interaction of fissure-fed lavas with phreatic explosive events. These assessments are intended to elucidate the cause and potential for hazards associated with phreatic phases that occur during basaltic fissure eruptions. In the present paper we focus on a general understanding of the geological history of the site. We utilize geospatial analysis of lava surfaces, lithologic and geochemical signatures of lava flows and explosively ejected blocks, and surveys via ground observation and remote sensing. Lithologic and geochemical signatures readily distinguish between Kings Bowl and underlying pre-Kings Bowl lava flows, both of which comprise phreatic ejecta from the Kings Bowl fissure. These basalt types, as well as neighboring lava flows from the contemporaneous Wapi lava field and the older Inferno Chasm vent and outflow channel, fall compositionally within the framework of eastern Snake River Plain olivine tholeiites. Total volume of lava in the Kings Bowl field is estimated to be 0.0125 km3, compared to a previous estimate of 0.005 km3. The main (central) lava lake lost a total of 0.0018 km3 of magma by either drain-back into the fissure system or breakout flows from breached levees. Phreatic explosions along the Kings Bowl fissure system occurred after magma supply was cut off, leading to fissure evacuation, and were triggered by magma withdrawal. The fissure system produced multiple phreatic explosions and the main pit is accompanied by others that occur as subordinate pits and linear blast corridors along the fissure. The drop in magma supply and the concomitant influx of groundwater were necessary processes that led to the formation of Kings Bowl and other pits along the fissure. A conceptual model is presented that has relevance to the broader range of low-volume, monogenetic
Closure certification report: TA-35 TSL-125 surface impoundment
International Nuclear Information System (INIS)
1991-01-01
This report summarizes the actions that were taken to clean close the TA-35 TSL-125 surface impoundment Building 125 is used for developing electron guns and related laser assemblies/equipment for a Laser Technology Research Program at the Laboratory. There is no permanent outfall from the surface impoundment; however, the impoundment accidentally overtopped on December 3, 1986, spilling an unknown volume of insulating oil and water into Ten Site Canyon. Sandbags were installed around the surface impoundment on June 25, 1988, to provide additional freeboard in the impoundment and reduce the risk of overtopping during a precipitation event. On July 1, 1988, the impoundment again overtopped releasing an unknown volume of insulating oil and water. Actions taken include removal of waste from the surface impoundment and its associated structures, decontamination of the floor trough and piping inside Building 125, grouting of the piping connecting the floor drain/trough system to the impoundment, decontamination, removal, and disposal of the impoundment liner and sandbags lining the top of the impoundment, and removal and disposal of contaminated soil underlying the impoundment area. Procedures followed to verify that clean closure objectives have been met are also documented in this report. Initial verification was performed through an extensive soil sampling and analysis program
2011-01-31
... Spanish Mackerel Coastal Migratory Pelagic Fishery Off the Southern Atlantic States; Control Date AGENCY... that it is establishing a new control date to control future access to the king and Spanish mackerel... September 17, 2010, for king and Spanish mackerel. The Council requested a new control date for the king and...
The Influence of Martin Luther King on Education
Harper, Frederick D.
1973-01-01
In a sense, Martin Luther King was an educator whose students composed citizens of the United States, whose classroom encompassed the entire country, and whose course contents and lesson plans included civil rights, race relations, human rights, and love. (Author)
R.I.S.-125 {sup 125}I air monitor system
Energy Technology Data Exchange (ETDEWEB)
Belaish, I; Levinson, S; German, U; Pelled, O; Laichter, Y; Wangrovitz, U; Tirosh, D; Barak, D [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev
1996-12-01
We have developed at NRCN a prototype of a continuous K-Ray air monitoring (CAM) system called `R.1.S.-125` (Radioactive Isotope Sampler for {sup 125}I). The system. was checked according to ANSI N42.17B -1989 (authors).
Thermal strategies of king penguins during prolonged fasting in water.
Lewden, Agnès; Enstipp, Manfred R; Bonnet, Batshéva; Bost, Caroline; Georges, Jean-Yves; Handrich, Yves
2017-12-15
Most animals experience periods of unfavourable conditions, challenging their daily energy balance. During breeding, king penguins fast voluntarily for up to 1.5 months in the colony, after which they replenish their energy stores at sea. However, at sea, birds might encounter periods of low foraging profitability, forcing them to draw from previously stored energy (e.g. subcutaneous fat). Accessing peripheral fat stores requires perfusion, increasing heat loss and thermoregulatory costs. Hence, how these birds balance the conflicting demands of nutritional needs and thermoregulation is unclear. We investigated the physiological responses of king penguins to fasting in cold water by: (1) monitoring tissue temperatures, as a proxy of tissue perfusion, at four distinct sites (deep and peripheral); and (2) recording their oxygen consumption rate while birds floated inside a water tank. Despite frequent oscillations, temperatures of all tissues often reached near-normothermic levels, indicating that birds maintained perfusion to peripheral tissues throughout their fasting period in water. The oxygen consumption rate of birds increased with fasting duration in water, while it was also higher when the flank tissue was warmer, indicating greater perfusion. Hence, fasting king penguins in water maintained peripheral perfusion, despite the associated greater heat loss and, therefore, thermoregulatory costs, probably to access subcutaneous fat stores. Hence, the observed normothermia in peripheral tissues of king penguins at sea, upon completion of a foraging bout, is likely explained by their nutritional needs: depositing free fatty acids (FFA) in subcutaneous tissues after profitable foraging or mobilizing FFA to fuel metabolism when foraging success was insufficient. © 2017. Published by The Company of Biologists Ltd.
Anogeissus sericea var. nummalaria King ex Duthie
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 4. Anogeissus sericea var. nummalaria King ex Duthie. Flowering Trees Volume 8 Issue 4 April 2003 pp 89-89. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/04/0089-0089. Resonance ...
Standardization of 125 Sb in equilibrium non-equilibrium situations with 125m Te
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Jimenez de Mingo, A.; Grau Carles, A.
1997-10-01
We study the stability of ''125 Sb in the following scintillators: HiSafeIII''TM, Insta- Gel reg s ign Plus and '' Ultima-Gold'' TM. Since ''125 m Te requires more than one year to reach the secular equilibrium with ''125 Sb, we cannot be sure, for a given sample, whether equilibrium is reached or not. In this report we present a new procedure that permits one calibrate mixtures of ''125 Sb+''125 m Te out of the equilibrium. The steps required for the radiochemical separation of the components are indicated. Finally, we study the evolution of counting rate when column yields are less than 100%. (Author)
Aljomaa, Suliman Saleh
2018-01-01
The study aimed at examining the relationship between body image satisfaction and bulimia nervosa among the students of education faculty at king said university students. The author used the tests of bulimia nervosa and body image test. The researcher verified tests reliability. Students from King Saud University randomly selected (No. 337)…
Lichen flora around the Korean Antarctic Scientific Station, King George Island, Antarctic.
Kim, Ji Hee; Ahn, In-Young; Hong, Soon Gyu; Andreev, Mikhail; Lim, Kwang-Mi; Oh, Mi Jin; Koh, Young Jin; Hur, Jae-Seoun
2006-10-01
As part of the long-term monitoring projects on Antarctic terrestrial vegetation in relation to global climate change, a lichen floristical survey was conducted around the Korean Antarctic Station (King Sejong Station), which is located on Barton Peninsula, King George Island, in January and February of 2006. Two hundred and twenty-five lichen specimens were collected and sixty-two lichen species in 38 genera were identified by morphological characteristics, chemical constituents, TLC analysis and ITS nucleotide sequence analysis.
Ornamental colors reveal age in the king penguin
Nicolaus, Marion; Le Bohec, Celine; Nolan, Paul M.; Gauthier-Clerc, Michel; Le Maho, Yvon; Komdeur, Jan; Jouventin, Pierre
2007-01-01
We investigated whether delayed plumage maturation occurred in king penguins (Aptenodytes patagonicus). Therefore we examined the relationships between age and sex on spectral properties and size of two colored plumage patches and a UV-reflective beak spot, using known-age cohorts. Unlike the
HIV intertest interval among MSM in King County, Washington.
Katz, David A; Dombrowski, Julia C; Swanson, Fred; Buskin, Susan E; Golden, Matthew R; Stekler, Joanne D
2013-02-01
The authors examined temporal trends and correlates of HIV testing frequency among men who have sex with men (MSM) in King County, Washington. The authors evaluated data from MSM testing for HIV at the Public Health-Seattle & King County (PHSKC) STD Clinic and Gay City Health Project (GCHP) and testing history data from MSM in PHSKC HIV surveillance. The intertest interval (ITI) was defined as the number of days between the last negative HIV test and the current testing visit or first positive test. Correlates of the log(10)-transformed ITI were determined using generalised estimating equations linear regression. Between 2003 and 2010, the median ITI among MSM seeking HIV testing at the STD Clinic and GCHP were 215 (IQR: 124-409) and 257 (IQR: 148-503) days, respectively. In multivariate analyses, younger age, having only male partners and reporting ≥10 male sex partners in the last year were associated with shorter ITIs at both testing sites (pGCHP attendees, having a regular healthcare provider, seeking a test as part of a regular schedule and inhaled nitrite use in the last year were also associated with shorter ITIs (pGCHP (median 359 vs 255 days, p=0.02). Although MSM in King County appear to be testing at frequent intervals, further efforts are needed to reduce the time that HIV-infected persons are unaware of their status.
Directory of Open Access Journals (Sweden)
Soliman MM
2017-03-01
Full Text Available Mona M Soliman,1,2 Kamran Sattar,2 Sami Alnassar,3 Faisal Alsaif,4 Khalid Alswat,5 Mohamed Alghonaim,6 Maysoon Alhaizan,7 Nawaf Al-furaih7 1Department of Physiology, 2Department of Medical Education, 3Department of Surgery, College of Medicine, King Saud University, 4Department of Surgery, King Saud University Medical City, 5Department of Internal Medicine, 6Department of Medicine, 7College of Medicine, King Saud University, Riyadh, Saudi Arabia Background: The students’ perception of the learning environment is an important aspect for evaluation and improvement of the educational program. The College of Medicine at King Saud University (KSU reformed its curriculum in 2009 from a traditional to a system-oriented hybrid curriculum.Objective: The objective of the present study was to determine the perception of the second batch (reformed curriculum of medical graduates about the educational environment at the College of Medicine, KSU, using the Dundee Ready Education Environment Measure (DREEM scale.Methods: The fifth year medical students were asked to evaluate the educational program after graduation in May 2014. The questionnaire was distributed to the graduate students electronically. The DREEM questionnaire consisted of 50 items based on Likert’s scale; and five domains, namely, students’ perceptions of learning, perceptions of teachers, academic self-perceptions, perceptions of atmosphere, and social self-perceptions. Data were analyzed using SPSS.Results: A total of 62 students participated in the study. The score for students’ perception of learning among medical students ranged from 2.93 to 3.64 (overall mean score: 40.17. The score for students’ perception of teachers ranged from 2.85 to 4.01 (overall mean score: 33.35. The score for students’ academic self-perceptions ranged from 3.15 to 4.06 (overall mean score: 28.4. The score for students’ perception of atmosphere ranged from 2.27 to 3.91 (overall mean score: 41.32. The
Fram, Miranda S.; Shelton, Jennifer L.
2018-01-08
Groundwater provides more than 40 percent of California’s drinking water. To protect this vital resource, the State of California created the Groundwater Ambient Monitoring and Assessment (GAMA) Program. The GAMA Program’s Priority Basin Project assesses the quality of groundwater resources used for drinking-water supply and increases public access to groundwater-quality information. Many households and small communities in the Madera– Chowchilla and Kings subbasins of the San Joaquin Valley rely on private domestic wells for their drinking-water supplies.
Biohistorical materials and contemporary privacy concerns-the forensic case of King Albert I.
Larmuseau, Maarten H D; Bekaert, Bram; Baumers, Maarten; Wenseleers, Tom; Deforce, Dieter; Borry, Pascal; Decorte, Ronny
2016-09-01
The rapid advancement of technology in genomic analysis increasingly allows researchers to study human biohistorical materials. Nevertheless, little attention has been paid to the privacy of the donor's living relatives and the negative impact they might experience from the (public) availability of genetic results, even in cases of scientific, forensic or historical relevance. This issue has become clear during a cold case investigation of a relic attributed to Belgian King and World War I-hero Albert I who died, according to the official version, in a solo climbing accident in 1934. Authentication of the relic with blood stains assigned to the King and collected on the place where his body was discovered is recognised as one of the final opportunities to test the plausibility of various conspiracy theories on the King's demise. While the historical value and current technological developments allow the genomic analysis of this relic, publication of genetic data would immediately lead to privacy concerns for living descendants and relatives of the King, including the Belgian and British royal families, even after more than 80 years. Therefore, the authentication study of the relic of King Albert I has been a difficult exercise towards balancing public research interests and privacy interests. The identification of the relic was realised by using a strict genetic genealogical approach including Y-chromosome and mitochondrial genome comparison with living relatives, thereby limiting the analysis to genomic regions relevant for identification. The genetic results combined with all available historical elements concerning the relic, provide strong evidence that King Albert I was indeed the donor of the blood stains, which is in line with the official climbing accident hypothesis and contradicts widespread 'mise-en-scène' scenarios. Since publication of the haploid data of the blood stains has the potential to violate the privacy of living relatives, we opted for
DEFF Research Database (Denmark)
Dissing, J.; Binladen, J.; Hansen, Anders J.
2007-01-01
of King Sven Estridsen to haplogroup H; Estrid's sequence differed from that of Sven at two positions in HVR-1, 16093T -> C and 16304T -> C, indicating that she belongs to subgroup H5a. Given the maternal inheritance of mtDNA, offspring will have the same mtDNA sequence as their mother with the exception......, there have been doubts among historians whether the woman entombed was indeed Estrid. To shed light on this problem, we have extracted and analysed mitochondrial DNA (mtDNA) from pulp of teeth from each of the two royals. Four overlapping DNA-fragments covering about 400 bp of hypervariable region 1 (HVR-1...
King penguin population threatened by Southern Ocean warming.
Le Bohec, Céline; Durant, Joël M; Gauthier-Clerc, Michel; Stenseth, Nils C; Park, Young-Hyang; Pradel, Roger; Grémillet, David; Gendner, Jean-Paul; Le Maho, Yvon
2008-02-19
Seabirds are sensitive indicators of changes in marine ecosystems and might integrate and/or amplify the effects of climate forcing on lower levels in food chains. Current knowledge on the impact of climate changes on penguins is primarily based on Antarctic birds identified by using flipper bands. Although flipper bands have helped to answer many questions about penguin biology, they were shown in some penguin species to have a detrimental effect. Here, we present for a Subantarctic species, king penguin (Aptenodytes patagonicus), reliable results on the effect of climate on survival and breeding based on unbanded birds but instead marked by subcutaneous electronic tags. We show that warm events negatively affect both breeding success and adult survival of this seabird. However, the observed effect is complex because it affects penguins at several spatio/temporal levels. Breeding reveals an immediate response to forcing during warm phases of El Niño Southern Oscillation affecting food availability close to the colony. Conversely, adult survival decreases with a remote sea-surface temperature forcing (i.e., a 2-year lag warming taking place at the northern boundary of pack ice, their winter foraging place). We suggest that this time lag may be explained by the delay between the recruitment and abundance of their prey, adjusted to the particular 1-year breeding cycle of the king penguin. The derived population dynamic model suggests a 9% decline in adult survival for a 0.26 degrees C warming. Our findings suggest that king penguin populations are at heavy extinction risk under the current global warming predictions.
Tribute to Julie Taymor's Lion King Costumes
Carter, Mary C.; Beaty, Ben
2011-01-01
Julie Taymor's costumes and masks for the stage version of "The Lion King" were stunning in the way they combined the dual images of human and animal forms. Taymor visually incorporated the human form of a dancer into the simplified form of the animal character so both are equally visible. This visible duality of human form and animal…
Whatsapp for Educational Purposes for Female Students at College of Education--King Saud University
Aljaad, Nawal Hamad Mohmad
2017-01-01
This research aims at finding out the educational usages of "Whatsapp" by the Saudi female students who are involved in the College of Education at King Saud University. To achieve the goal of this study, the researcher uses a simple sample of (122) female students from the Education College of King Saud University, which is chosen…
King eider foraging effort during the pre-breeding period in Alaska
Oppel, Steffen; Powell, Abby N.; Butler, Malcolm G.
2011-01-01
For reproduction, many arctic-nesting migratory birds rely on nutrients obtained on the breeding grounds, so they devote sufficient time to foraging immediately prior to nesting. However, little is known about the increase in foraging effort necessary to meet the energetic requirements of reproduction. In early June 2006 and 2008, we quantified the proportion of time spent foraging before breeding by a large sea duck, the King Eider (Somateria spectabilis), on its breeding grounds in northern Alaska. During >235 hours of behavioral observations, both male and female King Eiders spent >50% of the day loafing (resting, sleeping, comfort behavior, or being alert). Females foraged on average 30% of the time (mean 7.2 hr day-1,95% CI 6.0-8.4 hr day-1), three times as much as males (9%; 2.3 hr day-1, 95% CI 1.5–2.8 hr day-1). The most common prey in ponds where the eiders foraged were chironomid larvae and worms ranging in length from 1 to 30 mm. If the King Eider's daily energy expenditure on its breeding grounds is similar to values published for related species, it would need to ingest only 0.2–0.6 g dry mass of invertebrates per minute of foraging to meet its energetic requirements. Males did not lose body mass before breeding, and we assume that their foraging effort was sufficient for energy balance. Therefore, female King Eiders appear to triple their foraging effort over maintenance requirements to meet the energetic challenges of egg formation.
Directory of Open Access Journals (Sweden)
Hosseinpour-Feizi H
2011-12-01
Full Text Available Hojjat Hosseinpour-Feizi, Jafar Soleimanpour, Jafar Ganjpour Sales, Ali ArzroumchilarDepartment of Orthopedics, Shohada Hospital, Faculty of Medicine, Tabriz University of Medical Sciences, Tabriz, IranPurpose: The aim of this study was to investigate the interobserver agreement of the Lenke and King classifications for adolescent idiopathic scoliosis, and to compare the results of surgery performed based on classification of the scoliosis according to each of these classification systems.Methods: The study was conducted in Shohada Hospital in Tabriz, Iran, between 2009 and 2010. First, a reliability assessment was undertaken to assess interobserver agreement of the Lenke and King classifications for adolescent idiopathic scoliosis. Second, postoperative efficacy and safety of surgery performed based on the Lenke and King classifications were compared. Kappa coefficients of agreement were calculated to assess the agreement. Outcomes were compared using bivariate tests and repeated measures analysis of variance.Results: A low to moderate interobserver agreement was observed for the King classification; the Lenke classification yielded mostly high agreement coefficients. The outcome of surgery was not found to be substantially different between the two systems.Conclusion: Based on the results, the Lenke classification method seems advantageous. This takes into consideration the Lenke classification’s priority in providing details of curvatures in different anatomical surfaces to explain precise intensity of scoliosis, that it has higher interobserver agreement scores, and also that it leads to noninferior postoperative results compared with the King classification method.Keywords: test reliability, scoliosis classification, postoperative efficacy, adolescents
International Nuclear Information System (INIS)
Blight, L.F.; White, G.H.
1983-01-01
We have evaluated two commercially available 125 I radioimmunoassay kits (Diagnostic Products Corp., DPC; and Radioassay Systems Laboratories, RSL) for measurement of serum or plasma progesterone, to determine their suitability for use in in vitro fertilization programs. Both kits were suitably rapid for program requirements. Results by both were linear with concentration up to 60 nmol/L, and both had acceptable lower detection limits of 0.3 nmol/L. Kit-determined progesterone concentrations (y) for 100 patients' samples correlated well with results by our existing 3H radioimmunoassay method (y . 1.11x + 0.2, r . 0.965 for the DPC kit; y . 1.01x + 1.4, r . 0.974 for the RSL kit). Mean analytical recovery for the RSL kit was 116%, that for the DPC kit, 202%. Within-batch precision, expressed as the mean CV for three concentrations of progesterone, was 6.5% for the RSL kit, and 16.4% for the DPC kit; between-day CV was 8.1% for the RSL kit, 17.7% for the DPC kit. We conclude that the RSL kit provides a rapid, precise, and accurate assay for serum progesterone, suitable for use in a fertilization program, but do not recommend the DPC kit for either this purpose or the more general purpose of tracking menstrual cycles
Effects of FTY720 on Lung Injury Induced by Hindlimb Ischemia Reperfusion in Rats
Directory of Open Access Journals (Sweden)
Liangrong Wang
2017-01-01
Full Text Available Background. Sphingosine-1-phosphate (S1P is a biologically active lysophospholipid mediator involved in modulating inflammatory process. We investigated the effects of FTY720, a structural analogue of S1P after phosphorylation, on lung injury induced by hindlimb ischemia reperfusion (IR in rats. Methods. Fifty Sprague-Dawley rats were divided into groups SM, IR, F3, F5, and F10. Group SM received sham operation, and bilateral hindlimb IR was established in group IR. The rats in groups F3, F5, and F10 were pretreated with 3, 5, and 10 mg/kg/d FTY720 for 7 days before IR. S1P lyase (S1PL, sphingosine kinase (SphK 1, and SphK2 mRNA expressions, wet/dry weight (W/D, and polymorphonuclear/alveolus (P/A in lung tissues were detected, and the lung injury score was evaluated. Results. W/D, P/A, and mRNA expressions of S1PL, SphK1, and SphK2 were higher in group IR than in group SM, while these were decreased in both groups F5 and F10 as compared to IR (p<0.05. The lung tissue presented severe lesions in group IR, which were attenuated in groups F5 and F10 with lower lung injury scores than in group IR (p<0.05. Conclusions. FTY720 pretreatment could attenuate lung injury induced by hindlimb IR by modulating S1P metabolism and decreasing pulmonary neutrophil infiltration.
Barquete, Viviane; Bugoni, Leandro; Silva-Filho, Rodolfo P.; Adornes, Andréa C.
2006-01-01
A review of previous findings and new records of King Penguin (Aptenodytes patagonicus) and Rockhopper Penguin (Eudyptes chrysocome) on the Brazilian coast is presented. In total there are six records of the King Penguin and ten records of the Rockhopper Penguin. Juvenile and adults of both species were found stranded mostly on Rio Grande do Sul coast, southern Brazil. Records of King Penguins are restricted to the summer season, while records of Rockhopper Penguins are mostly during winter. ...
Connect the Book. Martin's Big Words: The Life of Dr. Martin Luther King, Jr.
Brodie, Carolyn S.
2005-01-01
In honor of Martin Luther King, Jr. Day, this month's featured book is "Martin's Big Words: The Life of Dr. Martin Luther King, Jr." The book was written by Doreen Rappaport and illustrated by Bryan Collier (Jump at the Sun, 2001. 40p. ISBN 0786807148). This pictorial biography of the world-renowned civil rights leader has one of the most striking…
Were king Stefan the First-Crowned and his son Radoslav co-rulers?
Directory of Open Access Journals (Sweden)
Bubalo Đorđe
2009-01-01
Full Text Available The Serbian historiography considers the issue of the co-ruling of King Stefan the First-Crowned and his son Radoslav as the one finally resolved. The suggested solution on the co-rule of Stefan and Radoslav may be most succinctly expressed as following: as early as in the year of 1220, due to the frail health of Stefan the First-Crowned and Radoslav's marriage to Anne the Epirus princess, Radoslav was crowned to be the king and positioned to co-rule with his father after the Byzantine model of governing. Nevertheless this point of view has some loose ends. The notion of co-ruling and the very term of 'co-ruler' are quite freely used in the scholarly works. A general consensus on the precise meaning has not been reached yet. At the point where one author perceives a co-rule, the other categorically denies it. Basically the approach equalizing the heir to the throne and the co-ruler is wrong. Although the co-rulers in most cases were the throne heirs, they cannot be called the co-rulers because of the right to inherit the throne, but for the ruling attributes that formally established that right. The conviction of the co-rule of King Stefan and his son Radoslav is founded on the interpretation of the facts coming from the following sources: entitling charters for the monastery of Žiča, produced by Stefan and Radoslav around 1220; some segments from St. Sava's biographies by Domentian and Theodosius describing the circumstances of Stefan's death-bed leaving the throne to Radoslav; the three acts of the town of Kotor from 1221 and 1227 dated by the rule of king Radoslav, the portraits of Stefan and Radoslav next to the entrance to the Church of the Ascension in the monastery of Žiča and in the nartex of the Mileševa monastery church. In the first Žiča charter, Stefan calls Radoslav his heir, while in the second Žiča charter Stefan points out Radoslav as his first-born son blessed by him to be the king of the whole state. (jegože i
Metabolism in the isolated rat heart: comparison of 125I-BMIPP with 125I-IPPA
International Nuclear Information System (INIS)
Chen Shaoliang; Cheng Aiping; Xu Lanwen; Qiao Weiwei
2008-01-01
Objective: The fatty acid metabolism in myocardium is recently one of the most interesting subjects in nuclear cardiology. The purpose of this study was to clarify the metabolic fate of 125 I-labeled 15-(p-iodophenyl)-3-(R, S)-methyl-pentadecanoic acid ( 125 I-BMIPP) and 15-(p-[ 125 I] iodophenyl) pentadecanoic acid ( 125 I-IPPA) by means of isolated rat hearts. Methods: Ten isolated rat hearts were prepared and perfused with 125 I-BMIPP (5 rats) or 125 I-IPPA (5 rats) for 3 h following a basic perfusion of 30 min. After perfusion, the radioactivity in the recirculated buffer was measured. The metabolites in the buffer were then extracted and analyzed using high performance liquid chromatography (HPLC) and thin-layer chromatography (TLC). Results: At the beginning (5 rain) of 125 I-BMIPP perfusion, the main radioactive peak appeared on HPLC at 37 min, which remained after 3 h perfusion. Several small peaks eluting were found before the parent peak at 30, 26, 21, 16, 12 and 9 min, respectively. At the beginning (5 min) of 125 I-IPPA perfusion, the main peak appeared on HPLC at 33 min, which disappeared after 3 h. Conclusions: 125 I-BMIPP strongly inhibited beta-oxidation, therefore appeared suitable for myocardial metabolic imaging. 125 I-IPPA was metabolized rapidly. (authors)
Outliers and Extremes: Dragon-Kings or Dragon-Fools?
Schertzer, D. J.; Tchiguirinskaia, I.; Lovejoy, S.
2012-12-01
Geophysics seems full of monsters like Victor Hugo's Court of Miracles and monstrous extremes have been statistically considered as outliers with respect to more normal events. However, a characteristic magnitude separating abnormal events from normal ones would be at odd with the generic scaling behaviour of nonlinear systems, contrary to "fat tailed" probability distributions and self-organized criticality. More precisely, it can be shown [1] how the apparent monsters could be mere manifestations of a singular measure mishandled as a regular measure. Monstrous fluctuations are the rule, not outliers and they are more frequent than usually thought up to the point that (theoretical) statistical moments can easily be infinite. The empirical estimates of the latter are erratic and diverge with sample size. The corresponding physics is that intense small scale events cannot be smoothed out by upscaling. However, based on a few examples, it has also been argued [2] that one should consider "genuine" outliers of fat tailed distributions so monstrous that they can be called "dragon-kings". We critically analyse these arguments, e.g. finite sample size and statistical estimates of the largest events, multifractal phase transition vs. more classical phase transition. We emphasize the fact that dragon-kings are not needed in order that the largest events become predictable. This is rather reminiscent of the Feast of Fools picturesquely described by Victor Hugo. [1] D. Schertzer, I. Tchiguirinskaia, S. Lovejoy et P. Hubert (2010): No monsters, no miracles: in nonlinear sciences hydrology is not an outlier! Hydrological Sciences Journal, 55 (6) 965 - 979. [2] D. Sornette (2009): Dragon-Kings, Black Swans and the Prediction of Crises. International Journal of Terraspace Science and Engineering 1(3), 1-17.
Gabb, Timothy P.; Telesman, Jack; Kantzos, Peter T.; Sweeney, Joseph W.; Browning, Paul F.
2002-01-01
The purpose of this study was to examine the effects of extended exposures on the near-surface fatigue resistance of a disk superalloy. Powder metallurgy processed, supersolvus heat-treated Udimet 720 (U720) fatigue specimens were exposed in air at temperatures from 650 to 705 C for 100 hr to over 1000 hr. They were then tested using conventional fatigue tests at 650 C to determine the effects of exposure on fatigue resistance. The exposures reduced life by up to 70% and increased the scatter in life, compared to unexposed levels. Fractographic evaluations indicated the failure mode was shifted by the exposures from internal to surface crack initiations. The increased scatter in life was related to the competition between internal crack initiations at inclusions or large grains producing longer lives, and surface crack initiations at an environmentally affected surface layer producing shorter lives.
Overvåking av jordboende sopp i Røsskleiva NR, Bamble 2016
Brandrud, Tor Erik; Dima, Bàlint
2017-01-01
Brandrud, T.E. & Dima, B. 2017. Overvåking av jordboende sopp i Røsskleiva NR, Bamble 2016. – NINA Kortrapport 80. 15 s. Kartlegging (start av overvåking) av habitat-spesifikke, jordboende kalksopper i nordre del av Røsskleiva NR ble gjennomført i 2016, før oppstart av skjøtselstiltak med storfébeiting. Tilsammen 27 habitat-spesifikke arter, inkludert 18 rødlistede arter ble registrert i løpet av to registreringsrunder i 2016. Funnene fordelte seg på 10 kalkbarskogsopper, 5 kalklinde-skogs...
2012-09-17
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines. The existing AD currently... TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but not limited to...
Fish for peasants and kings - a Danish perspective
DEFF Research Database (Denmark)
Kristiansen, Mette Svart
2011-01-01
Fish played an important role in medieval Europe. It formed the basis of a food culture influenced by Catholicism and was a central commodity in the national and international network of trade. Fish of all sorts held a prominent position on the dining tables of peasants as well as kings. Househol...
Anogeissus sericea var. nummalaria King ex Duthie (Combretaceae ...
Indian Academy of Sciences (India)
Anogeissus sericea var. nummalaria King ex Duthie (Combretaceae) is moderate sized multipurpose hard wood tree of dry deciduous forests with drooping branches and yellow to brownish-yellow flowers. it is endemic to Rajasthan and is considered to be a threatened tree of the region due to over exploitation for timber ...
Brian B. Boroski; Richard T. Golightly; Amie K. Mazzoni; Kimberly A. Sager
2002-01-01
The Kings River Sustainable Forest Ecosystems Project was initiated on the Kings River Ranger District of the Sierra National Forest, California, in 1993, with fieldwork beginning in 1994. Knowledge of the ecology of the fisher (Martes pennanti) in the Project area, and in the Sierra Nevada of California in general, is insufficient to develop...
The King James Bible and the Politics of Religious Education: Secular State and Sacred Scripture
Gearon, Liam
2013-01-01
This article provides an outline historical-educational analysis of the King James Bible from its 1611 publication through to its four-hundredth anniversary commemoration in 2011. With particular focus on England, the article traces the educational impact of the King James Bible and charts, in the country of its origin, its progressive decline in…
Directory of Open Access Journals (Sweden)
CS Phua
2012-01-01
Full Text Available Some constituents of snake venom have been found to display a variety of biological activities. The antibacterial property of snake venom, in particular, has gathered increasing scientific interest due to antibiotic resistance. In the present study, king cobra venom was screened against three strains of Staphylococcus aureus [including methicillin-resistant Staphylococcus aureus (MRSA], three other species of gram-positive bacteria and six gram-negative bacteria. King cobra venom was active against all the 12 bacteria tested, and was most effective against Staphylococcus spp. (S. aureus and S. epidermidis. Subsequently, an antibacterial protein from king cobra venom was purified by gel filtration, anion exchange and heparin chromatography. Mass spectrometry analysis confirmed that the protein was king cobra L-amino acid oxidase (Oh-LAAO. SDS-PAGE showed that the protein has an estimated molecular weight of 68 kDa and 70 kDa under reducing and non-reducing conditions, respectively. The minimum inhibitory concentrations (MIC of Oh-LAAO for all the 12 bacteria were obtained using radial diffusion assay method. Oh-LAAO had the lowest MIC value of 7.5 µg/mL against S. aureus ATCC 25923 and ATCC 29213, MRSA ATCC 43300, and S. epidermidis ATCC 12228. Therefore, the LAAO enzyme from king cobra venom may be useful as an antimicrobial agent.
El-Quliti, Said Ali Hassan; Radwan, Neyara
2016-01-01
Faculty of Engineering at King Abdulaziz University plans to redesign its undergraduate courses, which is required for students in 14 different programs. These courses have an annual enrolment of about 2,500 students each year. The Operations Research Teaching Area in the Department of Industrial Engineering will be presented as a case study. This area involves two core and three elective courses.The course redesign involves preparing students for the Fundamentals of Engineering (FE) Exam req...
Interactions between surface waters in King George Island, Antarctica - a stable isotope perspective
Perşoiu, Aurel; Bădăluşă, Carmen
2017-04-01
In this paper we present a first study of the isotopic composition of surface waters in the southern peninsulas (Barton, Fildes, Weaver and Potter) of King George Island, Antarctica. We have collected > 200 samples of snow and snowmelt, water (lake, river and spring), ice (glacier ice and permafrost) from the four peninsulas in February 2016 and analyzed them for their oxygen and hydrogen stable isotopic composition. Samples from lake water (50+) indicate a clear west-east depletion trend, suggesting a rain-out process as air masses are moving westward (and are progressively depleted in heavy isotopes) from their origin in the Drake Passage. In both Fildes and Barton Peninsulas, permafrost samples have the heaviest isotopic composition, most probably due to preferential incorporation of heavy isotopes in the ice during freezing (and no fractionation during melting). As permafrost melts, the resulting water mixes with isotopically lighter infiltrated snowmelt, and thus the groundwater has a lower isotopic composition. Further, lake and river (the later fed by lakes) water has the lightest isotopic composition, being derived mostly from the melting of light snow and glacier ice. It seems feasible to separate isotopically water in lakes/rivers (largely fed by melting multi-year glaciers and snow) and water from melting of snow/ground ice This preliminary study suggests that it is possible to separate various water sources in the southern peninsulas of King George Island, and this separation could be used to study permafrost degradation, as well as feeding and migration patterns in the bird fauna, with implications for protection purposes. Acknowledgments. The National Institute of Research and Development for Biological Sciences (Bucharest, Romania) and the Korean polar institute financially supported fieldwork in King George Island. We thank the personal at King Sejong (South Korea), Belingshaussen (Russia) and Carlini (Argentina) stations in King George Island for
78 FR 59414 - Environmental Impact Statement; King County, Washington
2013-09-26
... DEPARTMENT OF TRANSPORTATION Federal Highway Administration Environmental Impact Statement; King... prepare an environmental impact statement. SUMMARY: The Federal Highway Administration is issuing this notice to advise the public that an Environmental Impact Statement (EIS) will be prepared for a proposed...
Numerical simulation of explosive magnetic cumulative generator EMG-720
Energy Technology Data Exchange (ETDEWEB)
Deryugin, Yu N; Zelenskij, D K; Kazakova, I F; Kargin, V I; Mironychev, P V; Pikar, A S; Popkov, N F; Ryaslov, E A; Ryzhatskova, E G [All-Russian Research Inst. of Experimental Physics, Sarov (Russian Federation)
1997-12-31
The paper discusses the methods and results of numerical simulations used in the development of a helical-coaxial explosive magnetic cumulative generator (EMG) with the stator up to 720 mm in diameter. In the process of designing, separate units were numerically modeled, as was the generator operation with a constant inductive-ohmic load. The 2-D processes of the armature acceleration by the explosion products were modeled as well as those of the formation of the sliding high-current contact between the armature and stator`s insulated turns. The problem of the armature integrity in the region of the detonation waves collision was numerically analyzed. 8 figs., 2 refs.
Vidal-Martínez, Guadalupe; Vargas-Medrano, Javier; Gil-Tommee, Carolina; Medina, David; Garza, Nathan T; Yang, Barbara; Segura-Ulate, Ismael; Dominguez, Samantha J; Perez, Ruth G
2016-09-23
Patients with Parkinson's disease (PD) often have aggregated α-synuclein (aSyn) in enteric nervous system (ENS) neurons, which may be associated with the development of constipation. This occurs well before the onset of classic PD motor symptoms. We previously found that aging A53T transgenic (Tg) mice closely model PD-like ENS aSyn pathology, making them appropriate for testing potential PD therapies. Here we show that Tg mice overexpressing mutant human aSyn develop ENS pathology by 4 months. We then evaluated the responses of Tg mice and their WT littermates to the Food and Drug Administration-approved drug FTY720 (fingolimod, Gilenya) or vehicle control solution from 5 months of age. Long term oral FTY720 in Tg mice reduced ENS aSyn aggregation and constipation, enhanced gut motility, and increased levels of brain-derived neurotrophic factor (BDNF) but produced no significant change in WT littermates. A role for BDNF was directly assessed in a cohort of young A53T mice given vehicle, FTY720, the Trk-B receptor inhibitor ANA-12, or FTY720 + ANA-12 from 1 to 4 months of age. ANA-12-treated Tg mice developed more gut aSyn aggregation as well as constipation, whereas FTY720-treated Tg mice had reduced aSyn aggregation and less constipation, occurring in part by increasing both pro-BDNF and mature BDNF levels. The data from young and old Tg mice revealed FTY720-associated neuroprotection and reduced aSyn pathology, suggesting that FTY720 may also benefit PD patients and others with synucleinopathy. Another finding was a loss of tyrosine hydroxylase immunoreactivity in gut neurons with aggregated aSyn, comparable with our prior findings in the CNS. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Falandysz, J; Kunito, T; Kubota, R; Bielawski, L; Frankowska, A; Falandysz, Justyna J; Tanabe, S
2008-12-01
Based on ICP-MS, ICP-OES, HG-AAS, CV-AAS and elementary instrumental analysis of King Bolete collected from four sites of different soil bedrock geochemistry considered could be as mushroom abundant in certain elements. King's Bolete fruiting bodies are very rich in K (> 20 mg/g dry weight), rich in Ca, Mg, Na, Rb and Zn (> 100 microg/g dw), and relatively also rich in Ag, Cd, Cs, Cu, Fe, Mn and Se (> 10 microg/g dw). The caps of King Bolete when compared to stipes around two-to three-fold more abundant are in Ag, Cd, Cs, Cu, Hg, K, Mg, Mo, N, Rb, Se and Zn. King Bolete collected at the lowland and mountain sites showed Ag, Ba, Co, Cr, Hg, K, Mg, Mn, Mo and Na in caps in comparable concentrations, and specimens from the mountain areas accumulated more Cd and Sb. Elements such as Al, Pb and Rb occurred at relatively elevated concentration in King Bolete picked up at the metal ores-rich region of the Sudety Mountains. Because of high bioconcentration potential King Bolete at the background sites accumulate in fruiting bodies great concentrations of problematic elements such as Cd, Pb and Hg, i.e. up to nearly 20, 3 and 5 microg/g dw, on the average, respectively. The interdependence among determined mineral elements examined were using the principal components analysis (PCA) method. The PCA explained 56% of the total variance. The metals tend to cluster together (Ba, Cd, Cs, Cr, Ga, Rb, Se, Sr and V; K and Mg; Cu and Mo). The results provided useful environmental and nutritional background level information on 26 minerals as the composition of King Bolete from the sites of different bedrock soil geochemistry.
Burger, J; Boarman, W; Kurzava, L; Gochfeld, M
1991-01-01
The abilities of hatchling pine snakes (Pituophis melanoleucus) and king snakes (Lampropeltis getulus) to discriminate the chemical trails of pine and king snakes was investigated inY-maze experiments. Pine snakes were housed for 17 days either with shavings impregnated with pine snake odor, king snake odor, or no odor to test for the effect of experience on choice. Both pine and king snake hatchlings entered the arm with the pine snake odor and did not enter the arm with the king snake odor. The data support the hypothesis that hatchlings of both species can distinguish conspecific odors from other odors and that our manipulation of previous experience was without effect for pine snake hatchlings.
Beat characteristics and beat maps of the King Seong-deok Divine Bell
Kim, Seock-Hyun; Lee, Chi-Wook; Lee, Jang-Moo
2005-03-01
King Seong-deok Divine Bell is the second oldest bell in Korea. The bell is considered to have the best sound quality among Korean bells. The beat phenomenon is one of the most important characteristics for the sound of the King Seong-deok Divine Bell. In this study, the relationships between the modal parameters and the peculiar beat phenomena of the bell are investigated. It is theoretically proved from the beat characteristics that the sound might indeed be heard differently depending on the listening positions. The beat map method is introduced to visualize the beat distribution properties. It is shown that the beat maps can be drawn with a theoretical model based on the modal data of the bell. Using the beat maps of the King Seong-deok Divine Bell, it is investigated why clear and unclear beats, large and small amplitudes of the vibrations are repeated periodically along the circumference of the bell. Furthermore, the effect of the striking position on the beat distribution property is examined systematically.
Ontogeny of thermoregulatory mechanisms in king penguin chicks (Aptenodytes patagonicus).
Duchamp, Claude; Rouanet, Jean Louis; Barré, Hervé
2002-04-01
The rapid maturation of thermoregulatory mechanisms may be of critical importance for optimising chick growth and survival and parental energy investment under harsh climatic conditions. The ontogeny of thermoregulatory mechanisms was studied in growing king penguin chicks from hatching to the full emancipation observed at 1 month of age in the sub-Antarctic area (Crozet Archipelago). Newly hatched chicks showed small, but significant regulatory thermogenesis (21% rise in heat production assessed by indirect calorimetry), but rapidly became hypothermic. Within a few days, both resting (+32%) and peak (+52%) metabolic rates increased. The first week of life was characterised by a two-fold rise in thermogenic capacity in the cold, while thermal insulation was not improved. During the second and third weeks of age, thermal insulation markedly rose (two-fold drop in thermal conductance) in relation to down growth, while resting heat production was slightly reduced (-13%). Shivering (assessed by electromyography) was visible right after hatching, although its efficiency was limited. Thermogenic efficiency of shivering increased five-fold with age during the first weeks of life, but there was no sign of non-shivering thermogenesis. We conclude that thermal emancipation of king penguin chicks may be primarily determined by improvement of thermal insulation after thermogenic processes have become sufficiently matured. Both insulative and metabolic adaptations are required for the rapid ontogeny of thermoregulation and thermal emancipation in growing king penguin chicks.
78 FR 7387 - Continuation of Farm Service Agency 2008 Farm Bill Programs
2013-02-01
..., if effective prices are greater than specified target prices during the 2013 marketing year, there... the USDA Target Center at (202) 720-2600 (voice and TDD). SUPPLEMENTARY INFORMATION: ATRA (Pub. L. 112... Program (DPPSP), Dairy Indemnity Payment Program (DIPP), Marketing Assistance Loans (MAL), Loan Deficiency...
Directory of Open Access Journals (Sweden)
Maseko, L.
2016-02-01
Full Text Available Owing to the complexity and general lack of understanding of information technology (“IT”, the management of IT is often treated as a separately managed value-providing asset. This has resulted in IT rarely receiving the necessary attention of the board, thus creating a disconnect between the board and IT. The King Code of Governance for South Africa 2009 (hereafter referred to as “King III” provides principles and recommended practices for effective IT governance in order to create a greater awareness at board level. King III, however, provides no detailed guidance with regard to the practical implementation of these principles and practices. It is worth noting that numerous international guidelines are recommended within King III that can be adopted as frameworks to assist in the effective implementation of IT governance. COBIT 5 provides, as part of its governance process practices, related guidance activities linking it to the seven IT governance principles of King III, thus making it a practical framework for the implementation of King III recommendations. This study sought to establish the extent to which the governance processes, practices and activities of COBIT 5 are mapped to the recommended practices of IT governance as highlighted in King III in order to resolve COBIT 5 as the de facto framework for IT governance in terms of King III. The study found that though King III principles and practices may be interpreted as vague with regard to how to implement IT governance principles, COBIT 5 succeeds in bridging the gap between control requirements, technical issues, information systems and business risk, which consequently results in a better facilitation of IT governance. The study also revealed that COBIT 5 contains additional activities to assist the board in more transparent reporting of IT performance and conformance management to stakeholders as well activities which enable the connection of resource management with human
2010-11-23
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but..., Operation & Maintenance Manual OM- 01-02, Issue 3, Revision 13. (ii) For TAE 125-02-99 and TAE 125-02-114...
The preparation of 125I - gastrin I and 125 - minigastrin for medical diagnostics
International Nuclear Information System (INIS)
Byszewska-Szpocinska, E.; Markiewicz, A.
2002-01-01
Gastrin I G-17 and minigastrin G-13 were iodinated using direct methods with chloramin T and iodogen procedures and by indirect method with Bolton-Hunter reagent. 125 I - gastrin and 1 25 I - minigastrin were isolated from the iodination mixtures by gel filtration on Sephadex G-10 and Sephadex G-25 (PD-10 column) and by HPLC system (Lichrospher WP-300-RP-18 column). Radiochemical purity was shown by HPLC also. It was confirmed that iodogen procedure is the best for iodination of these peptides. 125 I - gastrin I obtained by this method with specific activity 80 μCi/nmol was homogeneous but iodination to higher specific activity (440μCi/nmol) caused appearance of two subfractions. 125 I - minigastrin with high and low specific activity were isolated by HPLC as the two forms (subfractions). It was shown that high performance liquid chromatography (HPLC) was the best method for isolation and purification of 125 I - gastrin I and 125 I - minigastrin. (author)
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.125 Section 284.125 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Transportation by Intrastate Pipelines § 284.125 [Reserved] ...
The origins of dragon-kings and their occurrence in society
Malkov, Artemy; Zinkina, Julia; Korotayev, Andrey
2012-11-01
A society is a medium with a complex structure of one-to-one relations between people. Those could be relations between friends, wife-husband relationships, relations between business partners, and so on. At a certain level of analysis, a society can be regarded as a gigantic maze constituted of one-to-one relationships between people. From a physical standpoint it can be considered as a highly porous medium. Such media are widely known for their outstanding properties and effects like self-organized criticality, percolation, power-law distribution of network cluster sizes, etc. In these media supercritical events, referred to as dragon-kings, may occur in two cases: when increasing stress is applied to a system (self-organized criticality scenario) or when increasing conductivity of a system is observed (percolation scenario). In social applications the first scenario is typical for negative effects: crises, wars, revolutions, financial breakdowns, state collapses, etc. The second scenario is more typical for positive effects like emergence of cities, growth of firms, population blow-ups, economic miracles, technology diffusion, social network formation, etc. If both conditions (increasing stress and increasing conductivity) are observed together, then absolutely miraculous dragon-king effects can occur that involve most human society. Historical examples of this effect are the emergence of the Mongol Empire, world religions, World War II, and the explosive proliferation of global internet services. This article describes these two scenarios in detail beginning with an overview of historical dragon-king events and phenomena starting from the early human history till the last decades and concluding with an analysis of their possible near future consequences on our global society. Thus we demonstrate that in social systems dragon-king is not a random outlier unexplainable by power-law statistics, but a natural effect. It is a very large cluster in a porous
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1220.125 Section 1220.125 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.125 Research. The term...
Mauger, G. S.; Lorente-Plazas, R.; Salathe, E. P., Jr.; Mitchell, T. P.; Simmonds, J.; Lee, S. Y.; Hegewisch, K.; Warner, M.; Won, J.
2017-12-01
King County has experienced 12 federally declared flood disasters since 1990, and tens of thousands of county residents commute through, live, and work in floodplains. In addition to flooding, stormwater is a critical management challenge, exacerbated by aging infrastructure, combined sewer and drainage systems, and continued development. Even absent the effects of climate change these are challenging management issues. Recent studies clearly point to an increase in precipitation extremes for the Pacific Northwest (e.g., Warner et al. 2015). Yet very little information is available on the magnitude and spatial distribution of this change. Others clearly show that local-scale changes in extreme precipitation can only be accurately quantified with dynamical downscaling, i.e.: using a regional climate model. This talk will describe a suite of research and adaptation efforts developed in a close collaboration between King County and the UW Climate Impacts Group. Building on past collaborations, research efforts were defined in collaboration with King County managers, addressing three key science questions: (1) How are the mesoscale variations in extreme precipitation modulated by changes in large-scale weather conditions? (2) How will precipitation extremes change? This was assessed via two new high-resolution regional model projections using the Weather Research and Forecasting (WRF) mesoscale model (Skamarock et al. 2005). (3) What are the implications for stormwater and flooding in King County? This was assessed by both exploring the statistics of hourly precipitation extremes in the new projections, as well as new hydrologic modeling to assess the implications for river flooding. The talk will present results from these efforts, review the implications for King County planning and infrastructure, and synthesize lessons learned and opportunities for additional work.
Structural organisation and dynamics in king penguin colonies
Gerum, Richard; Richter, Sebastian; Fabry, Ben; Le Bohec, Céline; Bonadonna, Francesco; Nesterova, Anna; Zitterbart, Daniel P.
2018-04-01
During breeding, king penguins do not build nests, however they show strong territorial behaviour and keep a pecking distance to neighbouring penguins. Penguin positions in breeding colonies are highly stable over weeks and appear regularly spaced, but thus far no quantitative analysis of the structural order inside a colony has been performed. In this study, we use the radial distribution function to analyse the spatial coordinates of penguin positions. Coordinates are obtained from aerial images of two colonies that were observed for several years. Our data demonstrate that the structural order in king penguin colonies resembles a 2D liquid of particles with a Lennard-Jones-type interaction potential. We verify this using a molecular dynamics simulation with thermally driven particles, whereby temperature corresponds to penguin movements, the energy well depth ɛ of the attractive potential corresponds to the strength of the colony-forming behaviour, and the repulsive zone corresponds to the pecking radius. We can recapitulate the liquid disorder of the colony, as measured by the radial distribution function, when the particles have a temperature of several (1.4–10) \
Are dragon-king neuronal avalanches dungeons for self-organized brain activity?
de Arcangelis, L.
2012-05-01
Recent experiments have detected a novel form of spontaneous neuronal activity both in vitro and in vivo: neuronal avalanches. The statistical properties of this activity are typical of critical phenomena, with power laws characterizing the distributions of avalanche size and duration. A critical behaviour for the spontaneous brain activity has important consequences on stimulated activity and learning. Very interestingly, these statistical properties can be altered in significant ways in epilepsy and by pharmacological manipulations. In particular, there can be an increase in the number of large events anticipated by the power law, referred to herein as dragon-king avalanches. This behaviour, as verified by numerical models, can originate from a number of different mechanisms. For instance, it is observed experimentally that the emergence of a critical behaviour depends on the subtle balance between excitatory and inhibitory mechanisms acting in the system. Perturbing this balance, by increasing either synaptic excitation or the incidence of depolarized neuronal up-states causes frequent dragon-king avalanches. Conversely, an unbalanced GABAergic inhibition or long periods of low activity in the network give rise to sub-critical behaviour. Moreover, the existence of power laws, common to other stochastic processes, like earthquakes or solar flares, suggests that correlations are relevant in these phenomena. The dragon-king avalanches may then also be the expression of pathological correlations leading to frequent avalanches encompassing all neurons. We will review the statistics of neuronal avalanches in experimental systems. We then present numerical simulations of a neuronal network model introducing within the self-organized criticality framework ingredients from the physiology of real neurons, as the refractory period, synaptic plasticity and inhibitory synapses. The avalanche critical behaviour and the role of dragon-king avalanches will be discussed in
Utilidade e significância social da teoria do alcance de metas de king
Directory of Open Access Journals (Sweden)
Inácia Sátiro Xavier de França
2002-02-01
Full Text Available Esta pesquisa enfocou o modelo de análise de teorias de Meleis, a Teoria do Alcance de Objetivos (King, 1981 e um estudo realizado por Silveira, objetivando analisar a utilidade e significância social da Teoria de King. Realizamos uma leitura compreensiva da Teoria de King e do modelo proposto por Meleis. Recortamos, desse modelo, o segmento "Crítica de teoria" para servir de suporte analítico. Selecionamos o estudo "Estar despido na unidade de terapia intensiva: duas percepções e um encontro" (Silveira, 1996, cujo marco teórico é a teoria supracitada. Da análise crítica, apoiada na inter-relação desses construtos, concluímos que: a teoria de King é útil à pesquisa por possibilitar a percepção e a interpretação dos dados objetivo-subjetivos da realidade concreta. Sua significância social tem relação com a aplicação da teoria por representantes dos vários segmentos sociais, viabilizando a re-socialização de pessoas e grupos em prol de um mundo mais humano, solidário, cidadão.
Culbert, K. N.; Anderson, J. L.; Cao, W.; Chang, J.; Ehret, P.; Enriquez, M.; Gross, M. B.; Gelbach, L. B.; Hardy, J.; Paterson, S. R.; Ianno, A.; Iannone, M.; Memeti, V.; Morris, M.; Lodewyk, J.; Davis, J.; Stanley, R.; van Guilder, E.; Whitesides, A. S.; Zhang, T.
2009-12-01
Within four years, USC’s College of Letters, Arts and Sciences and Earth Science department have successfully launched the revolutionary undergraduate team research (UTR) program “Geologic Wonders of Yosemite at Two Miles High”. A diverse group of professors, graduate students and undergraduates spent two weeks mapping the Boyden Cave in Kings Canyon National Park, the Iron Mountain pendants south of Yosemite, the Western Metamorphic belt along the Merced River, and the Tuolumne Batholith (TB) in June and August 2009. During their experience in the field, the undergraduates learned geologic field techniques from their peers, professors, and experienced graduate students and developed ideas that will form the basis of the independent and group research projects. Apart from teaching undergraduates about the geology of the TB and Kings Canyon, the two weeks in the field were also rigorous exercise in critical thinking and communication. Every day spent in the field required complete cooperation between mentors and undergraduates in order to successfully gather and interpret the day’s data. Undergraduates were to execute the next day’s schedule and divide mapping duties among themselves. The two-week field experience was also the ideal setting in which to learn about the environmental impacts of their work and the actions of others. The UTR groups quickly adapted to the demanding conditions of the High Sierra—snow, grizzly bears, tourists, and all. For many of the undergraduates, the two weeks spent in the field was their first experience with field geology. The vast differences in geological experience among the undergraduates proved to be advantageous to the ‘team-teaching’ focus of the program: more experienced undergraduates were able to assist less experienced undergraduates while cementing their own previously gained knowledge about geology. Over the rest of the academic year, undergraduates will learn about the research process and scientific
International education, the internet, and the Three Kings experiment
Kooijman, J.; Davies, J.; Berg-Cross, L.; Copier, L.; Asby, A.
2004-01-01
The current project linked students in three universities in a guided discussion of the movie, Three Kings. The goals were to assess the viability of having students from three different courses, in three different universities, in three different countries find common ground to have intellectual
Mutual mate choice for olorful traits in King Penguins
Nolan, Paul M.; Dobson, F. Stephen; Nicolaus, Marion; Karels, Tim J.; McGraw, Kevin J.; Jouventin, Pierre
While studies of mate choice based on male color pattern are ubiquitous, studies of mate choice based on ornamental color traits in sexually monomorphic species are less common. We conducted manipulative field experiments on two color ornaments of king penguins (Aptenodytes patagonicus), the size of
Etravirine: R165335, TMC 125, TMC-125, TMC125.
2006-01-01
Etravirine [TMC 125] is a next-generation non-nucleoside reverse transcriptase inhibitor (NNRTI) that is being developed by Tibotec (Tibotec-Virco Group; now Johnson & Johnson) for the treatment of HIV-1 infections. Etravirine is a highly flexible, di-aryl-pyrimidine (DAPY) compound. The flexibility enables favourable binding interactions with mutant HIV strains as well as wild-type virus. Etravirine has superseded dapivirine as Tibotec's lead NNRTI in clinical development worldwide. Tibotec merged with Virco to form Tibotec-Virco Group in March 2001. Subsequently, Tibotec-Virco Group was acquired by Johnson & Johnson on 18 April 2002. Etravirine was discovered by Tibotec in collaboration with the Janssen Research Foundation. However, the Janssen Research Foundation is no longer involved in the development of etravirine. Etravirine has received fast-track status from the US FDA for the treatment of HIV-1 infections. An expanded access programme for etravirine began in the US in September 2006. The programme made etravirine available to HIV-1 infected adults who have limited treatment options due to virological failure or intolerance to multiple antiretroviral regimens. The progamme will also be introduced in Canada and Europe. In November 2005, Tibotec initiated two randomised, placebo-controlled phase III trials of etravirine in treatment-experienced HIV-1 infected patients with NNRTI resistance and at least three primary protease mutations. The two trials will each enroll 600 patients and will be conducted in 18 countries. Darunavir will be used as the background protease inhibitor in the trials. This is the first time that two investigational antivirals have been evaluated in combination in heavily treatment-experienced patients. The trial design is supported by the FDA, the Committee for Medicinal Products for Human Use (CHMP) of the EMEA and the HIV patient community. Patient enrolment in the two phase III trials was completed in September 2006. A multicentre
Growth, chemical components and ensiling characteristics of king ...
African Journals Online (AJOL)
user
2012-08-09
Aug 9, 2012 ... Wilting had different effects on the 1st cutting and 3rd cutting silages in pH value and NH3-N content, ... On February 16, 2008, king grass was planted with seed stem on ... Home Electrical Appliance Company Limited, Hongkong, China). ... The plant height and the yield from the first cutting to fourth cutting.
Blindness and Insight in King Lear
Institute of Scientific and Technical Information of China (English)
岳元玉
2008-01-01
This paper intends to explore how William Shakespeare illustrates the theme of blindness and insight in his great tragedy "King Lear".Four characters’ deeds and their fate are used as a case study to examine what blindness is,what insight is,and the relationship between the two.The writer finds that by depicting the characters’ deeds and their fate in a double plot,Shakespeare renders the folly of blindness,the transition from blindness to insight,and the use of reason and thought to understand the truth.
The acute mania of King George III: A computational linguistic analysis.
Directory of Open Access Journals (Sweden)
Vassiliki Rentoumi
Full Text Available We used a computational linguistic approach, exploiting machine learning techniques, to examine the letters written by King George III during mentally healthy and apparently mentally ill periods of his life. The aims of the study were: first, to establish the existence of alterations in the King's written language at the onset of his first manic episode; and secondly to identify salient sources of variation contributing to the changes. Effects on language were sought in two control conditions (politically stressful vs. politically tranquil periods and seasonal variation. We found clear differences in the letter corpus, across a range of different features, in association with the onset of mental derangement, which were driven by a combination of linguistic and information theory features that appeared to be specific to the contrast between acute mania and mental stability. The paucity of existing data relevant to changes in written language in the presence of acute mania suggests that lexical, syntactic and stylometric descriptions of written discourse produced by a cohort of patients with a diagnosis of acute mania will be necessary to support the diagnosis independently and to look for other periods of mental illness of the course of the King's life, and in other historically significant figures with similarly large archives of handwritten documents.
Oxalate Content of the Herb Good-King-Henry, Blitum Bonus-Henricus
Directory of Open Access Journals (Sweden)
Wanying Li
2015-05-01
Full Text Available The total, soluble and insoluble oxalate contents of the leaves, stems and buds of Good-King-Henry (Blitum Bonus-Henricus were extracted and measured using HPLC chromatography. The large, mature leaves contained 42% more total oxalate than in the small leaves and the soluble oxalate content of the large leaves was 33% higher than the smaller leaves. Cooking the mixed leaves, stems and buds in boiling water for two minutes significantly (p < 0.05 reduced the total oxalate when compared to the raw plant parts. Pesto sauce made from mixed leaves contained 257 mg total oxalate/100 g fresh weight; this was largely made up of insoluble oxalates (85% of the total oxalate content. Soup made from mixed leaves contained lower levels of total oxalates (44.26 ± 0.49 mg total oxalate/100 g fresh weight and insoluble oxalate made up 49% of the oxalate contents. The levels of oxalates in the Good-King-Henry leaves were high, suggesting that the leaves should be consumed occasionally as a delicacy because of their unique taste rather than as a significant part of the diet. However, the products made from Good-King-Henry leaves indicated that larger amounts could be consumed as the oxalate levels were reduced by dilution and processing.
Directory of Open Access Journals (Sweden)
Streichert Laura C
2009-07-01
Full Text Available Abstract Background Fast food restaurants reportedly target specific populations by locating in lower-income and in minority neighborhoods. Physical proximity to fast food restaurants has been associated with higher obesity rates. Objective To examine possible associations, at the census tract level, between area demographics, arterial road density, and fast food restaurant density in King County, WA, USA. Methods Data on median household incomes, property values, and race/ethnicity were obtained from King County and from US Census data. Fast food restaurant addresses were obtained from Public Health-Seattle & King County and were geocoded. Fast food density was expressed per tract unit area and per capita. Arterial road density was a measure of vehicular and pedestrian access. Multivariate logistic regression models containing both socioeconomic status and road density were used in data analyses. Results Over one half (53.1% of King County census tracts had at least one fast food restaurant. Mean network distance from dwelling units to a fast food restaurant countywide was 1.40 km, and 1.07 km for census tracts containing at least one fast food restaurant. Fast food restaurant density was significantly associated in regression models with low median household income (p Conclusion No significant association was observed between census tract minority status and fast food density in King County. Although restaurant density was linked to low household incomes, that effect was attenuated by arterial road density. Fast food restaurants in King County are more likely to be located in lower income neighborhoods and higher traffic areas.
2011-03-31
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114.... Applicability (c) This AD applies to Thielert Aircraft Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE...) For TAE 125-02-99 and TAE 125-02-114 engines, Operation & Maintenance Manual OM-02-02, Version 2...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Relationships. 1.25 Section 1.25 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.25 Relationships. (a) Normal staff role. Normally, the functions of the Assistant Secretaries...
Lee de Forest King of Radio, Television, and Film
Adams, Mike
2012-01-01
Lee de Forest, Yale doctorate and Oscar winner, gave voice to the radio and the motion picture. Yet by the 1930s, after the radio and the Talkies were regular features of American life, Lee de Forest had seemingly lost everything. Why? Why didn’t he receive the recognition and acclaim he sought his entire life until years later in 1959, when he was awarded an Oscar? A lifelong innovator, Lee de Forest invented the three-element vacuum tube which he developed between 1906 and 1916 as a detector, amplifier, and oscillator of radio waves. As early as 1907, he was broadcasting music programming. In 1918, he began to develop a system for recording and playing back sound by using light patterns on motion picture film. In order to promote and demonstrate his process he made hundreds of short sound films, found theatres for their showing, and issued publicity to gain audiences for his invention. While he received many patents for this technology, he was ignored by the film industry. Lee de Forest, King of Radio, Te...
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Yukon River King Salmon - Ichthyophonus Pilot Study
Kocan, R.M.; Hershberger, P.K.
2001-01-01
When king salmon enter the Yukon River on their spawning migration in mid June, over 25% of the population are infected with Ichthyophonus. The percent of infected fish remains relatively constant until the fish pass river mile 1,319 at Dawson, Y.T., then it drops to 13% when they reach river mile 1,745 at Whitehorse, Y.T. When the sexes are examined separately, slightly more females are infected than males (29% vs 22%). The percent of fish exhibiting clinical signs (diseased) is 2-3% when they enter the river, but increases to over 20% at river mile 715 near Tanana, AK. Disease prevalence within the population remains constant at >20% until fish pass Dawson, then the percent of diseased fish drops to <9% at Whitehorse. When the sexes are examined separately, male disease prevalence is highest at Tanana (22.6%) then gradually drops to just 12.9% at Whitehorse. Females however, continue to show an increase in disease prevalence peaking at river mile 1,081 near Circle, AK, at 36.4%, then dropping to just 5.3% at Whitehorse. Data on infection and disease collected from kings at Nenana on the Tanana River more closely resembles that seen at Whitehorse than the lower and middle Yukon River.
National Oceanic and Atmospheric Administration, Department of Commerce — This data set is from a series of laboratory experiments examining the interactions between red and blue king crabs and habitat. We examined how density and predator...
The Role of Authors in the “Uruk List of Kings and Sages”: Canonization and Cultural Contact
DEFF Research Database (Denmark)
Helle, Sophus
2018-01-01
The so-called "Uruk List of Kings and Sages" includes a selection of (pseudo-)historical figures known from other sources as the authors of literary and scholarly works. These authors are placed alongside famous kings and mythical sages, in a synoptic and schematic overview of cuneiform culture...
Reflections on Cambridge: John Maynard Keynes at King's College Cambridge
Macfarlane, Alan
2012-01-01
.mp4 video file The economist John Maynard Keynes spent much of his life in Cambridge, connected to King's College. Alan Macfarlane reflects on a few aspects of his life and work. Filmed by Xu Bei in 2010
Teulier, Loïc; Tornos, Jérémy; Rouanet, Jean-Louis; Rey, Benjamin; Roussel, Damien
2013-05-01
During the cold austral winter, king penguin chicks are infrequently fed by their parents and thus experience severe nutritional deprivation under harsh environmental conditions. These energetic constraints lead to a range of energy sparing mechanisms balanced by the maintenance of efficient thermogenic processes. The present work investigated whether the high thermogenic capacities exhibited by winter-acclimatized king penguin chicks could be related to an increase in lipid substrate supply and oxidation in skeletal muscle, the main site of thermogenesis in birds. To test this hypothesis, we examined i) the effect of an experimental rise in plasma triglyceride on the whole metabolic rate in winter-acclimatized (WA) and de-acclimatized king penguin chicks kept at thermoneutrality (TN), and ii) investigated the fuel preference of muscle mitochondria. In vivo, a perfusion of a lipid emulsion induced a small 10% increase of metabolic rate in WA chicks but not in TN group. In vitro, the oxidation rate of muscle mitochondria respiring on lipid-derived substrate was +40% higher in WA chicks than in TN, while no differences were found between groups when mitochondria oxidized carbohydrate-derived substrate or succinate. Despite an enhanced fuel selection towards lipid oxidation in skeletal muscle, a rise of circulating lipids per se was not sufficient to fully unravel the thermogenic capacity of winter-acclimatized king penguin chicks. Copyright © 2013 Elsevier Inc. All rights reserved.
Applications of Panoramic Images: from 720° Panorama to Interior 3d Models of Augmented Reality
Lee, I.-C.; Tsai, F.
2015-05-01
A series of panoramic images are usually used to generate a 720° panorama image. Although panoramic images are typically used for establishing tour guiding systems, in this research, we demonstrate the potential of using panoramic images acquired from multiple sites to create not only 720° panorama, but also three-dimensional (3D) point clouds and 3D indoor models. Since 3D modeling is one of the goals of this research, the location of the panoramic sites needed to be carefully planned in order to maintain a robust result for close-range photogrammetry. After the images are acquired, panoramic images are processed into 720° panoramas, and these panoramas which can be used directly as panorama guiding systems or other applications. In addition to these straightforward applications, interior orientation parameters can also be estimated while generating 720° panorama. These parameters are focal length, principle point, and lens radial distortion. The panoramic images can then be processed with closerange photogrammetry procedures to extract the exterior orientation parameters and generate 3D point clouds. In this research, VisaulSFM, a structure from motion software is used to estimate the exterior orientation, and CMVS toolkit is used to generate 3D point clouds. Next, the 3D point clouds are used as references to create building interior models. In this research, Trimble Sketchup was used to build the model, and the 3D point cloud was added to the determining of locations of building objects using plane finding procedure. In the texturing process, the panorama images are used as the data source for creating model textures. This 3D indoor model was used as an Augmented Reality model replacing a guide map or a floor plan commonly used in an on-line touring guide system. The 3D indoor model generating procedure has been utilized in two research projects: a cultural heritage site at Kinmen, and Taipei Main Station pedestrian zone guidance and navigation system. The
Directory of Open Access Journals (Sweden)
Heleen Janse van Vuuren
2016-07-01
Full Text Available The ongoing collapse of large international companies could have been partiallyprevented if good corporate governance principles and,more specifically,effectiverisk management practices had been implemented and adhered to.Research reveals that the majority offinancial institutions in Europe do notmanage risk effectively and the global financial crisis proved that excessive risk-taking can result in corporate failure. Similar trends are prevalent in South Africa.The aim of this research was to investigate the compliance of Johannesburg StockExchange (JSE listed companies with recommended risk management practicesand disclosure requirements after the introduction of King II and III. To achievethis the annual reports ofselectedJSElisted companies were evaluated toestablish the quality of their reporting on risk management practices asrecommended in King II andIII. The results of the study indicated that theminority of the companies investigated, fully complied with all the recommendedrequirements. This study contributed to literature by showing that althoughdisclosure on risk management practicesimproved significantly since King IIbecame operational in 2002, companies still did not adhere to all the requirementsas stipulated even after King III became effectivein 2010. The finding, therefore,supports the notion that full compliance is an evolutionary process, rather than arevolutionary process and will therefore only be achieved over time.
Buranasiri, Prathan
2014-09-01
A physics undergraduate degree major in optics and communication technology has been offered at King Mongkut's Institute of Technology Ladkrabang (KMITL), Bangkok, Thailand. There are nine required three credit hour courses including two laboratory courses plus a number of selections in optics and communication based technology courses. For independent thinking and industrial working skills, nine credit hours of research project, practical training or overseas studies are included for selection in the final semester. Students are encouraged to participate in international conferences and professional organizations. Recently the program, with support from SPIE and OSA, has organized its first international conference on photonic solutions 2013 (ICPS 2013).
International Nuclear Information System (INIS)
Maekinen, Johanna; Marttila, Harri; Viljanen, Matti K.
2001-01-01
Borrelia burgdorferi sensu lato genospecies were differentiated by PCR-based sequencing of the borrelial flagellin gene. To evaluate the usefulness of KingFisher TM magnetic particle processor in PCR product purification, borrelia PCR products were purified with KingFisher TM magnetic particle processor prior to cycle sequencing and the quality of the sequence data received was analyzed. KingFisher was found to offer a rapid and reliable alternative for borrelial PCR product purification
Shame, recognition and love in Shakespeare’s 'King Lear'
DEFF Research Database (Denmark)
Montes Sanchez, Alba
2014-01-01
In this paper, I explore the experience of shame and its connections to recognition and love as manifested in Shakespeare’s King Lear. My main focus in this paper is the ethical relevance of shame. I start from Sartre’s account of shame in Being and Nothingness, and I consider Webber’s attempt...
Directory of Open Access Journals (Sweden)
Francisco Airton Rangel Filho
2007-12-01
µg (32 or 12.5 µg (30 of vaginal misoprostol each four hours, until the maximum of eight doses. Mode of delivery, time between induction and delivery, perinatal complications, and maternal side effects were studied. The control variables were maternal and gestational ages, parity and Bishop score. The statistical tests used were average calculations, shunting line-standards and Student t-test (numerical continuous variables, chi2 (categorical variables and Mann-Whitney test (discrete variables. RESULTS: the two groups, 12.5 and 25 µg, did not differ in relation to the interval of time between the induction onset and delivery (1524 versus 1212 min, p=0.333, in the frequency of vaginal delivery (70 versus 71.8%, p=0.720, Apgar scores below seven at the fifth minute (3,3 versus 6,25%, p=0.533 and tachysystole frequency (3.3 versus 9.3%, p=0.533. The average of total dose administered was significantly higher in the 25 µg group (40 versus 61.2 µg, p=0.03. CONCLUSIONS: vaginal misoprostol in the dose of 12.5 µg was efficient, with collateral effects similar, to the 25 µg of vaginal misoprostol, for induction of labor at term.
Using King's interacting systems theory to link emotional intelligence and nursing practice.
Shanta, Linda L; Connolly, Maria
2013-01-01
King's theory is a broad theory designed to provide a framework for nursing (I.M. King, 1981), whereas emotional intelligence (EI; J.D. Mayer & P. Salovey, 2004) is a theory that is specific for addressing potential competency in dealing with emotions and emotional information. J.D. Mayer, P. Salovey, D.R. Caruso, and G. Sitarenios (2001) defined EI as the "ability to recognize the meaning of emotions and their relationships and to use them as a basis for reasoning and problem solving" (p. 234). These researchers believed that EI is related to cognitive intellect through the ability to use reasoning by way of information to find meaning. J.D. Mayer and P. Salovey (2004) argued that the skills that comprise EI were likely enhanced through obtaining a liberal education infused with values exploration. J.D. Mayer, P. Salovey, D.R. Caruso, and G. Sitarenios (2001) contended that there are 4 branches of abilities that create EI: (a) the skill of perceiving emotion within oneself and others, (b) assimilation of an emotion to facilitate thinking, (c) understanding and knowledge of emotion, and (d) conscious regulation of emotion. Each level or branch builds upon the previous one, and awareness of what each branch offers the individual in enhancing relationships with others is a key component of healthy emotional interactions. This article will provide a theoretic foundation based upon King's interacting systems theory (IST; 1981) that embraces EI as a crucial component in the nurse's ability to provide holistic care for patients, peers, and themselves. King's IST underscores the necessity of nurses possessing abilities of EI as they care for others but does not fully describe a mechanism to understand and incorporate emotions within the complex nurse-patient interactions and communications that are part of the nursing process. Copyright © 2013 Elsevier Inc. All rights reserved.
Patrice Loïez
2002-01-01
Photo 02: Visiting the NA48 experiment, Dr Julia King, Chief Executive Designate, Institute of Physics (Britain and Ireland) (right) with A. Ceccucci and K. Peach. Photo 05: Visiting the NA48 experiment, Dr Julia King, Chief Executive Designate, Institute of Physics (Britain and Ireland) (centre) with A. Ceccucci and C. Lazzeroni. Photo 08: Visiting the NA48 experiment, Dr Julia King, Chief Executive Designate, Institute of Physics (Britain and Ireland) (second from left) with (left to right) R. Barlow, J. Wood, N. McCubbin, K. Peach, A. Ceccucci, C. Lazzeroni, M. Patel and D. Munday.
Statement of Basis/Proposed Plan for the Gunsite 720 Rubble Pit Unit (631-18G)
International Nuclear Information System (INIS)
Palmer, E.
1996-07-01
This Statement of Basis/Proposed Plan for the Gunsite 720 Rubble Pit Unit is issued by the U.S. Department of Energy, the lead agency for the Savannah River Site remedial activities, with concurrence by the U.S. Environmental Protection Agency - Region IV, and the South Carolina Department of Health and Environmental Control
Frankowska, Aneta; Ziółkowska, Joanna; Bielawski, Leszek; Falandysz, Jerzy
2010-01-01
This study aimed to provide basic data on the composition of metallic elements, including toxicologically important Cd and Hg, in popular and prized wild King Bolete mushrooms. We investigated the importance of soil substratum as a source of these metals. ICP-OES and CV-AAS were applied to determine the profile of Al, Ba, Ca, Cd, Cu, Fe, Hg, K, Mg, Mn, Na, Sr and Zn in caps and stipes of King Bolete mushroom and in the surface layer of soil (0-10 cm) from the Płocka Dale area of Poland. Hg, Cu, Cd, Zn, Mg and K exhibited bioconcentration factors (BCF) > 1. Specifically, Hg, Cu and Cd (mean BCFs for caps were 110, 19 and 16, respectively) were efficiently bioconcentrated by King Bolete, while other elements were bioexcluded (BCF < 1). Cadmium was present in the caps at mean levels of 5.5 ± 2.4 mg kg(-1) dry weight (dw) and mercury at levels of 4.9 ± 1.4 mg kg(-1) dw, both occurring at elevated concentrations in those King Bolete mushrooms surveyed.
2011-02-23
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-02-99 and TAE 125-02-114 Reciprocating... TAE 125-02-99 and TAE 125-02-114 reciprocating engines installed in, but not limited to, Cessna 172... occurs later. Repetitive Replacements of Timing Chains for All TAE 125-02-99 and TAE 125-02-114 Engines...
Sampaio, Dayanna Souza; Almeida, Juliana Rodrigues Barboza; de Jesus, Hugo E; Rosado, Alexandre S; Seldin, Lucy; Jurelevicius, Diogo
2017-11-01
Anaerobic diesel fuel Arctic (DFA) degradation has already been demonstrated in Antarctic soils. However, studies comparing the distribution of anaerobic bacterial groups and of anaerobic hydrocarbon-degrading bacteria in Antarctic soils containing different concentrations of DFA are scarce. In this study, functional genes were used to study the diversity and distribution of anaerobic hydrocarbon-degrading bacteria (bamA, assA, and bssA) and of sulfate-reducing bacteria (SRB-apsR) in highly, intermediate, and non-DFA-contaminated soils collected during the summers of 2009, 2010, and 2011 from King George Island, Antarctica. Signatures of bamA genes were detected in all soils analyzed, whereas bssA and assA were found in only 4 of 10 soils. The concentration of DFA was the main factor influencing the distribution of bamA-containing bacteria and of SRB in the analyzed soils, as shown by PCR-DGGE results. bamA sequences related to genes previously described in Desulfuromonas, Lautropia, Magnetospirillum, Sulfuritalea, Rhodovolum, Rhodomicrobium, Azoarcus, Geobacter, Ramlibacter, and Gemmatimonas genera were dominant in King George Island soils. Although DFA modulated the distribution of bamA-hosting bacteria, DFA concentration was not related to bamA abundance in the soils studied here. This result suggests that King George Island soils show functional redundancy for aromatic hydrocarbon degradation. The results obtained in this study support the hypothesis that specialized anaerobic hydrocarbon-degrading bacteria have been selected by hydrocarbon concentrations present in King George Island soils.
2011-10-18
... Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125-01 Reciprocating Engines AGENCY: Federal Aviation... substance. But we have found it necessary to reduce the initial compliance time for TAE 125-02-99 engines... about 370 TAE 125-01 and TAE 125-02-99 reciprocating engines installed on products of U.S. registry. We...
On-farm flood capture could reduce groundwater overdraft in Kings River Basin
Directory of Open Access Journals (Sweden)
Philip A.M. Bachand
2016-11-01
Full Text Available Chronic groundwater overdraft threatens agricultural sustainability in California's Central Valley. Diverting flood flows onto farmland for groundwater recharge offers an opportunity to help address this challenge. We studied the infiltration rate of floodwater diverted from the Kings River at a turnout upstream of the James Weir onto adjoining cropland; and calculated how much land would be necessary to capture the available floodwater, how much recharge of groundwater might be achieved, and the costs. The 1,000-acre pilot study included fields growing tomatoes, wine grapes, alfalfa and pistachios. Flood flows diverted onto vineyards infiltrated at an average rate of 2.5 inches per day under sustained flooding. At that relatively high infiltration rate, 10 acres are needed to capture one CFS of diverted flood flow. We considered these findings in the context of regional expansion. Based upon a 30-year record of Kings Basin surplus flood flows, we estimate 30,000 acres operated for on-farm flood recharge would have had the capacity to capture 80% of available flood flows and potentially offset overdraft rates in the Kings Basin. Costs of on-farm flood capture for this study were estimated at $36 per acre-foot, less than the cost for surface water storage and dedicated recharge basins.
King penguins can detect two odours associated with conspecifics.
Cunningham, Gregory B; Bonadonna, Francesco
2015-11-01
Recent studies on olfaction in penguins have focused on their use of odours while foraging. It has been proposed for some seabirds that an olfactory landscape shaped by odours coming from feeding areas exists. Islands and colonies, however, may also contribute to the olfactory landscape and may act as an orienting map. To test sensitivities to a colony scent we studied whether King penguins (Aptenodytes patagonicus) could detect the smell of sand, feathers or feces by holding presentations beneath their beaks while they naturally slept on the beach. Penguins had a significantly greater response to the feathers and feces presentations than to sand. Although only a first step in exploring a broader role of olfaction in this species, our results raise the possibility of olfaction being used by King penguins in three potential ways: (1) locating the colony from the water or the shore, (2) finding the rendezvous zone within the colony where a chick or partner may be found, or (3) recognizing individuals by scent, as in Humboldt penguins (Spheniscus demersus). © 2015. Published by The Company of Biologists Ltd.
The Greek charter of the Hungarian King Stephen I
Directory of Open Access Journals (Sweden)
Stojkovski Boris
2016-01-01
Full Text Available The first Hungarian Christian ruler, King Stephen I (997-1038 issued several charters that have survived to this day. One of them is the charter issued on behalf of the nuns from the Monastery of the Holy Theotokos in Veszprémvölgy. The charter was written in the Greek language, and has been the subject of many studies. The original has not been preserved; what remains is a copy from the time of King Coloman, dated to 1109. The charter has not been published in a critical edition in any language other than Hungarian and even though it has been examined by numerous Hungarian scholars, many questions remain open. The aim of the author is to provide a critical edition and an English translation of the charter, but also to clarify some remaining doubts about the charter and its contents. Furthermore, some comparisons will be made with the Byzantine charters issued at the beginning of the 11th and during the 12th century.
Oral fingolimod (FTY720) in multiple sclerosis: two-year results of a phase II extension study
DEFF Research Database (Denmark)
O'Connor, P; Comi, G; Montalban, X
2009-01-01
OBJECTIVE: To report the results of a 24-month extension of a phase II trial assessing the efficacy, safety, and tolerability of the once-daily oral sphingosine-1-phosphate receptor modulator, fingolimod (FTY720), in relapsing multiple sclerosis (MS). METHODS: In the randomized, double-blind, pla...
Energy Technology Data Exchange (ETDEWEB)
Bretz, Justin K.; Olson, Jill M. (US Fish and Wildlife Service, Idaho Fishery Resource Office, Ahsahka, ID)
2003-03-01
In 2002 the Idaho Fisheries Resource Office continued working as a cooperator on the Salmon Supplementation Studies in Idaho Rivers (ISS) project on Pete King and Clear creeks. Data relating to supplementation treatment releases, juvenile sampling, juvenile PIT tagging, broodstock spawning and rearing, spawning ground surveys, and snorkel surveys were used to evaluate the project data points and augment past data. Supplementation treatments included the release of 51,329 left ventral-clipped smolts into Clear Creek (750 were PIT tagged), and 12,000 unmarked coded-wire tagged parr into Pete King Creek (998 were PIT tagged). Using juvenile collection methods, Idaho Fisheries Resource Office staff PIT tagged and released 579 naturally produced spring chinook juveniles in Clear Creek, and 54 on Pete King Creek, for minimum survival estimates to Lower Granite Dam. For Clear Creek, minimum survival estimates to Lower Granite Dam of hatchery produced supplementation and naturally produced PIT tagged smolts, were 36.0%, and 53.1%, respectively. For Pete King Creek, minimum survival estimates to Lower Granite Dam, of hatchery produced supplementation smolts and naturally produced smolts PIT tagged as parr and presmolts, were 18.8%, and 8.3%, respectively. Adults collected for broodstock in 2002 represented the final adult broodstock group collected for the ISS project. Twenty-six ventral clipped, and 28 natural adult spring chinook were transported above the weir. Monitoring and evaluation of spawning success was continued on Clear and Pete King creeks. A total of 69 redds were counted and 79 carcasses were recovered on Clear Creek. Two redds were observed and no carcasses were collected on Pete King Creek.
International Nuclear Information System (INIS)
Kuri, S.; Matsuoka, T.; Kishimoto, J.; Ishiko, D.; Saito, Y.; Kimura, T.
2004-01-01
MHI have been developing 5 types of spent nuclear fuel transport and storage cask (MSF cask fleet) as a cask line-up. In order to demonstrate their safety, a representative cask model for the cask fleet have been designed for drop test regulated in IAEA TS-R-1. The drop test with a full and a 1/2.5 scale models are to be performed. It describes the test program of the drop test and manufacturing process of the scale models used for the tests
Contrapuntal Significations in Wole Soyinka's Death and the King's ...
African Journals Online (AJOL)
Wole Soyinka's Death and the King's Horseman has been widely acclaimed as a great example of African tragedy. It is, in fact, the dramatic aggregation of Soyinka's treatise in Myth, Literature and the African World. Hence, the play is most often 'read' in the lights of its 'difference' from western notions of the tragic, the place ...
The King-Denborough syndrome in the paediatric patient. | Maharaj ...
African Journals Online (AJOL)
We describe the management of two children with a diagnosis of King Denborough syndrome. The first case is that of a 23-month-old term male infant requiring repair of a cleft palate. After flushing the anaesthetic machine, infusions of remifentanil at 0.25 μ/kg/min and propofol at 12 mg/kg/hr were commenced. These were ...
Evaluation of medical consultation letters at King Fahd Hospital, Al ...
African Journals Online (AJOL)
Evaluation of medical consultation letters at King Fahd Hospital, Al Hufuf, Saudi Arabia. Hamed Abd Allah Al Wadaani, Magdy Hassan Balaha. Abstract. Background: In surgical wards, it is of paramount importance to communicate with other health care providers, mostly physicians, referring patients to them for their ...
Validation of the King's Health Questionnaire for South Africa in ...
African Journals Online (AJOL)
Objective. To validate the King's Health Questionnaire for urinary incontinence in the local South African English, Afrikaans and isiXhosa female community. Design. A cohort analytical study. Setting and subjects. The study utilised a sample of convenience. Women with urinary incontinence attending the gynaecology clinic ...
Directory of Open Access Journals (Sweden)
Ewelina Gaszynska
2014-01-01
Full Text Available Objective. Advanced airway management, endotracheal intubation (ETI, during CPR is more difficult than, for example, during anesthesia. However, new devices such as video laryngoscopes should help in such circumstances. The aim of this study was to assess the performance of the KingVision video laryngoscopes in a manikin cardiopulmonary resuscitation (CPR scenario. Methods. Thirty students enrolled in the third year of paramedic school took part in the study. The simulated CPR scenario was ETI using the standard laryngoscope with a Macintosh blade (MCL and ETI using the KingVision video laryngoscope performed during uninterrupted chest compressions. The primary endpoints were the time needed for ETI and the success ratio. Results. The mean time required for intubation was similar for both laryngoscopes: 16.6 (SD 5.11, median 15.64, range 7.9–27.9 seconds versus 17.91 (SD 5.6, median 16.28, range 10.6–28.6 seconds for the MCL and KingVision, respectively (P=0.1888. On the first attempt at ETI, the success rate during CPR was comparable between the evaluated laryngoscopes: P=0.9032. Conclusion. The KingVision video laryngoscope proves to be less superior when used for endotracheal intubation during CPR compared to the standard laryngoscope with a Mackintosh blade. This proves true in terms of shortening the time needed for ETI and increasing the success ratio.
"I Just Want to Do God's Will:" Teaching Martin Luther King, Jr. as a Religious Leader
Neumann, David
2018-01-01
Teachers often respond to the perils of teaching about religion by simply avoiding the subject. An investigation of secondary lesson plans on three prominent Martin Luther King, Jr. websites reveals little attention to the ideology of the civil rights movement, especially those touching on religious ideas. Ignoring King's religious views risks…
Thyroid measurements of Iodine-125 workers
International Nuclear Information System (INIS)
Burns, P.A.; Peggie, J.R.
1979-02-01
The accumulation of 125 I in the thyroid presents real hazards to workers who use this radionuclide. Recent assessments of the maximum permissible thyroid burden for 125 I have tended to be lower than those previously adopted. Workers using 125 I may receive small doses to a film badge monitor from external radiation while accumulating significant doses to the thyroid from internal contamination. It is therefore necessary to perform some form of thyroid monitoring on such workers. In the past two years the Australian Radiation Laboratory has monitored 125 I workers from six different institutations in the Melbourne area to determine the activity of 125 I in their thyroids. Most of the levels monitored were less than one tenth of the most recently recommended thyroid burden of 400 nanocurie. The highest levels were measured in workers who actually perform iodinations. Workers who handle the iodinate generally had lower levels than those performing the iodinations. Only a very small number of the workers measured were below the detectable limit of the system indicating that even when low activities of 125 I are handled in relatively stable forms it is still possible to accumulate 125 I in the thyroid
14 CFR 125.145 - Firewall construction.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewall construction. 125.145 Section 125.145 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Requirements § 125.145 Firewall construction. Each firewall and shroud must— (a) Be so made that no hazardous...
Dvoretsky, Alexander G.; Dvoretsky, Vladimir G.
2016-12-01
Knowledge of relationships between environmental variables and biological processes can greatly improve fisheries assessment and management in commercially important species. We analyzed the effects of environmental factors (climatic indices and water temperature) on the stock characteristics (total population number, number of pre-recruits and number of legal males) of the red king crab (Paralithodes camtschaticus), an introduced species in the Barents Sea. Stock trends in red king crab appear to be related to decadal climate shifts. Abundances were negatively related to the North Atlantic Oscillation index (NAO) in August and positively related to water temperature in late winter-early summer. Total and commercial stock abundance were negatively correlated with the lag-1 Arctic Oscillation index (AO) in August and the lag-2 winter NAO index. The total number of P. camtschaticus was most strongly associated with water temperature in spring and summer and NAO/AO indices in April and May. Lagged NAO indices in February and August (9 or 10 yr) had a positive relationship to the commercial stock of P. camtschaticus. These findings suggest that temperature conditions of current and previous year affect natural mortality of larvae and juvenile red king crabs. Warmer temperature conditions lead to increased biomass of red king crab food items. Negative correlations between climatic indices and the red king crab stocks may be associated with predator pressure on juvenile red king crabs or higher mortality because of predator or parasite pressure and diseases. The associations between stock indices and environmental variables could help better predict recruitment patterns of P. camtschaticus.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT
Bachand, P.A.M.; Horwath, W.R.; Roy, S.; Choperena, J.; Cameron, D.
2012-01-01
Two large hydrologic issues face the Kings Basin, severe and chronic overdraft of about 0.16M ac-ft annually, and flood risks along the Kings River and the downstream San Joaquin River. Since 1983, these floods have caused over $1B in damage in today’s dollars. Capturing flood flows of sufficient volume could help address these two pressing issues which are relevant to many regions of the Central Valley and will only be exacerbated with climate change. However, the Kings River has high vari...
14 CFR 135.125 - Aircraft security.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft security. 135.125 Section 135.125....125 Aircraft security. Certificate holders conducting operators conducting operations under this part must comply with the applicable security requirements in 49 CFR chapter XII. [67 FR 8350, Feb. 22, 2002] ...
34 CFR 303.125 - Fiscal control.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Fiscal control. 303.125 Section 303.125 Education... DISABILITIES State Application for a Grant Statement of Assurances § 303.125 Fiscal control. The statement must provide assurance satisfactory to the Secretary that such fiscal control and fund accounting procedures...
75 FR 3839 - Martin Luther King, Jr., Federal Holiday, 2010
2010-01-22
... Part III The President Proclamation 8473--Martin Luther King, Jr., Federal Holiday, 2010 Proclamation 8474--Religious Freedom Day, 2010 Notice of January 20, 2010--Continuation of the National... only by the power of his words, which still call on us to perfect those sacred ideals enshrined in our...
Littoral Encounters : The Shore as Cultural Interface in King Horn
Sobecki, Sebastian
2006-01-01
1. III * Later Medieval: Excluding Chaucer -- Brown et al., 10.1093 ... ... between the Saracens and the londisse men allied to the protagonist (' Littoral Encounters: the Shore as Cultural Interface in King Horn', Al-Mas a ... www.ywes.oxfordjournals.org/cgi/content/full/man0092 2.Murray, Alan V.
His Majesty King Abdullah II of the Hashemite Kingdom of Jordan
Patrice Loïez
2003-01-01
Left to right : King Abdullah II of Jordan visiting CERN with Luciano Maiani, Director-General of CERN, Maurice Bourquin (behind), President of the CERN Council, and Herwig Schopper, President of the SESAME Council and former Director-General of CERN.
Heupink, Tim H; van den Hoff, John; Lambert, David M
2012-08-23
Historically, king penguin populations on Macquarie Island have suffered greatly from human exploitation. Two large colonies on the island were drastically reduced to a single small colony as a result of harvesting for the blubber oil industry. However, recent conservation efforts have resulted in the king penguin population expanding in numbers and range to recolonize previous as well as new sites. Ancient DNA methods were used to estimate past genetic diversity and combined with studies of modern populations, we are now able to compare past levels of variation with extant populations on northern Macquarie Island. The ancient and modern populations are closely related and show a similar level of genetic diversity. These results suggest that the king penguin population has recovered past genetic diversity in just 80 years owing to conservation efforts, despite having seen the brink of extinction.
Reconciling PM10 analyses by different sampling methods for Iron King Mine tailings dust.
Li, Xu; Félix, Omar I; Gonzales, Patricia; Sáez, Avelino Eduardo; Ela, Wendell P
2016-03-01
The overall project objective at the Iron King Mine Superfund site is to determine the level and potential risk associated with heavy metal exposure of the proximate population emanating from the site's tailings pile. To provide sufficient size-fractioned dust for multi-discipline research studies, a dust generator was built and is now being used to generate size-fractioned dust samples for toxicity investigations using in vitro cell culture and animal exposure experiments as well as studies on geochemical characterization and bioassay solubilization with simulated lung and gastric fluid extractants. The objective of this study is to provide a robust method for source identification by comparing the tailing sample produced by dust generator and that collected by MOUDI sampler. As and Pb concentrations of the PM10 fraction in the MOUDI sample were much lower than in tailing samples produced by the dust generator, indicating a dilution of Iron King tailing dust by dust from other sources. For source apportionment purposes, single element concentration method was used based on the assumption that the PM10 fraction comes from a background source plus the Iron King tailing source. The method's conclusion that nearly all arsenic and lead in the PM10 dust fraction originated from the tailings substantiates our previous Pb and Sr isotope study conclusion. As and Pb showed a similar mass fraction from Iron King for all sites suggesting that As and Pb have the same major emission source. Further validation of this simple source apportionment method is needed based on other elements and sites.
Mena, F. P.; Kooi, J.; Baryshev, A. M.; Lodewijk, C. F. J.; Klapwijk, T. M.; Wild, W.; Desmaris, V.; Meledin, D.; Pavolotsky, A.; Belitsky, V.; Wild, Wolfgang
2008-01-01
Here we report on the RF performance of a 2SB mixer (600-720 GHz) fabricated in a new method that combines traditional micromachining with waveguide components fabricated by photolithography and electroplating. The latter allows reaching, in a reproducible way, the stringent accuracies necessary for
JEWISH IDEA: FROM KING TEMPLE TO KING STATE YAHUDİ İDEASI: KRAL MABEDİNDEN KRAL DEVLETE
Directory of Open Access Journals (Sweden)
Mustafa YİĞİTOĞLU
2012-06-01
Full Text Available The study focuses on a process that has become the main problem of Judaism. As the subject, this article is reflectiton the world and the beyond world of the point of view of Judaism. This actually means that the analysis in general terms the history of Jewish thought. Although concentrated in the research issue is not exactly a history of thought. But this article examines the structure of Judaism directly. Firstly in this research discusses King Solomon’s temple which was built as an indicator of Judaism is institutionalized and the idea of Jewish towards to King State. Bu çalışma Yahudiliğin temel sorunu haline gelen bir süreci ele almaktadır. Konu itibari ile Yahudiliğin dünyaya ve dünya ötesine bakış açısını yansıtmaktadır. Bu, aslında Yahudi düşünce tarihinin genel anlamda analizi demektir. Gerçi araştırmanın yoğunlaştığı husus tam anlamıyla bir düşünce tarihi değildir. Ancak alan itibariyle Yahudiliğin doğrudan yapısını inceleyen bir duruma haizdir.Araştırmada ilk olarak Yahudiliğin kurumsallaştığının bir göstergesi olan Kral Süleyman’ın inşa ettirdiği mabed; önemi, konumu ve etkisi gibi hususiyetleriyle tarihsel bir çerçevede ele alınmış, nihayetinde Kral Devlete doğru giden bir Yahudi düşüncesine yer verilmiştir.
Directory of Open Access Journals (Sweden)
Emmanuel Bankole Oladumiye
2014-10-01
Full Text Available Printmaking is a visual documentary media of art which was used as a medium of expression in analyzing myth and mythology monarchical activities of the Yorubas in South Western Nigeria in this study. The monarchical activities of the Yoruba Kings, is the cultural heritage and legacy that people do guide jealously and considered to be of high cultural value. The Yoruba Kings of South Western Nigeria are traditional entity which passed through the rites of installing kings for the throne fore fathers as a leader with symbol of authority between the people and the spirit world. The kings in Yoruba kingdom is so much respected that they are seen as divine and representative of God on earth and they are exalted into the position of deity because of his monarchical duties to his subjects at large. The funfairs that accompany the monarch roles are worth documenting using printmaking as vehicle of visual and historical expression of myths and mythologies demonstrating African culture which stands out as sacred. The discourse also relies on oral testimonies written and archival documents. The materials used for the execution of the prints are rubber, wood, plate, offset printing inks and glass which records the events as an alternative to the use of photographic documentation. The research examine the philosophy behind the monarchical roles of the Yoruba Kings in print visuals based on the cultural heritage of the Yoruba people it employs an exploratory qualitative methods rely on literature review.
Chiari-like malformation and syringomyelia in cavalier King Charles spaniels
Rusbridge, C.
2007-01-01
This thesis is the cumulation of over a decade of study into the pathogenesis and treatment Chiari-like malformation and syringomyelia (CM/SM) in the cavalier King Charles spaniel (CKCS). Chiari-like malformation is a condition where the brain is too big for the skull and is crushed and pushed out
Examples of Mechanism Design : From King Solomon to eBay
De Weerdt, M.M.
2007-01-01
The judgment of king Solomon is an early example of mechanism design. Mechanism design attempts to achieve desired outcomes in situations with self-interested players by setting the rules of the game in a specific way. We will see that the game Solomon proposed would not have worked if the women
International Nuclear Information System (INIS)
Goodnow, R.A. Jr.; Bukownik, R.; Nakanishi, K.; Usherwood, P.N.; Eldefrawi, A.T.; Anis, N.A.; Eldefrawi, M.E.
1991-01-01
125I2-iodinated philanthotoxin-343 (PhTX-343), [125I2]PhTX-343-arginine, and [125I2]PhTX-343-lysine were synthesized and evaluated as probes for glutamate receptors in rat brain synaptic membranes. It was found that these probes were not specific for the glutamate receptors but may be useful for investigating the polyamine binding site. Filtration assays with Whatman GF/B fiber glass filters were unsuitable because the iodinated PhTX-343 analogues exhibited high nonspecific binding to the filters, thus hindering detection of specific binding to membranes. When binding was measured by a centrifugal assay, [125I2]PhTX-343-lysine bound with low affinity (KD = 11.4 ± 2 microM) to a large number of sites (37.2 ± 9.1 nmol/mg of protein). The binding of [125I2]PhTX-343-lysine was sensitive only to the polyamines spermine and spermidine, which displaced [125I2]PhTX-343-lysine with Ki values of (3.77 ± 1.4) x 10(-5) M and (7.51 ± 0.77) x 10(-5) M, respectively. The binding was insensitive to glutamate receptor agonists and antagonists. Binding results with [125I2]PhTX-343-arginine were similar to those of [125I2]-PhTX-343-lysine. Considering the high number of toxin binding sites (10000-fold more than glutamate) in these membranes and the insensitivity of the binding to almost all drugs that bind to glutamate receptors, it is evident that most of the binding observed is not to glutamate receptors. On the other hand, PhTX analogues with photoaffinity labels may be useful in the isolation/purification of various glutamate and nicotinic acetylcholine receptors; they could also be useful in structural studies of receptors and their binding sites
14 CFR 125.355 - Airplane equipment.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane equipment. 125.355 Section 125.355...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Release Rules § 125.355 Airplane...
14 CFR 125.93 - Airplane limitations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations. 125.93 Section 125.93...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements § 125.93 Airplane...
Tedesco-Silva, H; Lorber, M I; Foster, C E; Sollinger, H W; Mendez, R; Carvalho, D B; Shapiro, R; Rajagopalan, P R; Mayer, H; Slade, J; Kahan, B D
2009-01-01
This exploratory, multicenter, open-label study evaluated the efficacy and safety of FTY720, as a part of an immunosuppressive regimen, in combination with everolimus and steroids in de novo renal transplant recipients at increased risk of delayed graft function (DGF). Patients received FTY720 (5 mg) and everolimus (4 mg) 2-12 h pre-transplantation, followed by 2.5 mg/d FTY720 and concentration-controlled everolimus (4-8 ng/mL) post-transplant for 12 months. Induction therapy was prohibited. After enrollment of 56 of the planned 200 patients between 2000 and 2002, the recruitment was terminated. The primary endpoint, rate of graft loss, or death at three months was 15.4% and the biopsy-confirmed acute rejection was 42.3%. Death or graft loss at 12 months in the DGF and non-DGF arms was 36.0% and 25.9%, respectively. The mean estimated creatinine clearance at three months was 63 and 55 mL/min in the non-DGF and DGF groups, respectively, while at 12 months it was 56 mL/min in both the groups. Although there was no comparator arm, the results from this exploratory study (compared with data from other phases II and III trials) indicated no apparent benefits of FTY720-based regimens for prevention of acute rejection and preservation of renal function in renal transplant recipients at high risk of DGF.
King customer forever: Customer satisfaction and beyond
Directory of Open Access Journals (Sweden)
Myuers James
2004-01-01
Full Text Available "King Customer!" So proclaimed the front cover of Business Week in a 1989 issue. At about the same time, "Rediscovering the Customer" was the title of a series of company vignettes in Fortune magazine. And a Wall Street Journal article asked, "For Customers, More Than Lip Service?" Combined, these three prestigious business publications reflected a new era in business firms perceptions of their customers and the role they should play in the formulation of company strategies and priorities. Had the "Era of the Customer" finally arrived in American business? .
Distinct characteristics of NPP HRD and establishment of KINGS in Korea
International Nuclear Information System (INIS)
Namgung, Ihn
2013-01-01
Full text:Korean government set-up nuclear energy department within the ministry of education in 1956 and joined IAEA in 1957 and set up nuclear energy agency in 1959, and installed the first research reactor in 1962. The Korean Government started constructing NPP in 1971 that had started commercial operation in 1978. The first oil shock in 1973 had devastated Korean economy and that made Korean Government to accelerate the construction of NPPs. Since then Korea steadily constructed NPP as well as invested in the development of indigenized NPP technology. During 1990s, Korea developed KSNP PWR 600 MWe NPP and in the last decade Korea developed APR1400 MWe NPP. Through the time, the engineers and operators involved in every field of nuclear industry is getting old and started to retire. Someone freshly out from the university with bachelor or post graduate degree will take many years to be able to understand how things running and operating in nuclear industry. Even in many years of job assignment, one cannot experience and understand all aspect of nuclear industry. It is this reason to establish a special educational system to teach people already in the field and to be able to see the whole picture by systematically teaching most of the related subject. In order to prevent any influence from existing university system, it was determined to establish KINGS (KEPCO International Nuclear Graduate School) as separate and independent institution and as a post-graduate institution. The curriculum of KINGS was set up along this philosophy, and has only one academic department, for example NPP Engineering Department, to make more interactions among faculty and students. Also the curriculum is set up to teach practical experience; hence the graduates can bridge between industry and academia as well as fill in the large gap of technical experience of older generation. Also another aim is to make KINGS international institution to share experience of Korean NPP development
2010-02-23
... Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02-99 Reciprocating Engines Installed in, But Not Limited...-99 engines, initial and repetitive replacements of the PPRV, and installation of a vibration isolator..., we estimate that this proposed AD would affect about 300 TAE 125-01 and TAE 125-02-99 reciprocating...
Jensen, Pamela C.; Purcell, Maureen K.; Morado, J. Frank; Eckert, Ginny L.
2012-01-01
The Alaskan red king crab (Paralithodes camtschaticus) fishery was once one of the most economically important single-species fisheries in the world, but is currently depressed. This fishery would benefit from improved stock assessment capabilities. Larval crab distribution is patchy temporally and spatially, requiring extensive sampling efforts to locate and track larval dispersal. Large-scale plankton surveys are generally cost prohibitive because of the effort required for collection and the time and taxonomic expertise required to sort samples to identify plankton individually via light microscopy. Here, we report the development of primers and a dual-labeled probe for use in a DNA-based real-time polymerase chain reaction assay targeting the red king crab, mitochondrial gene cytochrome oxidase I for the detection of red king crab larvae DNA in plankton samples. The assay allows identification of plankton samples containing crab larvae DNA and provides an estimate of DNA copy number present in a sample without sorting the plankton sample visually. The assay was tested on DNA extracted from whole red king crab larvae and plankton samples seeded with whole larvae, and it detected DNA copies equivalent to 1/10,000th of a larva and 1 crab larva/5mL sieved plankton, respectively. The real-time polymerase chain reaction assay can be used to screen plankton samples for larvae in a fraction of the time required for traditional microscopial methods, which offers advantages for stock assessment methodologies for red king crab as well as a rapid and reliable method to assess abundance of red king crab larvae as needed to improve the understanding of life history and population processes, including larval population dynamics.
Directory of Open Access Journals (Sweden)
Jun-Im Song
2012-04-01
Full Text Available Some gorgonians in the families, Primnoidae and Isididae within the suborder Calcaxonia were collected from subtidal zones between depths of 10 and 45 m in the coastal regions of King Sejong Station (62??13′S, 058?? 47′W, Korea Polar Research Institute of Korea Ocean Research and Development Institute (KORDI by SCUBA diving from 2009 to 2011. Three species in the Primnoidae, Arntzia gracilis (Molander, 1929, Thouarella (Thouarella antarctica (Valenciennes, 1846 and Onogorgia nodosa (Molander, 1929, and also one species in the family Isididae, Tenuisis microspiculata (Molander, 1929 are newly recorded to octocorallian fauna in Marian Cove and Potter Cove of King George Island. These four species have been described in detail.
Directory of Open Access Journals (Sweden)
A. A. Kurteva
2016-08-01
Full Text Available Beta-decay of the nucleus 125I and spectroscopic characteristics of the daughter nucleus are described within the framework of the dynamic collective model. Quasiparticle and multiphonon states, as well as vacuum fluctuations of quasiparticles are taken into account. The comparison of the results of calculations with the available experimental data is performed.
One Voice Too Many: Echoes of Irony and Trauma in Oedipus the King
Directory of Open Access Journals (Sweden)
Joshua Waggoner
2017-11-01
Full Text Available Sophocles’ Oedipus the King has often inspired concurrent interpretations examining the tragic irony of the play and the traumatic neurosis of its protagonist. The Theban king epitomizes a man who knows everything but himself, and Sophocles’ use of irony allows Oedipus to discover the truth in a manner that Freud viewed in The Interpretation of Dreams as “comparable to the work of a psychoanalysis.” Psychoanalytical readings of Oedipus at times depend greatly on his role as a doubled figure, but this article specifically investigates his doubled voice in order to demonstrate the interrelated, chiasmic relationship between Oedipus’ trauma and the trope of irony. It argues, in fact, that irony serves as the language, so to speak, of the traumatic experiences haunting the king and his city, but it also posits that this doubled voice compounds the irony of the play and its hero. In other words, in addition to the Sophoclean irony that dominates the work, the doubling of the king’s voice reveals a modified form of Socratic irony that contributes to the tragedy’s power. Consequently, even after the king’s recognition of the truth ultimately resolves the work’s tragic irony, Oedipus remains divided by a state of simultaneous knowledge and ignorance.
Effects of a Mathematics Cognitive Acceleration Program on Student Achievement and Motivation
Finau, Teukava; Treagust, David F.; Won, Mihye; Chandrasegaran, A. L.
2018-01-01
This paper presents the effects of a cognitive acceleration program in mathematics classes on Tongan students' achievements, motivation and self-regulation. Cognitive Acceleration in Mathematics Education (CAME) is a program developed at King's College and implemented worldwide with the aim of improving students' thinking skills, mathematics…
Directory of Open Access Journals (Sweden)
Jan Muis
2008-01-01
Full Text Available This article discusses whether the metaphor of “king” can still be used in Christian God-talk. Firstly, it is argued that the “king” metaphor for God is an indispensable key metaphor in both the Old and the New Testament. “King” has become a root metaphor in the canonical text of the Old Testament and Jesus’ proclamation of the coming kingdom of God presupposes that God is king. Secondly, the Biblical meanings of the metaphor are explored. God’s kingship implies his authority and power to fight the forces of evil, to liberate and lead his people and to control the events of history. Modified by Jesus Christ, God’s kingship is universal, non-violent and in accordance with his love. Then, the use of the metaphor in contemporary God-talk is considered. Because “king” is the only metaphor that can give expression to God’s ultimate highness and authority, it cannot be replaced by others. In the concluding section the “king” metaphor for God is conceptually explained in terms of the relationship, the agency and the power of God it implies.
How accurately can we estimate energetic costs in a marine top predator, the king penguin?
Halsey, Lewis G; Fahlman, Andreas; Handrich, Yves; Schmidt, Alexander; Woakes, Anthony J; Butler, Patrick J
2007-01-01
King penguins (Aptenodytes patagonicus) are one of the greatest consumers of marine resources. However, while their influence on the marine ecosystem is likely to be significant, only an accurate knowledge of their energy demands will indicate their true food requirements. Energy consumption has been estimated for many marine species using the heart rate-rate of oxygen consumption (f(H) - V(O2)) technique, and the technique has been applied successfully to answer eco-physiological questions. However, previous studies on the energetics of king penguins, based on developing or applying this technique, have raised a number of issues about the degree of validity of the technique for this species. These include the predictive validity of the present f(H) - V(O2) equations across different seasons and individuals and during different modes of locomotion. In many cases, these issues also apply to other species for which the f(H) - V(O2) technique has been applied. In the present study, the accuracy of three prediction equations for king penguins was investigated based on validity studies and on estimates of V(O2) from published, field f(H) data. The major conclusions from the present study are: (1) in contrast to that for walking, the f(H) - V(O2) relationship for swimming king penguins is not affected by body mass; (2) prediction equation (1), log(V(O2) = -0.279 + 1.24log(f(H) + 0.0237t - 0.0157log(f(H)t, derived in a previous study, is the most suitable equation presently available for estimating V(O2) in king penguins for all locomotory and nutritional states. A number of possible problems associated with producing an f(H) - V(O2) relationship are discussed in the present study. Finally, a statistical method to include easy-to-measure morphometric characteristics, which may improve the accuracy of f(H) - V(O2) prediction equations, is explained.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewalls. 125.143 Section 125.143....143 Firewalls. Each engine, auxiliary power unit, fuel-burning heater, or other item of combusting... of firewalls or shrouds, or by other equivalent means. ...
On generation of high power x-rays in the range 7-20 keV
International Nuclear Information System (INIS)
Ratakhin, N.A.
1997-01-01
An attempt is made on the base of general relations to evaluate possibility of two approaches to the problem of receiving powerful x-radiation id spectral range of (7-20) keV. Extremely cut possibilities of electron beams of vacuum diodes and Z-pinch plasma thermal radiation are shown. Some perspectives of increasing such radiation power in connection with possibility of generation of high-energy electrons in Z-pinch plasma are noted
Modeling the marine resources consumed in raising a king penguin chick: an energetics approach.
Halsey, L G; Butler, P J; Fahlman, A; Bost, C-A; Woakes, A J; Handrich, Y
2008-01-01
Accurate estimates of penguin energetics would represent an important contribution to our understanding of the trophodynamics of the Southern Ocean ecosystem and our ability to predict effects of environmental change on these species. We used the heart rate-rate of oxygen consumption technique to estimate rate of energy expenditure in adult king penguins raising a chick, in combination with data from the literature on changes in adult mass, chick energy requirements, and prey energy density. Our model estimated a variety of energetic costs and quantities of prey consumption related to raising a king penguin chick during the austral summer. The total energy requirements of a king penguin chick at the Crozet Archipelago from hatching until reaching a mass of 8 kg 90 d later is 271 MJ, representing the consumption of 38.4 kg of myctophid fish. A successfully breeding male requires 0.78 kg d(-1) of fish during the entirety of the incubation period and 1.14 kg d(-1) during the subsequent 90 d of chick rearing. Assuming the same energy requirements for females, the estimated 580,000 pairs of king penguins that breed successfully at Crozet each year, together with their chicks, consume a total of around 190,000 tons of fish during the incubation and summer rearing periods combined. If, due to depletion of fish stocks, the diet of breeders and chicks during the summer becomes identical to the typical diet of adults during the austral winter, the mass of prey required by both adults and chicks combined (where the chick still reaches 8 kg after 90 d) would increase by more than 25%.
Peters, Timothy
2015-04-01
Recent studies have shown that the claim that King George III suffered from acute porphyria is seriously at fault. This article explores some of the causes of this misdiagnosis and the consequences of the misleading claims, also reporting on the nature of the king's recurrent mental illness according to computer diagnostics. In addition, techniques of cognitive archaeology are used to investigate the nature of the king's final decade of mental illness, which resulted in the appointment of the Prince of Wales as Prince Regent. The results of this analysis confirm that the king suffered from bipolar disorder type I, with a final decade of dementia, due, in part, to the neurotoxicity of his recurrent episodes of acute mania. © 2015 Royal College of Physicians.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Gulf of Mexico, south from..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.720 Gulf of Mexico, south from Choctawhatchee Bay; guided missiles test operations area, Headquarters Air Proving...
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Aliens. 125.25 Section 125.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) WATERFRONT....25 Aliens. Alien registration records together with other papers and documents which indicated the...
AFSC/RACE/SAP/Cummiskey: Red king crab sonic tagging and dive database
National Oceanic and Atmospheric Administration, Department of Commerce — This is data from a long-term monitoring project which utilized sonic tags to follow aggregations of red king crab in Womens Bay near Kodiak Alaska. The database...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What definitions are important in... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION GOVERNMENT CONTRACTING PROGRAMS Definitions for the Service-Disabled Veteran-Owned Small Business Concern Program § 125.8 What definitions are...
Preparation of sup 125 I-creatine phosphokinase-MM
Energy Technology Data Exchange (ETDEWEB)
Jingxian, Su; Jingmin, Ma [Academia Sinica, Beijing, BJ (China). Inst. of Atomic Energy
1988-09-01
{sup 125}I-creatine phosphokinase-MM ({sup 125}I-CPK-MM) was prepared by {sup 125}I-labelled Bolton-Hunter reagent (HPNS). Iodinating conditions of HPNS and its conjugation to protein were studied. {sup 125}I-CPK-MM with immune activity was obtained and used to establish the {sup 125}I-CPK-MM radioimmunoassay method by the General Hospital of PLA. {sup 125}I-CPK-MM in PBS-G solution containing 0.015 mol/l ethyl mercaptan at 4-10 deg C can be used for one month.
Bochdansky, Alexander B; Clouse, Melissa A; Herndl, Gerhard J
2016-03-04
Particles are the major vector for the transfer of carbon from the upper ocean to the deep sea. However, little is known about their abundance, composition and role at depths greater than 2000 m. We present the first number-size spectrum of bathy- and abyssopelagic particles to a depth of 5500 m based on surveys performed with a custom-made holographic microscope. The particle spectrum was unusual in that particles of several millimetres in length were almost 100 times more abundant than expected from the number spectrum of smaller particles, thereby meeting the definition of "dragon kings." Marine snow particles overwhelmingly contributed to the total particle volume (95-98%). Approximately 1/3 of the particles in the dragon-king size domain contained large amounts of transparent exopolymers with little ballast, which likely either make them neutrally buoyant or cause them to sink slowly. Dragon-king particles thus provide large volumes of unique microenvironments that may help to explain discrepancies in deep-sea biogeochemical budgets.
Directory of Open Access Journals (Sweden)
Ryan M Fryer
Full Text Available Sphingosine-1-phospate (S1P and S1P receptor agonists elicit mechanism-based effects on cardiovascular function in vivo. Indeed, FTY720 (non-selective S1P(X receptor agonist produces modest hypertension in patients (2-3 mmHg in 1-yr trial as well as acute bradycardia independent of changes in blood pressure. However, the precise receptor subtypes responsible is controversial, likely dependent upon the cardiovascular response in question (e.g. bradycardia, hypertension, and perhaps even species-dependent since functional differences in rodent, rabbit, and human have been suggested. Thus, we characterized the S1P receptor subtype specificity for each compound in vitro and, in vivo, the cardiovascular effects of FTY720 and the more selective S1P₁,₅ agonist, BAF312, were tested during acute i.v. infusion in anesthetized rats and after oral administration for 10 days in telemetry-instrumented conscious rats. Acute i.v. infusion of FTY720 (0.1, 0.3, 1.0 mg/kg/20 min or BAF312 (0.5, 1.5, 5.0 mg/kg/20 min elicited acute bradycardia in anesthetized rats demonstrating an S1P₁ mediated mechanism-of-action. However, while FTY720 (0.5, 1.5, 5.0 mg/kg/d elicited dose-dependent hypertension after multiple days of oral administration in rat at clinically relevant plasma concentrations (24-hr mean blood pressure = 8.4, 12.8, 16.2 mmHg above baseline vs. 3 mmHg in vehicle controls, BAF312 (0.3, 3.0, 30.0 mg/kg/d had no significant effect on blood pressure at any dose tested suggesting that hypertension produced by FTY720 is mediated S1P₃ receptors. In summary, in vitro selectivity results in combination with studies performed in anesthetized and conscious rats administered two clinically tested S1P agonists, FTY720 or BAF312, suggest that S1P₁ receptors mediate bradycardia while hypertension is mediated by S1P₃ receptor activation.
Aspects of the biology of three benthic-feeding teleosts from King's ...
African Journals Online (AJOL)
Aspects of the biology of three benthic-feeding teleosts from King's Beach, Algoa Bay. Theresa A. Lasiak. Department of Zoology, University of Port Elizabeth, Port Elizabeth. The lengths, abundance pattems and feeding habits of three species of benthic·feeding teleosts, Lithognathus mormyrus,. Lithognathus lithognathus ...
AFSC/RACE/SAP/Swiney: Red king crab fecundity and embryo and larval quality
National Oceanic and Atmospheric Administration, Department of Commerce — Stock assessment of Alaskan red king crab, Paralithodes camtschaticus (Tilesius, 1815), can be improved by incorporating reproductive output, which requires an...
Directory of Open Access Journals (Sweden)
Apoorva Mahendera
2016-03-01
Full Text Available CONTEXT Previous studies suggest glottic view is better achieved with straight blades while tracheal intubation is easier with curved blades and videolaryngoscope is better than conventional laryngoscope. AIMS Comparison of conventional laryngoscope (Macintosh blade and Miller blade with channelled videolaryngoscope (King Vision TM with respect to laryngeal visualisation and difficulty in endotracheal intubation. SETTINGS AND DESIGN This prospective randomised comparative study was conducted at a tertiary care hospital (in ASA I and ASA II patients after approval from the Institutional Ethics Committee. METHODS We compared Macintosh, Miller, and the King VisionTM videolaryngoscope for glottic visualisation and ease of tracheal intubation. Patients undergoing elective surgeries under general anaesthesia requiring endotracheal intubation were randomly divided into three groups (N=180. After induction of anaesthesia, laryngoscopy was performed and trachea intubated. We recorded visualisation of glottis (Cormack-Lehane grade-CL, ease of intubation, number of attempts, need to change blade, and need for external laryngeal manipulation. STATISTICAL ANALYSIS Demographic data, Mandibular length, Mallampati classification were compared using ANOVA, Chi-square test, Kruskal-Wallis Test, where P value <0.005 is statically significant. RESULTS CL grade 1 was most often observed in King Vision -TM VL group (90% which is followed by Miller (28.33%, and Macintosh group (15%. We found intubation was to be easier (grade 1 with King Vision -TM VL group (73.33%, followed by Macintosh (38.33%, and Miller group (1.67%. External manipulation (BURP was needed more frequently in patients in Miller group (71.67%, followed by Macintosh (28.33% and in King Vision -TM VL group (6.67%. All (100% patients were intubated in the 1 st attempt with King Vision -TM VL group, followed by Macintosh group (90% and Miller group (58.33%. CONCLUSIONS In patients with normal airway
Just how literal is the King James Version?
Jan (JH) Kroeze; Manie (CM) van den Heever; Bertus (AJ) van Rooy
2010-01-01
Many scholars have the perception that the King James Version (KJV) is a literal translation. However, it is not so easy to define the concept of "literal translation". The simplest definition may be to regard it as word-for-word translation. However, when one compares the KJV carefully with the original Hebrew Bible, there are numerous instances where lexical items are changed to adapt the idiom to that of the target language. In this article, a measuring instrument will be proposed and u...
Falandysz, Jerzy; Frankowska, Aneta; Jarzynska, Grazyna; Dryzałowska, Anna; Kojta, Anna K; Zhang, Dan
2011-01-01
This paper provides data on baseline concentrations, interrelationships and bioconcentration potential of 12 metallic elements by King Bolete collected from 11 spatially distant sites across Poland. There are significant differences in concentrations of metals (Al, Ba, Ca, Cd, Cu, Fe, K, Mg, Mn, Na, Sr, Zn) and their bioconcentration potential in King Bolete Boletus edulis at 11 spatially distant sites surveyed across Poland. These have resulted from significant geographical differences in trace metal concentrations in a layer (0-10 cm) of organic and mineral soil underneath to fruiting bodies and possible local bioavailabilities of macro- (Ca, K, Mg, Na) and trace metals (Al, Ba, Cd, Cu, Fe, Mn, Sr, Zn) to King Bolete. The use of highly appreciated wild-grown edible King Bolete mushroom has established a baseline measure of regional minerals status, heavy metals pollution and assessment of intake rates for wild mushroom dish fanciers against which future changes can be compared. Data on Cd, Cu and Zn from this study and from literature search can be useful to set the maximum limit of these metals in King Bolete collected from uncontaminated (background) areas. In this report also reviewed are data on Al, Ba, Ca, Cd, Cu, Fe, K, Mg, Mn, Na, Sr and Zn accumulation in King Bolete.
Shimada, Keisuke; Lo, Nathan; Kitade, Osamu; Wakui, Akane
2013-01-01
Among the best-known examples of mutualistic symbioses is that between lower termites and the cellulolytic flagellate protists in their hindguts. Although the symbiosis in worker termites has attracted much attention, there have been only a few studies of protists in other castes. We have performed the first examination of protist population dynamics in queens and kings during termite colony foundation. Protist numbers, as well as measurements of hindgut and reproductive tissue sizes, were undertaken at five time points over 400 days in incipient colonies of Reticulitermes speratus, as well as in other castes of mature colonies of this species. We found that protist numbers increased dramatically in both queens and kings during the first 50 days of colony foundation but began to decrease by day 100, eventually disappearing by day 400. Hindgut width followed a pattern similar to that of protist numbers, while ovary and testis widths increased significantly only at day 400. Kings were found to contain higher numbers of protists than queens in incipient colonies, which may be linked to higher levels of nutrient transfer from kings to queens than vice versa, as is known in some other termite species. Protists were found to be abundant in soldiers from mature colonies but absent in neotenics. This probably reflects feeding of soldiers by workers via proctodeal trophallaxis and of reproductives via stomodeal trophallaxis. The results reveal the dynamic nature of protist numbers during colony foundation and highlight the trade-offs that exist between reproduction and parental care during this critical phase of the termite life cycle. PMID:23376945
2010-07-01
... environment means that territorial seas, the contiguous zone and the oceans. (c) Mixing zone means the zone... of the pollutants. (e) Unreasonable degradation of the marine environment means: (1) Significant... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 125.121 Section 125.121...
40 CFR 421.125 - Pretreatment standards for existing sources.
2010-07-01
... pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of silver from film.../troy ounce of silver from precipitation and filtration of film stripping solutions Copper 1.242 .592... mg/troy ounce of silver precipitated Copper 73.690 35.120 Zinc 58.720 24.180 Ammonia (as N) 7,674.000...
Riflessioni su diritto e religione a margine del Martin Luther King Day
Directory of Open Access Journals (Sweden)
Giancarlo Anello
2018-04-01
ABSTRACT: April 4, 2018 commemorates the fiftieth anniversary of the death of Martin Luther King jr., in Memphis-Tennessee. The importance of Martin Luther King’s personality goes far beyond the borders of United States and spreads on the global scale. The present paper concerns the universality and the present impact of Martin Luther King’s legacy, considering also the European context. The paper analyses in brief the history of Martin Luther King, taking into account both his activism in the US and his international criticism against global issues such as post-colonialism and third-worldism; a second part is dedicated to the so called religious “global left” of the 50s and 70s. Conclusions show how and why the global religions have still to be considered a critical background for the rule of law, its inequalities and its injustices.
Tesco, Giuseppina; Ginestroni, Andrea; Hiltunen, Mikko; Kim, Minji; Dolios, Georgia; Hyman, Bradley T; Wang, Rong; Berezovska, Oksana; Tanzi, Rudolph E
2005-10-01
The 37-43 amino acid Abeta peptide is the principal component of beta-amyloid deposits in Alzheimer's disease (AD) brain, and is derived by serial proteolysis of the amyloid precursor protein (APP) by beta- and gamma-secretase. gamma-Secretase also cleaves APP at Val50 in the Abeta numbering (epsilon cleavage), resulting in the release of a fragment called APP intracellular domain (AICD). The aim of this study was to determine whether amino acid substitutions in the APP transmembrane domain differentially affect Abeta and AICD generation. We found that the APPV715F substitution, which has been previously shown to dramatically decrease Abeta40 and Abeta42 while increasing Abeta38 levels, does not affect in vitro generation of AICD. Furthermore, we found that the APPL720P substitution, which has been previously shown to prevent in vitro generation of AICD, completely prevents Abeta generation. Using a fluorescence resonance energy transfer (FRET) method, we next found that both the APPV715F and APPL720P substitutions significantly increase the distance between the N- and C-terminus of presenilin 1 (PS1), which has been proposed to contain the catalytic site of gamma-secretase. In conclusion, both APPV715F and APPL720P change PS1 conformation with differential effects on Abeta and AICD production.
Energy Technology Data Exchange (ETDEWEB)
Godcharles, M.F.; Murphy, M.D.
1986-06-01
This Species Profile on king and Spanish mackerel summarizes the taxonomy, morphology, distribution, life history, fishery descriptions, ecological role, and environmental requirements of these coastal pelagic fish to assist environmental impact assessment. King and Spanish mackerel support major commercial and sport fisheries in south Florida. In 1974 to 1983, Gulf of Mexico and Atlantic commercial landings of king mackerel declined from 10.4 to 4.3 million lb.; Spanish mackerel have fluctuated between 4.9 to 17.4 million lb. Both inhabit coastal waters, but Spanish mackerel are generally found closer to beaches and in outer estuarine waters. Both species feed principally on estuarine-dependent species. They are highly migratory, exhibiting seasonal migrations to winter feeding grounds off south Florida and summer spawning/feeding grounds in the northern Gulf of Mexico and off the Atlantic coast of the Southeastern US. Spawning occurs from March/April through September/October between the middle and Outer Continental Shelf (35 to 183 mi) for king mackerel and the inner shelf (12 to 34 mi) for Spanish mackerel. King mackerel reach sexual maturity in their 3rd and 4th years and Spanish, between their 2nd and 3rd. Female king mackerel live longer and grow larger and faster than males. Spanish mackerel live to 8 years; females also grow faster than males. King and Spanish mackerel feed principally on schooling fishes. Larvae and juveniles of both species are prey to little tunny and dolphin; adults are prey for sharks and bottlenose dolphin. Temperature and salinity are important factors regulating mackerel distribution.
"The Lion King" and "Hamlet": A Homecoming for the Exiled Child.
Gavin, Rosemarie
1996-01-01
Explains how the movie "The Lion King" may be used to elucidate Shakespeare's "Hamlet," a play about a prince who does not always seem heroic to modern audiences. Gives specific points of comparison between the two works concerning heroes, characters, conflicts, themes, ending scenes, and archetypal patterns. (TB)
Red king crab’s bycatch in demersal fishing in the South-Eeastern part of the Barents Sea
Directory of Open Access Journals (Sweden)
Stes Aleksej Vladimirovich
2016-03-01
Full Text Available In the paper, the data of the red king crab by-catch in demersal fishing in the South-Eastern part of the Barents Sea, including those in the areas forbidden to trawling are presented. The impact of the catch of demersal fish on the distribution of the king crab is analyzed. It was shown that intensive fishing contributes to the growth of crabs’ density, possibly, they are attracted by the wastes of fish factories.
27 CFR 21.125 - Rubber hydrocarbon solvent.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Rubber hydrocarbon solvent. 21.125 Section 21.125 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU....125 Rubber hydrocarbon solvent. (a) Rubber hydrocarbon solvent is a petroleum derivative. (b...
Fragmentation of chromatin with 125I radioactive disintegrations
International Nuclear Information System (INIS)
Turner, G.N.; Nobis, P.; Dewey, W.C.
1976-01-01
The DNA in Chinese hamster cells was labeled first for 3 h with [ 3 H]TdR and then for 3 h with [ 125 I]UdR. Chromatin was extracted, frozen, and stored at -30 0 C until 1.0 x 10 17 and 1.25 x 10 17 disintegrations/g of labeled DNA occurred for 125 I and 3 H, respectively. Velocity sedimentation of chromatin (DNA with associated chromosomal proteins) in neutral sucrose gradients indicated that the localized energy from the 125 I disintegrations, which gave about 1 double-strand break/disintegration plus an additional 1.3 single strand breaks, selectively fragmented the [ 125 I] chromatin into pieces smaller than the [ 3 H] chromatin. In other words, 125 I disintegrations caused much more localized damage in the chromatin labeled with 125 I than in the chromatin labeled with 3 H, and fragments induced in DNA by 125 I disintegrations were not held together by the associated chromosomal proteins. Use of this 125 I technique for studying chromosomal proteins associated with different regions in the cellular DNA is discussed. For these studies, the number of disintegrations required for fragmenting DNA molecules of different sizes is illustrated
Directory of Open Access Journals (Sweden)
S. R. Verkulich
2013-01-01
Full Text Available The interstadial marine deposits stratum was described in the Fildes Peninsula (King George Island due to field and laboratory investigations during 2008–2011. The stratum fragments occur in the west and north-west parts of peninsula in following forms: sections of soft sediments, containing fossil shells, marine algae, bones of marine animals and rich marine diatom complexes in situ (11 sites; fragments of shells and bones on the surface (25 sites. According to the results of radiocarbon dating, these deposits were accumulated within the period 19–50 ky BP. Geographical and altitude settings of the sites, age characteristics, taxonomy of fossil flora and fauna, and good safety of the soft deposits stratum allow to make following conclusions: during interstadial, sea water covered significant part of King George Island up to the present altitude of 40 m a.s.l., and the King George Island glaciation had smaller size then; environmental conditions for the interstadial deposit stratum accumulation were at least not colder than today; probably, the King George island territory was covered entirely by ice masses of Last glacial maximum not earlier than 19 ky BP; during Last glacial maximum, King George Island was covered by thin, «cold», not mobile glaciers, which contribute to conservation of the soft marine interstadial deposits filled with fossil flora and fauna.
7 CFR 1221.125 - Books and records.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1221.125 Section 1221.125... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Reports, Books, and Records § 1221.125 Books and records. (a) Each first handler, producer, or importer subject to this subpart shall maintain...
23 CFR 635.125 - Termination of contract.
2010-04-01
... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.125 Termination of contract. (a) All contracts exceeding... 23 Highways 1 2010-04-01 2010-04-01 false Termination of contract. 635.125 Section 635.125... the termination will be effected and the basis for settlement. In addition, such contracts shall...
The Poukai ceremony of the Maori King Movement: An ethnohistorical interpretation
Meijl, A.H.M. van
2009-01-01
The poukai is a ceremonial gathering held on 28 days a year at different Marae [1] or ceremonial centres supporting the K ngitanga, or Maori King Movement, which is largely based within the Tainui confederation of tribes in the Waikato region of New Zealand's North Island. The K ngitanga was
Wole Soyinka's A Play of Giants and King Baabu : The crises ...
African Journals Online (AJOL)
This paper, using Soyinka's A Play of Giants and King Baabu, re-examines the centrality of ideology to texts of social engagement in the postcolonial space. Within the context of the humanistic values that the playwright esteems, this essay scrutinizes the social conditions in the plays and the dramatist's “vision.
77 FR 38005 - Safety Zone; Independence Day Fireworks, Kings Beach, CA
2012-06-26
... Zone; Independence Day Fireworks, Kings Beach, CA AGENCY: Coast Guard, DHS. ACTION: Notice of... Independence Day Fireworks display from 7 a.m. until 10 p.m. on July 3, 2012. This action is necessary to protect life and property of the maritime public from the hazards associated with the fireworks display...
Mock iodine-125 radiation source
International Nuclear Information System (INIS)
Coffey, D.L.
1976-01-01
An intimate mixture of americium-241 and iodine-129 provides an energy spectrum that reliably simulates the spectrum of iodine-125 in a well-type detector. As such, it may be used as a long-lived standard to calibrate instruments such as well scintillation spectrometers in which measurements are to be made involving iodine-125
Wang, Dan; Liu, Chenxi; Zhang, Zinan; Ye, Liping; Zhang, Xinping
2018-03-27
With the impressive advantages of patient-pharmacist communication being advocated and poor pharmacist-patient communication in different settings, it is of great significance and urgency to explore the mechanism of the pharmacist-patient communicative relationship. The King's theory of goal attainment is proposed as one of the most promising models to be applied, because it takes into consideration both improving the patient-pharmacist relationship and attaining patients' health outcomes. This study aimed to validate the King's transaction process and build the linkage between the transaction process and patient satisfaction in a pharmaceutical context. A cross-sectional study was conducted in four tertiary hospitals in two provincial cities (Wuhan and Shanghai) in central and east China in July 2017. Patients over 18 were investigated in the pharmacies of the hospitals. The instrument for the transaction process was revised and tested. Path analysis was conducted for the King's transaction process and its relationship with patient satisfaction. Five hundred eighty-nine participants were investigated for main study. Prior to the addition of covariates, the hypothesised model of the King's transaction process was validated, in which all paths of the transaction process were statistically significant (p process had direct effects on patient satisfaction (p process was established as one valid theoretical framework of healthcare provider-patient communication in a pharmaceutical context. Copyright © 2018 Elsevier Inc. All rights reserved.
AFSC/RACE/SAP/Long: Effects of ocean acidification on blue king crab
National Oceanic and Atmospheric Administration, Department of Commerce — This is data from a laboratory experiment in which blue king crab juveniles were held at three different pHs (ambient, pH 7.8, and pH 7.5) for a year. Growth,...
Czech Academy of Sciences Publication Activity Database
Sedláček, O.; Mikeš, M.; Albrecht, Tomáš; Reif, J.; Hořák, D.
2014-01-01
Roč. 7, č. 4 (2014), s. 720-732 ISSN 1940-0829 R&D Projects: GA ČR(CZ) GAP505/11/1617 Institutional support: RVO:68081766 Keywords : Artificial nest s * Zebra finch eggs * Montane forest * Endemic species * Cameroon Mountains Subject RIV: EG - Zoology Impact factor: 1.125, year: 2014 http://tropicalconservationscience.mongabay.com/content/v7/TCS-2014-Vol7(4)_720-732_%20Ondrej.pdf
Kawaii, S; Tomono, Y; Katase, E; Ogawa, K; Nonomura-Nakano, M; Nesumi, H; Yoshida, T; Sugiura, M; Yano, M
2001-08-01
Twenty-four Citrus hybrids of King (C. nobilis) and Mukaku Kishu (C. kinokuni) were examined for their flavonoid profiles of the edible part by reversed-phase HPLC analysis. Two hybrids (G-155 and G-156) contained higher amounts of natsudaidain than their parents, whereas the remainder of the hybrids had a character intermediate between those of King and Mukaku Kishu on the basis of polymethoxylated flavone composition. Principal component analysis revealed the distribution of the hybrids by quantifying 23 flavonoid contents.
2004-01-01
This image from the Mars Exploration Rover Opportunity's panoramic camera shows one octant of a larger panoramic image which has not yet been fully processed. The full panorama, dubbed 'Lion King' was obtained on sols 58 and 60 of the mission as the rover was perched at the lip of Eagle Crater, majestically looking down into its former home. It is the largest panorama yet obtained by either rover. The octant, which faces directly into the crater, shows features as small as a few millimeters across in the field near the rover arm, to features a few meters across or larger on the horizon. The full panoramic image was taken in eight segments using six filters per segment, for a total of 558 images and more than 75 megabytes of data. This enhanced color composite was assembled from the infrared (750 nanometer), green (530 nanometer), and violet (430 nanometer) filters. Additional lower elevation tiers were added relative to other panoramas to ensure that the entire crater was covered in the mosaic.
Radioactive waste handling and disposal at King Faisal Specialist Hospital and Research Centre.
Al-Haj, Abdalla N; Lobriguito, Aida M; Al Anazi, Ibrahim
2012-08-01
King Faisal Specialist Hospital & Research Centre (KFSHRC) is the largest specialized medical center in Saudi Arabia. It performs highly specialized diagnostic imaging procedures with the use of various radionuclides required by sophisticated dual imaging systems. As a leading institution in cancer research, KFSHRC uses both long-lived and short-lived radionuclides. KFSHRC established the first cyclotron facility in the Middle East, which solved the in-house high demand for radionuclides and the difficulty in importing them. As both user and producer of high standard radiopharmaceuticals, KFSHRC generates large volumes of low and high level radioactive wastes. An old and small radioactive facility that was used for storage of radioactive waste was replaced with a bigger warehouse provided with facilities that will reduce radiation exposure of the staff, members of the public, and of the environment in the framework of "as low as reasonably achievable." The experiences and the effectiveness of the radiation protection program on handling and storage of radioactive wastes are presented.
King Lear Reveals the Tragic Pattern of Shakespeare
Directory of Open Access Journals (Sweden)
Salim Eflih Al-Ibia
2017-04-01
Full Text Available Rather than focusing on the obvious traditions of evaluating Shakespearean tragic heroes, this paper presents a groundbreaking approach to unfold the pattern William Shakespeare follows as he designed his unique characters. This pattern applies to most, if not all, Shakespearean tragic heroes. I argue that Shakespeare himself reveals a great portion of this pattern on the tongue of Lear as the latter disowns Goneril and Regan promising to have “such revenges on [them] both” in King Lear. Lear’s threats bestow four unique aspects that apply not only to his character but they also apply to Shakespearean tragic heroes. Lear’s speech tells us that he is determined to have an awful type of revenge on his daughters. However, the very same speech tells us that he seems uncertain about the method through which he should carry out this revenge. Lear does not express any type of remorse as he pursues his vengeful plans nor should he aim at amnesty. He also admits his own madness as he closes his revealing speech. This research develops these facts about Lear to unfold the unique pattern Shakespeare follows as he portrayed his major tragic figures. This pattern is examined, described and analyzed in King Lear, Othello, and Hamlet. We will find out that the pattern suggested in this study helps us better understand Shakespeare’s tragedies and enables us to provide better explanations for some controversial scenes in the tragedies discussed.
Directory of Open Access Journals (Sweden)
Iliana Maria de Almeida Araújo
2005-12-01
Full Text Available Objetivou-se refletir sobre o modelo conceitual de King, segundo a abordagem do Interacionismo Simbólico, dentro do modelo de análises de teoria de Meleis. Para alcançar o objetivo, realizamos uma leitura dos três modelos citados nos trabalho, buscando as congruências e discrepâncias entre os conceitos e correlacionando-os. O estudo permitiu concluir que as teorias concordam ao elucidar o homem como um ser que reage e busca compreender o significado das coisas ao seu redor, planejando e julgando suas ações e a dos outros. É importante a questão dos significados poderem ser modificados e gerarem a elaboração de metas em comum.Se apuntó a reflectir acerca del modelo conceptual de King, según el acercamiento de Interacionismo Simbólico, dentro del modelo de análisis de la teoría de Meleis. Para alcanzar el objetivo, nosotros logramos una lectura de los tres modelos mencionada en el trabajo, mientras buscando las consistencias y diferencias entre los conceptos y poniéndolos en correlación. El estudio permitió concluir que las teorías están de acuerdo al elucidar al hombre como un ser que reacciona e investiga para entender el significado de las cosas en suyo circuito, mientras flotando y juzgando sus acciones y el uno de los otros. Es importante el asunto de los significados podría modificarse y ellos generan la elaboración de metas en común.It was aimed to reflect on King's Theory, according to the approach of Symbolic Interaccionism, and theory analyses model of Meleis. To reach the objective, we proceeded the reading of the three models as mentioned before, looking for the consistencies and discrepancies among the concepts and correlating them. The study allowed to conclude that the theories agree when elucidating the man as a being that reacts and search to understand the meaning of things to his/her circuit, drifting and judging their actions and the one of the other ones. It is important the subject of the meanings
Kehie, Mechuselie; Kumaria, Suman; Devi, Khumuckcham Sangeeta; Tandon, Pramod
2016-02-01
Sequences of the Internal Transcribed Spacer (ITS1-5.8S-ITS2) of nuclear ribosomal DNAs were explored to study the genetic diversity and molecular evolution of Naga King Chili. Our study indicated the occurrence of nucleotide polymorphism and haplotypic diversity in the ITS regions. The present study demonstrated that the variability of ITS1 with respect to nucleotide diversity and sequence polymorphism exceeded that of ITS2. Sequence analysis of 5.8S gene revealed a much conserved region in all the accessions of Naga King Chili. However, strong phylogenetic information of this species is the distinct 13 bp deletion in the 5.8S gene which discriminated Naga King Chili from the rest of the Capsicum sp. Neutrality test results implied a neutral variation, and population seems to be evolving at drift-mutation equilibrium and free from directed selection pressure. Furthermore, mismatch analysis showed multimodal curve indicating a demographic equilibrium. Phylogenetic relationships revealed by Median Joining Network (MJN) analysis denoted a clear discrimination of Naga King Chili from its closest sister species (Capsicum chinense and Capsicum frutescens). The absence of star-like network of haplotypes suggested an ancient population expansion of this chili.
Aerosols in King George Island (Antarctic peninsula) using PIXE and alpha spectrometry
International Nuclear Information System (INIS)
Dias da Cunha, K.; Medeiros, G.; Leal, M.A.; Lima, C.; Dalia, K.C.
2009-01-01
The aim of this study was to characterize the airborne particles and particles deposited in the recent snow samples collected at King George Island (Admiralty Bay) in order to evaluate the possible local sources of airborne particles and the aerosol transport from South America to Antarctic at sea level. Airborne particles samples were collected using a cascade impactor and cyclones at several sampling points at Admiralty Bay. Airborne particles were also collected during the ship travel from Rio de Janeiro to Antarctica. The recent snow samples and aerosols collected at several sampling points at Admiralty Bay were analyzed by PIXE for the determination of the elemental mass concentration. Snow samples were analyzed by alpha spectrometry to determine the 232Th, 228Th, 238U and 234U concentrations in snow. The Mass Median Aerodynamic Diameter of airborne particles was determined. The results suggest that there is a correlation between the aerosol samples and the particles deposited in the snow, but the elemental mass distributions are not equal. The snow elemental concentration can be used as an indicator of the elements present in the aerosols. The local aerosol sources (natural and anthropogenic) have been considered to characterize the aerosol transport to Antarctic, mainly King George Island. The main aerosol sources are the marine spray, weathering of local rocks and anthropogenic sources, as the diesel burning in the island. Besides the local aerosol sources the transport of airborne particles from south Atlantic to Antarctic is an important source of airborne particles at King George Island. (author)
21 CFR 131.125 - Nonfat dry milk.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Nonfat dry milk. 131.125 Section 131.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.125 Nonfat dry milk. (a...
29 CFR 102.125 - Action on petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...
14 CFR 125.7 - Display of certificate.
2010-01-01
... OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT General § 125.7 Display of certificate. (a) The certificate holder must display a true copy of the certificate in each of its aircraft. (b... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Display of certificate. 125.7 Section 125.7...
Cartwright, Richard A.
2002-01-01
Ground-water withdrawals from the aquifers underlying Kings and Queens Counties varied temporally and spatially during the 20th century and caused extreme changes in water levels. The resultant lowering of water levels during periods of heavy pumping caused saltwater intrusion in nearshore areas and the migration of contaminants from land surface into deep aquifers. The recovery of water levels in response to countywide curtailment of pumping has resulted in the flooding of underground structures. Combined withdrawals for public and industrial supply in Kings and Queens Counties were greatest during the 1930's--about 130 million gallons per day. During this period, a large cone of depression developed in the water table in Kings County; within this depression, water levels were about 45 feet lower than in 1903. All pumping for public supply was halted in Kings County in 1947, and in Jamaica (in Queens County) in 1974. Water levels in Kings County had recovered by 1974 and have remained similar to those of 1903 since then, except for minor localized drawdowns due to industrial-supply or dewatering withdrawals. A large cone of depression that had formed in southeastern Queens County before 1974 has now (1997) disappeared. The estimated combined withdrawal for public supply and industrial supply in Kings and Queens Counties in 1996 was only about 50 million gallons per day.The water-level recoveries in the water-table and confined aquifers generally have resulted in the dilution and dispersion of residual salty and nitrate-contaminated ground water. The majority of recently sampled wells indicate stable or decreasing chloride and nitrate concentrations in all aquifers since 1983. Organic contaminants remain in ground water in Kings, Queens, and Nassau Counties, however; the most commonly detected compounds in 1992-96 were tetrachloroethene, trichloroethene, chloroform, and total trihalomethanes. Water samples from monitoring wells in Kings County indicate a greater
Directory of Open Access Journals (Sweden)
Inés Calderón Medina
2017-09-01
Full Text Available The birth of the frontier between Galicia and Portugal was an arduous process. The control over this area relied, to a great extent, on the success of the kings of Leon and Portugal in assuring the local nobles’ loyalty and service. The role played by the local nobility in the creation and military defense of this border can be analysed throughout chronicles and diplomas. These sources cast light on the nobility’s key military role in southern Galicia and the political consequences derived from these nobles’ loyalty or infidelity. The kings of Portugal and Leon actively seek the local nobility’s support; however they also relied on royal marriages in order to solve border conflicts. In that regard, disputed landholdings and castles were given to the Portuguese monarchs as part of the Leonese queens’ dowry. Some nobles were chosen as executors of these marriages agreements, so they acted as intermediaries between both kings.
14 CFR 125.127 - Location of fuel tanks.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Location of fuel tanks. 125.127 Section 125... Requirements § 125.127 Location of fuel tanks. (a) Fuel tanks must be located in accordance with § 125.153. (b... compartment may be used as the wall of an integral tank. (c) Fuel tanks must be isolated from personnel...
International Nuclear Information System (INIS)
Yamato, H.; Matsumoto, T.; Fukumoto, S.; Ikeda, K.; Ishizuka, S.; Ogata, E.
1989-01-01
Previous studies revealed that administration of 24,25-dihydroxyvitamin D3 [24,25-(OH)2D3] to calcium (Ca)-deficient rats causes a dose-dependent reduction in markedly elevated serum 1,25-(OH)2D3 level. Although the results suggested that the metabolism of 1,25-(OH)2D3 was accelerated by 24,25-(OH)2D3, those experiments could not define whether the enhanced metabolism of 1,25-(OH)2D3 played a role in the reduction in the serum 1,25-(OH)2D3 level. In the present study, in order to address this issue more specifically, serum 1,25-(OH)2D3 was maintained solely by exogenous administration through miniosmotic pumps of 1,25-(OH)2D3 into vitamin D-deficient rats. Thus, by measuring the serum 1,25-(OH)2D3 concentration, the effect of 24,25-(OH)2D3 on the MCR of 1,25-(OH)2D3 could be examined. Administration of 24,25-(OH)2D3 caused a dose-dependent enhancement in the MCR of 1,25-(OH)2D3, and 1 microgram/100 g rat.day 24,25-(OH)2D3, which elevated serum 24,25-(OH)2D3 to 8.6 +/- 1.3 ng/ml, significantly increased MCR and suppressed serum levels of 1,25-(OH)2D3. The effect of 24,25-(OH)2D3 on 1,25-(OH)2D3 metabolism developed with a rapid time course, and the recovery of iv injected [1 beta-3H]1,25-(OH)2D3 in blood was significantly reduced within 1 h. In addition, there was an increase in radioactivity in the water-soluble fraction of serum as well as in urine, suggesting that 1,25-(OH)2D3 is rapidly degraded to a water-soluble metabolite(s). Furthermore, the reduction in serum 1,25-(OH)2D3 was associated with a reduction in both serum and urinary Ca levels. Because the conversion of [3H]24,25-(OH)2D3 to [3H]1,24,25-(OH)2D3 or other metabolites was minimal in these rats, 24,25-(OH)2D3 appears to act without being converted into other metabolites. These results demonstrate that 24,25-(OH)2D3 rapidly stimulates the metabolism of 1,25-(OH)2D3 and reduces its serum level
Directory of Open Access Journals (Sweden)
Porzio, Laura
2012-06-01
Full Text Available This article focuses on the biographical account of King Manaba, who for many years was the Inca, the supreme leader of the latin King tribes in Catalonia and Spain. Referring to his biography, I will focus on the social presentation of the bodies of Manaba and the latin King, through their dress, adornments and tattoos. From a theoretical and analytical point of view, the body represents one of the main elements for the creation and diffusion of the imaginary of the so called “Latin gangs”. The body can be a stigma and create inequalities and, at the same time, a place of experiences, reflexion and resistance as an emblem. At the end, the article reflects on the tension and paradoxical relationship between resistance and assimilation practices in youth culture.El artículo se centra en el relato biográfico de King Manaba, que durante muchos años fue el Inca, es decir, el líder supremo de una de las tribus de los latin King en Cataluña y en España. Mediante el recurso de su biografía, nos centraremos en la presentación social del cuerpo de Manaba y de los latin King, a través de sus vestidos, adornos y tatuajes. Desde un punto de vista teórico y analítico, el cuerpo representa uno de los elementos centrales para la creación y difusión del imaginario de las llamadas “bandas latinas”. El cuerpo puede ser un estigma y crear desigualdades y, al mismo tiempo, un espacio de vivencias, reflexión y resistencia en cuanto emblema. Finalmente, el artículo reflexiona sobre la tensión y paradójica relación entre prácticas de resistencias y de asimilación en las culturas juveniles.
The Kings River Sustainable Forest Ecosystems Project: inception, objectives, and progress
Jared Verner; Mark T. Smith
2002-01-01
The Kings River Sustainable Forest Ecosystems Project, a formal administrative study involving extensive and intensive collaboration between Forest Service managers and researchers, is a response to changes in the agencyâs orientation in favor of ecosystem approaches and to recent concern over issues associated with maintenance of late successional forest attributes...
Jong-Kyun Chung; Young-In Won; Bang Yong Lee; Jhoon Kim
1998-01-01
We measured the terrestrial nightglow of OI 6300A in the thermosphere(~250km) using a ground-based Fabry-Perot interferometer at the King Sejong Station, Antarctic from March through September, 1997. The King Sejong Station is located at high latitude geographically (62.22 deg S, 301.25 deg E) but at mid-latitude geomagnetically (50.65 deg S, 7.51 deg E). It is therefore the strategic location to measure the temperatures of the thermosphere in the Southern Hemisphere associated with both sola...
Directory of Open Access Journals (Sweden)
Santoso B
2013-06-01
Full Text Available A study was conducted to isolate and identify strain of lactic acid bacteria (LAB isolated from king grass, and to determine their potential as candidate of probiotic for livestock. The LAB was isolated by culturing king grass extract in De Man, Rogosa and Sharpe (MRS medium. The pure culture LAB was used to identify strain of bacteria using Analytical Profile Index (API 50 CH kit. The result showed that the strain bacteria was identified as Lactobacillus plantarum. L. plantarum was able to survive in extreme condition at pH 2 and 0.3% bile salt. L. plantarum also survived against pathogenic bacteria i.e. Staphylococcus aureus, Escherechia coli and Salmonella thypi. It is concluded that L. plantarum isolated from king grass could potentially to be used as probiotic for livestock.
Energy Technology Data Exchange (ETDEWEB)
Montanez, I.P.; Droser, M.L. (Univ. of California, Riverside (United States))
1991-03-01
The Middle to Late Cambrian Bonanza King Formation (CA, NV) is characterized by superimposed scales of cyclicity. Small-scale cycles (0.5 to 10m) occur as shallowing-upward peritidal and subtidal cycles that repeat at high frequencies (10{sup 4} to 10{sup 5}). Systematic changes in stacking patterns of meter-scale cycles define several large-scale (50-250 m) third-order depositional sequences in the Bonanza King Formation. Third-order depositional sequences can be traced within ranges and correlated regionally across the platform. Peritidal cycles in the Bonanza King Formation are both subtidal- and tidal flat-dominated. Tidal flat-dominated cycles consist of muddy bases grading upward into thrombolites or columnar stromatolites all capped by planar stromatolites. Subtidal cycles in the Bonanza King Formation consist of grainstone bases that commonly fine upward and contain stacked hardgrounds. These are overlain by digitate-algal bioherms with grainstone channel fills and/or bioturbated ribbon carbonates with grainstone lenses. Transgressive depositional facies of third-order depositional sequences consist primarily of stacks of subtidal-dominated pertidial cycles and subtidal cycles, whereas regressive depositional facies are dominated by stacks of tidal flat-dominated peritidal cycles and regoliths developed over laminite cycle caps. The use of high frequency cycles in the Bonanza King Formation to delineate regionally developed third-order depositional sequences thus provides a link between cycle stratigraphy and sequence stratigraphy.
Talbot, Darren A; Hanuise, Nicolas; Rey, Benjamin; Rouanet, Jean-Louis; Duchamp, Claude; Brand, Martin D
2003-12-26
We present the partial nucleotide sequence of the avian uncoupling protein (avUCP) gene from king penguin (Aptenodytes patagonicus), showing that the protein is 88-92% identical to chicken (Gallus gallus), turkey (Meleagris gallopavo), and hummingbird (Eupetomena macroura). We show that superoxide activates the proton conductance of mitochondria isolated from king penguin skeletal muscle. GDP abolishes the superoxide-activated proton conductance, indicating that it is mediated via avUCP. In the absence of superoxide there is no GDP-sensitive component of the proton conductance from penguin muscle mitochondria demonstrating that avUCP plays no role in the basal proton leak.
Predictors of pretreatment CA125 at ovarian cancer diagnosis
DEFF Research Database (Denmark)
Babic, Ana; Cramer, Daniel W; Kelemen, Linda E
2017-01-01
PURPOSE: Cancer antigen 125 (CA125) is a glycoprotein expressed by epithelial cells of several normal tissue types and overexpressed by several epithelial cancers. Serum CA125 levels are mostly used as an aid in the diagnosis of ovarian cancer patients, to monitor response to treatment and detect...... in CA125 between studies and linear regression to estimate the association between epidemiologic factors and tumor characteristics and pretreatment CA125 levels. RESULTS: In age-adjusted models, older age, history of pregnancy, history of tubal ligation, family history of breast cancer, and family...... cancer recurrence. Besides tumor characteristics, CA125 levels are also influenced by several epidemiologic factors, such as age, parity, and oral contraceptive use. Identifying factors that influence CA125 levels in ovarian cancer patients could aid in the interpretation of CA125 values for individuals...
Seasonal variation of seismic ambient noise level at King Sejong Station, Antarctica
Lee, W.; Sheen, D.; Seo, K.; Yun, S.
2009-12-01
The generation of the secondary- or double-frequency (DF) microseisms with dominant frequencies between 0.1 and 0.5 Hz has been explained by nonlinear second-order pressure perturbations on the ocean bottom due to the interference of two ocean waves of equal wavelengths traveling in opposite directions. Korea Polar Research Institute (KOPRI) has been operating a broadband seismic station (KSJ1) at King George Island (KGI), Antarctica, since 2001. Examining the ambient seismic noise level for the period from 2006 to 2008 at KSJ1, we found a significant seasonal variation in the frequency range 0.1-0.5 Hz. Correlation of the DF peaks with significant ocean wave height and peak wave period models indicates that the oceanic infragravity waves in the Drake Passage is a possible source to excite the DF microseisms at KGI. Location of King Sejong Station, Antarctica Seasonal variations of DF peak, significant wave height, and peak wave period
Energy Technology Data Exchange (ETDEWEB)
Gass, Carrie; Olson, Jim M. (US Fish and Wildlife Service, idaho Fishery Resource Office, Ahsahka, ID)
2004-11-01
In 2001 the Idaho Fisheries Resource Office continued as a cooperator on the Salmon Supplementation Studies in Idaho Rivers (ISS) project on Pete King and Clear creeks. Data relating to supplementation treatment releases, juvenile sampling, juvenile PIT tagging, brood stock spawning and rearing, spawning ground surveys, and snorkel surveys were used to evaluate project data points and augment past data. Due to low adult spring Chinook returns to Kooskia National Fish Hatchery (KNFH) in brood year 1999 there was no smolt supplementation treatment release into Clear Creek in 2001. A 17,014 spring Chinook parr supplementation treatment (containing 1000 PIT tags) was released into Pete King Creek on July 24, 2001. On Clear Creek, there were 412 naturally produced spring Chinook parr PIT tagged and released. Using juvenile collection methods, Idaho Fisheries Resource Office staff PIT tagged and released 320 naturally produced spring Chinook pre-smolts on Clear Creek, and 16 natural pre-smolts on Pete King Creek, for minimum survival estimates to Lower Granite Dam. There were no PIT tag detections of brood year 1999 smolts from Clear or Pete King creeks. A total of 2261 adult spring Chinook were collected at KNFH. Forty-three females were used for supplementation brood stock, and 45 supplementation (ventral fin-clip), and 45 natural (unmarked) adults were released upstream of KNFH to spawn naturally. Spatial and temporal distribution of 37 adults released above the KNFH weir was determined through the use of radio telemetry. On Clear Creek, a total of 166 redds (8.2 redds/km) were observed and data was collected from 195 carcasses. Seventeen completed redds (2.1 redds/km) were found, and data was collected data from six carcasses on Pete King Creek.
King Cotton's Lasting Legacy of Poverty and Southern Region Contemporary Conditions
Guthrie, James W.; Peevely, Gary
2010-01-01
One hundred fifty years ago, cotton was considered as the king of all United States' agricultural exports. Cotton's dollar value far exceeded that of any other mid-19th-century United States trade item, much more than tobacco, fish, forest products, raw materials for manufacturing, or manufactured items. Indeed, in the mid-19th century, cotton was…
GPM GROUND VALIDATION DUAL POLARIZED C-BAND DOPPLER RADAR KING CITY GCPEX V1
National Aeronautics and Space Administration — The GPM Ground Validation Dual Polarized C-Band Doppler Radar King City GCPEx dataset has special Range Height Indicator (RHI) and sector scans of several dual...
Approximate Dynamic Programming Based on High Dimensional Model Representation
Czech Academy of Sciences Publication Activity Database
Pištěk, Miroslav
2013-01-01
Roč. 49, č. 5 (2013), s. 720-737 ISSN 0023-5954 R&D Projects: GA ČR(CZ) GAP102/11/0437 Institutional support: RVO:67985556 Keywords : approximate dynamic programming * Bellman equation * approximate HDMR minimization * trust region problem Subject RIV: BC - Control Systems Theory Impact factor: 0.563, year: 2013 http://library.utia.cas.cz/separaty/2013/AS/pistek-0399560.pdf
Unknown Fragment of King Sigismundus III’s Diary about Campaign to Russia, 1609–1611
Directory of Open Access Journals (Sweden)
Igor O. Tyumentsev
2017-09-01
Full Text Available Events of the Time of Troubles of the early 17th century played a great role in the history of Russia. In the year of 1609, the Polish royal army under high command of hetman Stanislav Zholkevsky and the King Sigismundus III himself invaded Russia and resiged Smolensk. At this time, a massive offensive to Western, South-Western and North-Western regions of Russia was launched by some detachments under Aleksander Korvinus Gosievsky, some of Polish colonels who were at the head of their regiments and the Cossacks of Zaporozhye. The role of this invasion was very important. The Polish authorities viewed the Russians as a potentially oppositional force, though actual economic collapse and repressions from the state authorities of Vasily Shuiski and the false Dimitry II considerably undermined their enthusiasm and brought social apathy among the Russians. Nevertheless, a garrison of Smolensk refused to surrender and decided to fight against the enemy. History of this siege was described by the King’s secretaries in King Sigismundus III’s Diary about Campaign to Russia. It belongs to the main sources about Russia’s Time of Troubles and about these events, as well as other documents of foreign observers. Using the procedures developed by R.G. Skrynnikov and I.O. Tyumentsev, the authors found and analysed unknown fragment of the “King Sigismundus‘ journal”, which are edited in this publication for the first time. Comparison of this document with the another data of King Sigismundus III’s Diary about Campaign to Russia and other Polish-Luthuanian sources from the beginning of the 17th century enables them to carry out a complex examination of the materials and to cross-verify their data. Experience shows that this technique works effectively.
The Spanish King Alfonso XIII on pages of Russian Press in 1902–1917
Directory of Open Access Journals (Sweden)
Ariadna A. Petrova
2016-06-01
Full Text Available The article examines the approaches of the Russian press (“Moskovskie Vedomosti”, “Russkie Vedomosti”, “Novoe Vremia” to the evaluation of the Spanish King Alfonso XIII (1886–1941 at the first stage of his government. During this time he, acting within the powers granted to him by the Spanish constitution of the Restoration era, tried to stabilize the political situation in Spain and raise the prestige of the royal power, is also actively involved in social and political life of the country. Alfonso XIII also sought to raise the country's prestige in the international arena, seriously shaken after the “disaster in 1898”. The special attention is paid to the problem of formation of public opinion by the Russian press, on the example of newspaper coverage of humanitarian and intermediate activity of the Spanish king during the First World War. The activity of Alfonso XIII, aimed at protecting the interests of the citizens of the Russian Empire and the Slavic population of Austria-Hungary, in particular, his personal involvement in the rescue of the Austrian authorities was sentenced to death by a correspondent of the newspaper "New time" in Vienna D.G. Yanchevetskiy, forced the Russian public during the war to change the attitude towards Spain, its king and Spanish neutrality.
Siim Nestor soovitab : Goldie. Kevin Saunderson. Nicole Willis. King Britt / Siim Nestor
Nestor, Siim, 1974-
2005-01-01
Popmuusikaüritustest: briti muusik Goldie esineb jungle-muusikaga Tallinnas 21. apr. klubis Privé, DJ Kevin Saunderson 22. apr. klubis Privé, laulja Nicole Willis 27. apr. BonBon Jazz Lounge'il klubis BonBon, Philadelphia muusik King Britt ja Eesti ansambel Broken Time Orchestra esitlevad oma heliplaate
Hazardous Waste Cleanup: Thermo King de Puerto Rico Incorporated in Arecibo, Puerto Rico
Thermo King de Puerto Rico, Inc. facility is located in the Zeno Gandia Industrial Area in Arecibo, Puerto Rico. Major features of the facility include six buildings used for manufacturing and storage, a wastewater treatment plant, a hazardous waste and no
33 CFR 101.125 - Approved Alternative Security Programs.
2010-07-01
... 106 of this subchapter, as applicable: (a) American Gaming Association Alternative Security Program..., and Towboats and Barges, dated September 24, 2003. (c) Passenger Vessel Association Industry Standards...
Accumulation factors of mercury by King Bolete Boletus edulis
Falandysz, J.; Frankowska, A.
2003-05-01
To understand pollution picture with mercury and to examine suitability of King Bolete Boletits edulis Bull.: Fr. as possible bioindicator the total mercurv concentrations were determined both in the fruiting bodies and underlying soil substrate collected from various regions of Poland. There were quite large spatial variations of mercury concentration and some seasonal also were noted. Mercury content of the caps exceeded that of stalks (p<0.05), Nvhile Hg BCF values varied between 9 and 40, and 4 and 40, respectively.
Micro-gravity studies in archeo-prospecting of the Valley of the Kings, Luxor, Egypt
Czech Academy of Sciences Publication Activity Database
Issawy, E. A.; Tealeb, A. A.; Mrlina, Jan; Radwan, A. H.; Hassan, G. S.; Sakr, K. O.
- (2001), s. 201-212 ISSN 1110-6417 Institutional research plan: CEZ:AV0Z3012916 Keywords : micro-gravity investigations * archaeo-prospecting * Valley of the Kings * Egypt Subject RIV: DE - Earth Magnetism, Geodesy, Geography
Heterothermy in growing king penguins.
Eichhorn, Götz; Groscolas, René; Le Glaunec, Gaële; Parisel, Camille; Arnold, Laurent; Medina, Patrice; Handrich, Yves
2011-08-16
A drop in body temperature allows significant energy savings in endotherms, but facultative heterothermy is usually restricted to small animals. Here we report that king penguin chicks (Aptenodytes patagonicus), which are able to fast for up to 5 months in winter, undergo marked seasonal heterothermy during this period of general food scarcity and slow-down of growth. They also experience short-term heterothermy below 20 °C in the lower abdomen during the intense (re)feeding period in spring, induced by cold meals and adverse weather. The heterothermic response involves reductions in peripheral temperature, reductions in thermal core volume and temporal abandonment of high core temperature. Among climate variables, air temperature and wind speed show the strongest effect on body temperature, but their effect size depends on physiological state. The observed heterothermy is remarkable for such a large bird (10 kg before fasting), which may account for its unrivalled fasting capacity among birds.
Directory of Open Access Journals (Sweden)
Alkhayal A
2012-10-01
Full Text Available Abdullah Alkhayal,1 Shahla Aldhukair,2 Nahar Alselaim,1 Salah Aldekhayel,1 Sultan Alhabdan,1 Waleed Altaweel,3 Mohi Elden Magzoub,4 Mohammed Zamakhshary1,21Department of Surgery, King Saud bin Abdulaziz University for Health Sciences, Riyadh, Saudi Arabia; 2Public Health Section, King Abdullah International Medical Research Center, Riyadh, Saudi Arabia; 3Urology Department, King Faisal Specialist Hospital and Research Center, Riyadh, Saudi Arabia; 4Department of Medical Education, King Saud bin Abdulaziz University for Health Sciences, Riyadh, Saudi ArabiaBackground: After almost a decade of implementing competency-based programs in postgraduate training programs, the assessment of technical skills remains more subjective than objective. National data on the assessment of technical skills during surgical training are lacking. We conducted this study to document the assessment tools for technical skills currently used in different surgical specialties, their relationship with remediation, the recommended tools from the program directors’ perspective, and program directors’ attitudes toward the available objective tools to assess technical skills.Methods: This study was a cross-sectional survey of surgical program directors (PDs. The survey was initially developed using a focus group and was then sent to 116 PDs. The survey contains demographic information about the program, the objective assessment tools used, and the reason for not using assessment tools. The last section discusses the recommended tools to be used from the PDs’ perspective and the PDs’ attitude and motivation to apply these tools in each program. The associations between the responses to the assessment questions and remediation were statistically evaluated.Results: Seventy-one (61% participants responded. Of the respondents, 59% mentioned using only nonstandardized, subjective, direct observation for technical skills assessment. Sixty percent use only summative
9 CFR 3.125 - Facilities, general.
2010-01-01
... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, general. 3.125 Section 3.125 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...
Line-shape asymmetry of water vapor absorption lines in the 720-nm wavelength region
Grossmann, Benoist E.; Browell, Edward V.
1991-01-01
Spectral line-shape analyses were performed for water vapor lines broadened by argon, oxygen, and xenon in the 720-nm wavelength region. A line-shape asymmetry was observed, which is attributed to statistical dependence or correlation between velocity- and state-changing collisions. The generalized (asymmetric) Galatry profile, which results from the soft-collision profile and includes correlation between velocity- and state-changing collisions, was fitted to the observed line shapes and was found to compare favorably with the observed data. The most prominent asymmetries were observed with xenon as the buffer gas.
Allamnakhrah, Alhasan
2013-01-01
Saudi scholars have been agitating for education reforms to incorporate critical thinking in education programs. This paper is a qualitative case study undertaken at King Abdul Aziz University and Arab Open University and examines students' perception of learning critical thinking in secondary pre-service teacher education programs in Saudi…
44 CFR 19.125 - Effect of other requirements.
2010-10-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.125 Effect of other requirements. (a... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Effect of other requirements. 19.125 Section 19.125 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...
National Research Council Canada - National Science Library
Szymczak, Neil R
2006-01-01
...) 720/Alumina ceramic matrix composite at 1200 deg. C in air and 100% steam environments. The effects of creep loading history on the tensile and compressive material behavior will also be examined...
Does winter region affect spring arrival time and body mass of king eiders in northern Alaska?
Powell, Abby N.; Oppel, Steffen
2009-01-01
Events during the non-breeding season may affect the body condition of migratory birds and influence performance during the following breeding season. Migratory birds nesting in the Arctic often rely on endogenous nutrients for reproductive efforts, and are thus potentially subject to such carry-over effects. We tested whether king eider (Somateria spectabilis) arrival time and body mass upon arrival at breeding grounds in northern Alaska were affected by their choice of a winter region in the Bering Sea. We captured birds shortly after arrival on breeding grounds in early June 2002–2006 at two sites in northern Alaska and determined the region in which individuals wintered using satellite telemetry or stable isotope ratios of head feathers. We used generalized linear models to assess whether winter region explained variation in arrival body mass among individuals by accounting for sex, site, annual variation, and the date a bird was captured. We found no support for our hypothesis that either arrival time or arrival body mass of king eiders differed among winter regions. We conclude that wintering in different regions in the Bering Sea is unlikely to have reproductive consequences for king eiders in our study areas.
Synthesis of I-125 labeled photoaffinity rapamycin analogs
International Nuclear Information System (INIS)
Shu, A.Y.L.; Yamashita, D.S.; Holt, D.A.; Heys, J.R.
1996-01-01
Two no-carrier-added 125 I-labelled photoaffinity rapamycin analogs were prepared: 7-demethoxy-7-(4-azido-3- 125 I-benzyloxy) rapamycin and its C 28 -C 29 seco analog. The key reactions of the synthesis were substitution of the C 7 methoxyl of rapamycin with 4-azido-3-tributylstannylbenzyloxy group, exchange of tributyltin with 125 I using Na 125 I and Chloramine-T, and a ZnCl 2 mediated retro-Aldol cleavage of the C 28 -C 29 bond of rapamycin. (author)
[Neurological evaluation of the leper king Baldwin IV of Jerusalem].
Guerrero-Peral, A L
In the medieval period, physicians became more aware of leprosy symptoms and differentiated it from other similar diseases. Baldwin, the leper king of Jerusalem (1161-1185), probably contributed to an increasing interest and tolerance to this disease in medieval Christian states. We review historical descriptions of the neurological manifestations he developed. William of Tyre gives us a description of first symptoms experienced by the prince when aged nine. He notices that half of his right arm and hand were partially numb. No skin or nervous lesions are described. By his early twenties, muscle weakness makes him unable to walk. He gets blinded, probably due to keratopathy related to facial nerves involvement. Repeated attacks of fever lead to progressive worsening of his disease. He finally dies in Jerusalem, aged twenty-five, probably due to a septicaemia from infected sores. The earliest sign of Baldwin's disease is anaesthesia. Though skin lesions are not described, it is likely that at this point he had a tuberculoid form of leprosy. As his disease finally takes a lepromatous form, we suspect that it began as a borderline, immunologically unstable form. Leper king Baldwin biography gives us interesting descriptions of neurological clinical features of leprosy. Besides, it helps us to discover twelfth century medicine knowledge about this disease.
Directory of Open Access Journals (Sweden)
Sokov Ilya Anatolyevich
2015-04-01
Full Text Available The author of the article analyses the role of Canada’s Prime Minister W.L. Mackenzie King in the creation of the unique Canadian political culture. The basis for this political culture was represented not only by the British political system, the adopted ideology of English classical liberalism, but also the national historical and cultural traditions connected with one and a half century existence of two nations on the North American continent. The author confirms that the Liberal Party and Mackenzie King as its leader decided upon the wide modernization of the Canadian society in the conditions of the post-war reconstruction in 1920s. This process would have been impossible without the reorganization of the political culture. The change of political practice allowed the autonomy to obtain more rights and the sovereignty. That is why M. King held two posts during almost the whole period – as Prime Minister and as Minister of Foreign Affairs. This approach helped him to have significant influence on the external political aspect in the development of the Canadian political culture. The author of the article points the main seven directions in the political activity of Mackenzie King which contributed to the creation of the unique Canadian political culture. The author concludes that the influence of Mackenzie King on the creation of the Canadian political culture was crucial in the second half of the 20th Century.
46 CFR 201.125 - Attendance and mileage fees.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Attendance and mileage fees. 201.125 Section 201.125 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Subpoenas (Rule 12) § 201.125 Attendance and mileage fees. Persons attending...
Rossanese, M; Pivetta, M; Pereira, N; Burrow, R
2018-04-30
Five cavalier King Charles spaniels were examined for acute onset of respiratory distress. Thoracic radiographs demonstrated diaphragmatic hernia and tension gastrothorax, visible as a distended stomach occupying the left caudal thoracic cavity. Exploratory midline coeliotomy confirmed congenital pleuroperitoneal diaphragmatic hernia with herniation and dilatation of the stomach. The hernia configuration was consistent in all cases, with a defect affecting the left diaphragmatic crus. Congenital pleuroperitoneal diaphragmatic hernia is a rare condition caused by a defect in the dorsolateral diaphragm. Defects of the left crus of the diaphragm could result in the herniation of the stomach into the thoracic cavity with possible subsequent tension gastrothorax. Cavalier King Charles spaniels may have a predisposition to this condition. Tension gastrothorax is an acute life-threatening consequence of gastric herniation through a diaphragmatic defect that must be promptly recognised and surgically treated. © 2018 British Small Animal Veterinary Association.
24 CFR 245.125 - Tenant organizers.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Tenant organizers. 245.125 Section... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.125 Tenant organizers. (a) A tenant organizer is a tenant or non-tenant who assists tenants in establishing and operating a tenant organization...
Cancer antigen-125 and risk of atrial fibrillation
DEFF Research Database (Denmark)
Cheung, Angel; Gong, Mengqi; Bellanti, Roberto
2018-01-01
Background: Cancer antigen-125 (Ca-125) is traditionally recognised as a tumour marker and its role in cardiovascular diseases has been studied only in recent years. Whether Ca-125 is elevated in patients with atrial fibrillation (AF) and its levels predict the risk of AF remains controversial. T...
40 CFR 40.125-1 - Limitations on duration.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Limitations on duration. 40.125-1 Section 40.125-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE RESEARCH AND DEMONSTRATION GRANTS § 40.125-1 Limitations on duration. (a) [Reserved] (b) No...
King James II in Foreign Historiography: the Main Scientifi c Trends and Approaches .
Directory of Open Access Journals (Sweden)
Stankov Kirill
2016-07-01
Full Text Available The fate of the tragic figure of the British king James II Stuart is considered in the article. In this paper the author pays speсial attention to the history of investigation of the character and politics of this person by the British historians, as well as by the leading European and American specialists on the Early Modern Time. The estimates of James II are of vast variety in the British historiography but at the same time diff erent authors have some similar features in their attitude. Except the apologists the British historians on the whole criticized this king and explain that the majority of the problems connected with him are based on the religious factor that is not really right. On the other hand there are some differences in this negative approaches among various scientifi c schools of British historiography. The Whigs stated that James II tried to limit the personal rights of the Englishmen which was the main result of the English revolution of the middle of the 17th century. The Tories proved that the king neglected the gentry’s property rights and tried to transform the dualistic monarchy into absolutism. The Positivists thought that James II supported the Catholic Counterreformation and fought against the Enlightenment. The revisionists and postrevisionists tried to revalue the person of James II based on the true scientific foundations. A special view on James II’ policy is produced by Non-British authors: German, French and American historians.
Burger King in Portugal : to lead or to follow?
Patrone, Sara Saraiva
2012-01-01
In 2001, the Burger King (BK) brand, managed by Ibersol group entered the growing fast food Portuguese market. Marginally higher prices along with the fact of having entered the market 10 years after its most direct competitor (McDonald´s), led BK to a sub leader position. Although being recognized as offering superior quality products when compared to McDonald´s, BK´s growth margins in the Portuguese market have been decreasing since 2007. The company´s uncertainty situation, offers the p...
Is tissue CA125 expression in epithelial ovarian adenocarcinoma heterogenic?
DEFF Research Database (Denmark)
Sparholt, Morten H; Høgdall, Claus K; Nedergaard, Lotte
2013-01-01
To evaluate if heterogeneity of tissue cancer antigen 125 (CA125) expression is present in epithelial serous adenocarcinomas. Furthermore, to investigate whether there is a correlation between levels of CA125 tissue expression, serum level of CA125, stage, and grade. A total of 10 patients...... diagnosed with serous ovarian adenocarcinomas were included. Preoperative blood samples were collected to determine serum CA125 levels. Tumor tissue from primary surgery was collected and processed for immunohistochemical analyses. CA125 was expressed in varying degrees in tumor tissues from all patients....... Mean tissue CA125 expression for each patient ranged from 36% to 98%. Intrapatient variations in tissue expression ranged from 10% to 90% point. No significant correlations between levels of CA125 tissue expression, serum level of CA125, stage, and grade were found. We found that the tissue expression...
2011-07-15
... Statement ``The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and... status, familial status, parental status, religion, sexual orientation, genetic information, political... contact USDA's TARGET Center at (202) 720-2600 (voice and TDD). To file a complaint of discrimination...
Directory of Open Access Journals (Sweden)
Saghar Salehpour
2009-01-01
Full Text Available Background: Despite a high prevalence of endometriosis, there still exist many challenges indiagnosing the disease. This study aims to evaluate non-invasive and practical diagnostic methodsby measuring serum and peritoneal fluid CA 125 levels in patients with endometriosis. A secondaryaim is to determine the correlation between these markers with the stage of disease as well as therelationship of the two markers with each other.Materials and Methods: This is a cross-sectional study of 60 women who underwent laparoscopyfor benign conditions. Based on laparoscopic findings and biopsy results, patients were divided to twogroups; one group included patients with pelvic endometriosis (35 patients and the second enrolledpatients free from endometriosis (25 patients. Serum and peritoneal fluid specimens were provided at thetime of laparoscopy and CA125 levels were then assessed by electrochemiluminescence immunoassay.Results: Mean serum and peritoneal fluid CA125 levels were significantly higher in women withendometriosis as compared to the control group (26.42 ± 24.34 IU/ml versus 12.64 ± 6.87 IU/mlin serum and 2203.54 + 993.19 IU/ml versus 1583.42 ± 912.51 IU/ml in peritoneal fluid, p<0.05.CA 125 levels also varied proportionally with the stage of endometriosis; but showed a significantdifference only in higher stages of the disease, both in serum and peritoneal fluid. We calculatedthe cut-off value suggesting a diagnosis of pelvic endometriosis as 14.70 IU/ml for serum and1286.5 IU/ml for peritoneal fluid CA125. A linear correlation between CA 125 levels in serum andperitoneal fluid in patients with pelvic endometriosis has also been observed.Conclusion: Serum and peritoneal fluid CA 125 levels are simple and non-surgical tools fordiagnosing and staging pelvic endometriosis. These markers are of greater diagnostic value inhigher stages of the disease.
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J.M.; Grau Carles, A.
1994-01-01
A comparative study of performance of 19-iodocholesterol-''125I 3-acetate and sodium iodine samples labelled with ''125 I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I''-concentration of 0-90 ug and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol-''125I 3-acetate samples in Toluene-alcohol and 0.04% for Na''125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs
46 CFR 28.125 - Stowage of survival craft.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Stowage of survival craft. 28.125 Section 28.125... FISHING INDUSTRY VESSELS Requirements for All Vessels § 28.125 Stowage of survival craft. (a) Each..., inflatable buoyant apparatus, and any auxiliary craft used in their place, must be kept readily accessible...
Isotopic labeling affects 1,25-dihydroxyvitamin D metabolism
International Nuclear Information System (INIS)
Halloran, B.P.; Bikle, D.D.; Castro, M.E.; Gee, E.
1989-01-01
Isotope substitution can change the biochemical properties of vitamin D. To determine the effect of substituting 3H for 1H on the metabolism of 1,25(OH)2D3, we measured the metabolic clearance rate and renal metabolism of unlabeled and 3H-labeled 1,25(OH)2D3. Substitution of 3H for 1H on carbons 26 and 27 [1,25(OH)2[26,27(n)-3H]D3] or on carbons 23 and 24 [1,25(OH)2[23,24(n)-3H]D3] reduced the in vivo metabolic clearance rate of 1,25(OH)2D3 by 36% and 37%, respectively, and reduced the in vitro renal catabolism of 1,25(OH)2D3 by 11% and 54%, respectively. Substitutions of 3H for 1H on carbons 23 and 24 as opposed to carbons 26 and 27 reduced conversion of [3H]1,25(OH)2D3 to [3H]1,24,25(OH)2D3 by 25% and to putative 24-oxo-1,23,25-dihydroxyvitamin D3 by 1600%. These results indicate that substitution of 3H for 1H on carbons 26 and 27 or on carbons 23 and 24 can reduce the metabolic clearance rate and in vitro metabolism of 1,25(OH)2D3 and quantitatively alter the pattern of metabolic products produced
Two versions of solomon's prayer (1 kings 8 and 2 chronicles 6): a ...
African Journals Online (AJOL)
. We find this prayer in two different theological and literary traditions of the Bible: 1 Kings 8:22-53 and 2 Chronicles 6:12-42. In the light of these parallel versions one may pose the following questions: What are the similarities and differences ...
40 CFR 179.125 - Judicial review.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Judicial review. 179.125 Section 179... EVIDENTIARY PUBLIC HEARING Judicial Review § 179.125 Judicial review. (a) The Administrator's final decision... judicial review within the period ending on the 60th day after the date of the publication of the order...
Antiproliferative activity of king cobra (Ophiophagus hannah) venom L-amino acid oxidase.
Li Lee, Mui; Chung, Ivy; Yee Fung, Shin; Kanthimathi, M S; Hong Tan, Nget
2014-04-01
King cobra (Ophiophagus hannah) venom L-amino acid oxidase (LAAO), a heat-stable enzyme, is an extremely potent antiproliferative agent against cancer cells when compared with LAAO isolated from other snake venoms. King cobra venom LAAO was shown to exhibit very strong antiproliferative activities against MCF-7 (human breast adenocarcinoma) and A549 (human lung adenocarcinoma) cells, with an IC50 value of 0.04±0.00 and 0.05±0.00 μg/mL, respectively, after 72-hr treatment. In comparison, its cytotoxicity was about 3-4 times lower when tested against human non-tumourigenic breast (184B5) and lung (NL 20) cells, suggesting selective antitumour activity. Furthermore, its potency in MCF-7 and A549 cell lines was greater than the effects of doxorubicin, a clinically established cancer chemotherapeutic agent, which showed an IC50 value of 0.18±0.03 and 0.63±0.21 μg/mL, respectively, against the two cell lines. The selective cytotoxic action of the LAAO was confirmed by phycoerythrin (PE) annexin V/7-amino-actinomycin (AAD) apoptotic assay, in which a significant increase in apoptotic cells was observed in LAAO-treated tumour cells than in their non-tumourigenic counterparts. The ability of LAAO to induce apoptosis in tumour cells was further demonstrated using caspase-3/7 and DNA fragmentation assays. We also determined that this enzyme may target oxidative stress in its killing of tumour cells, as its cytotoxicity was significantly reduced in the presence of catalase (a H2O2 scavenger). In view of its heat stability and selective and potent cytotoxic action on cancer cells, king cobra venom LAAO can be potentially developed for treating solid tumours. © 2013 Nordic Association for the Publication of BCPT (former Nordic Pharmacological Society).
Interns’ perceived abuse during their undergraduate training at King Abdul Aziz University
Directory of Open Access Journals (Sweden)
Iftikhar R
2014-05-01
Full Text Available Rahila Iftikhar,1 Razaz Tawfiq,2 Salem Barabie2 1Department of Family and Community Medicine, 2General Practice Department, King Abdul Aziz University, Jeddah, Saudi Arabia Background and objectives: Abuse occurs in all workplaces, including the medical field. The aim of this study was to determine the prevalence of perceived abuse among medical students, the types of abuse experienced during medical training, the source of abuse, and the perceived barriers to reporting abuse. Method: This cross-sectional survey was conducted between September 2013 and January 2014 among medical graduates of King Abdul Aziz University, Jeddah. The survey questionnaire was designed to gather information regarding the frequency with which participants perceived themselves to have experienced abuse, the type of abuse, the source of abuse, and the reasons for nonreporting of perceived abuse. Data were analyzed using the Statistical Package for the Social Sciences. Result: Of the 186 students enrolled in this study, 169 (90.9% reported perceiving some form of abuse during medical school training. Perceived abuse was most often verbal (86.6%, although academic abuse (73.1%, sex discrimination (38.7%, racial or ethnic discrimination (29.0%, physical abuse (18.8%, religious discrimination (15.1%, and sexual harassment (8.6% were also reported. Professors were most often cited as the sources of perceived abuse, followed by associate professors, demonstrators (or assistant teaching staff, and assistant professors. The Internal Medicine Department was the most frequently cited department where students perceived themselves to have experienced abuse. Only 14.8% of the students reported the abuse to a third party. Conclusion: The self-reported prevalence of medical student abuse at King Abdul Aziz University is high. A proper system for reporting abuse and for supporting victims of abuse should be set up, to promote a good learning environment. Keywords: maltreatment
Rey, Benjamin; Halsey, Lewis G; Dolmazon, Virginie; Rouanet, Jean-Louis; Roussel, Damien; Handrich, Yves; Butler, Patrick J; Duchamp, Claude
2008-07-01
In endotherms, regulation of the degree of mitochondrial coupling affects cell metabolic efficiency. Thus it may be a key contributor to minimizing metabolic rate during long periods of fasting. The aim of the present study was to investigate whether variation in mitochondrial avian uncoupling proteins (avUCP), as putative regulators of mitochondrial oxidative phosphorylation, may contribute to the ability of king penguins (Aptenodytes patagonicus) to withstand fasting for several weeks. After 20 days of fasting, king penguins showed a reduced rate of whole animal oxygen consumption (Vo2; -33%) at rest, together with a reduced abundance of avUCP and peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC1-alpha) mRNA in pectoralis muscle (-54%, -36%, respectively). These parameters were restored after the birds had been refed for 3 days. Furthermore, in recently fed, but not in fasted penguins, isolated muscle mitochondria showed a guanosine diphosphate-inhibited, fatty acid plus superoxide-activated respiration, indicating the presence of a functional UCP. It was calculated that variation in mitochondrial UCP-dependent respiration in vitro may contribute to nearly 20% of the difference in resting Vo2 between fed or refed penguins and fasted penguins measured in vivo. These results suggest that the lowering of avUCP activity during periods of long-term energetic restriction may contribute to the reduction in metabolic rate and hence the ability of king penguins to face prolonged periods of fasting.
49 CFR 192.125 - Design of copper pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Design of copper pipe. 192.125 Section 192.125... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.125 Design of copper pipe. (a) Copper... hard drawn. (b) Copper pipe used in service lines must have wall thickness not less than that indicated...
Airborne iodine-125 arising from surface contamination
International Nuclear Information System (INIS)
Kwok, C.S.; Hilditch, T.E.
1982-01-01
Measurements of airborne 125 I were made during the subdivision of 740 MBq stocks of 125 I iodide solution in a hospital dispensary. Within the fume cupboard the mean airborne 125 I concentration was 3.5 +- 2.9 kBqm -3 . No airborne concentration contamination was found outside the fume cupboard during these dispensing sessions. The airborne 125 I concentration arising from deliberate surface contamination (50 μl, 3.7-6.3 MBq) of the top of a lead pot was measured at a height simulating face level at an open work bench. There was a progressive fall in airborne concentration over seven days but even then the level was still significantly above background. Measurements made with the extraction system of the fume cupboard in operation were 2-3 times lower. (U.K.)
7 CFR 4279.125 - Interest rates.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest rates. 4279.125 Section 4279.125 Agriculture... Interest rates. The interest rate for the guaranteed loan will be negotiated between the lender and the applicant and may be either fixed or variable as long as it is a legal rate. Interest rates will not be more...
Medical waste management in Jordan: A study at the King Hussein Medical Center
International Nuclear Information System (INIS)
Oweis, Rami; Al-Widyan, Mohamad; Al-Limoon, Ohood
2005-01-01
As in many other developing countries, the generation of regulated medical waste (RMW) in Jordan has increased significantly over the last few decades. Despite the serious impacts of RMW on humans and the environment, only minor attention has been directed to its proper handling and disposal. This study was conducted in the form of a case study at one of Jordan's leading medical centers, namely, the King Hussein Medical Center (KHMC). Its purpose was to report on the current status of medical waste management at KHMC and propose possible measures to improve it. In general, it was found that the center's administration was reasonably aware of the importance of medical waste management and practiced some of the measures to adequately handle waste generated at the center. However, it was also found that significant voids were present that need to be addressed in the future including efficient segregation, the use of coded and colored bags, better handling and transfer means, and better monitoring and tracking techniques, as well as the need for training and awareness programs for the personnel
Clucas, Gemma V; Younger, Jane L; Kao, Damian; Rogers, Alex D; Handley, Jonathan; Miller, Gary D; Jouventin, Pierre; Nolan, Paul; Gharbi, Karim; Miller, Karen J; Hart, Tom
2016-10-13
Seabirds are important components of marine ecosystems, both as predators and as indicators of ecological change, being conspicuous and sensitive to changes in prey abundance. To determine whether fluctuations in population sizes are localised or indicative of large-scale ecosystem change, we must first understand population structure and dispersal. King penguins are long-lived seabirds that occupy a niche across the sub-Antarctic zone close to the Polar Front. Colonies have very different histories of exploitation, population recovery, and expansion. We investigated the genetic population structure and patterns of colonisation of king penguins across their current range using a dataset of 5154 unlinked, high-coverage single nucleotide polymorphisms generated via restriction site associated DNA sequencing (RADSeq). Despite breeding at a small number of discrete, geographically separate sites, we find only very slight genetic differentiation among colonies separated by thousands of kilometers of open-ocean, suggesting migration among islands and archipelagos may be common. Our results show that the South Georgia population is slightly differentiated from all other colonies and suggest that the recently founded Falkland Island colony is likely to have been established by migrants from the distant Crozet Islands rather than nearby colonies on South Georgia, possibly as a result of density-dependent processes. The observed subtle differentiation among king penguin colonies must be considered in future conservation planning and monitoring of the species, and demographic models that attempt to forecast extinction risk in response to large-scale climate change must take into account migration. It is possible that migration could buffer king penguins against some of the impacts of climate change where colonies appear panmictic, although it is unlikely to protect them completely given the widespread physical changes projected for their Southern Ocean foraging grounds
Directory of Open Access Journals (Sweden)
Klemens Pütz
Full Text Available Most studies concerning the foraging ecology of marine vertebrates are limited to breeding adults, although other life history stages might comprise half the total population. For penguins, little is known about juvenile dispersal, a period when individuals may be susceptible to increased mortality given their naïve foraging behaviour. Therefore, we used satellite telemetry to study king penguin fledglings (n = 18 from two sites in the Southwest Atlantic in December 2007. The two sites differed with respect to climate and proximity to the Antarctic Polar Front (APF, a key oceanographic feature generally thought to be important for king penguin foraging success. Accordingly, birds from both sites foraged predominantly in the vicinity of the APF. Eight king penguins were tracked for periods greater than 120 days; seven of these (three from the Falkland Islands and four from South Georgia migrated into the Pacific. Only one bird from the Falkland Islands moved into the Indian Ocean, visiting the northern limit of the winter pack-ice. Three others from the Falkland Islands migrated to the eastern coast of Tierra del Fuego before travelling south. Derived tracking parameters describing their migratory behaviour showed no significant differences between sites. Nevertheless, generalized linear habitat modelling revealed that juveniles from the Falkland Islands spent more time in comparatively shallow waters with low sea surface temperature, sea surface height and chlorophyll variability. Birds from South Georgia spent more time in deeper waters with low sea surface temperature and sea surface height, but high concentrations of chlorophyll. Our results indicate that inexperienced king penguins, irrespective of the location of their natal site in relation to the position of the APF, develop their foraging skills progressively over time, including specific adaptations to the environment around their prospective breeding site.
Pütz, Klemens; Trathan, Phil N; Pedrana, Julieta; Collins, Martin A; Poncet, Sally; Lüthi, Benno
2014-01-01
Most studies concerning the foraging ecology of marine vertebrates are limited to breeding adults, although other life history stages might comprise half the total population. For penguins, little is known about juvenile dispersal, a period when individuals may be susceptible to increased mortality given their naïve foraging behaviour. Therefore, we used satellite telemetry to study king penguin fledglings (n = 18) from two sites in the Southwest Atlantic in December 2007. The two sites differed with respect to climate and proximity to the Antarctic Polar Front (APF), a key oceanographic feature generally thought to be important for king penguin foraging success. Accordingly, birds from both sites foraged predominantly in the vicinity of the APF. Eight king penguins were tracked for periods greater than 120 days; seven of these (three from the Falkland Islands and four from South Georgia) migrated into the Pacific. Only one bird from the Falkland Islands moved into the Indian Ocean, visiting the northern limit of the winter pack-ice. Three others from the Falkland Islands migrated to the eastern coast of Tierra del Fuego before travelling south. Derived tracking parameters describing their migratory behaviour showed no significant differences between sites. Nevertheless, generalized linear habitat modelling revealed that juveniles from the Falkland Islands spent more time in comparatively shallow waters with low sea surface temperature, sea surface height and chlorophyll variability. Birds from South Georgia spent more time in deeper waters with low sea surface temperature and sea surface height, but high concentrations of chlorophyll. Our results indicate that inexperienced king penguins, irrespective of the location of their natal site in relation to the position of the APF, develop their foraging skills progressively over time, including specific adaptations to the environment around their prospective breeding site.
14 CFR 125.211 - Seat and safety belts.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Seat and safety belts. 125.211 Section 125... Requirements § 125.211 Seat and safety belts. (a) No person may operate an airplane unless there are available... the airplane who is at least 2 years old; and (2) An approved safety belt for separate use by each...
78 FR 34978 - Amendment to Notice of Funding Availability for the Rural Energy for America Program
2013-06-11
.... Nondiscrimination Statement USDA prohibits discrimination in all its programs and activities on the basis of race..., parental status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because... at (202) 720-2600 (voice and TDD). To file a complaint of discrimination, write to: USDA, Assistant...
78 FR 26747 - Amendment to Notice of Funding Availability for the Rural Energy for America Program
2013-05-08
... Statement USDA prohibits discrimination in all its programs and activities on the basis of race, color... status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because all or...) 720-2600 (voice and TDD). To file a complaint of discrimination, write to: USDA, Assistant Secretary...
Maseko, L.; Marx, B.
2016-01-01
Owing to the complexity and general lack of understanding of information technology (“IT”), the management of IT is often treated as a separately managed value-providing asset. This has resulted in IT rarely receiving the necessary attention of the board, thus creating a disconnect between the board and IT. The King Code of Governance for South Africa 2009 (hereafter referred to as “King III”) provides principles and recommended practices for effective IT governance in order to create a great...
New Light on the Legendary King Nechepsos of Egypt
DEFF Research Database (Denmark)
Ryholt, Kim
2011-01-01
This paper identifies several indigenous Egyptian attestations of King Nechepsos, previously well known from Classical sources. The name may be understood as ‘Necho the Wise’, and refers to Necho II of the Twenty-sixth Dynasty. His association with astrology may be related to an eclipse near the ...... the beginning of that king’s historical reign. This paper further identifies the sage Petosiris known from Greek texts as the well-attested sage Petesis. The divine instructors of Nechepsos and Petosiris are identified as Imhotep and Amenhotep son of Hapu....
Polysémie de HOW dans la King James Version
Pinson, Mathilde
2017-01-01
This paper aims at analyzing the various functional and semantic values attributed to the morpheme how in the King James Version of the Bible (KJV), some of which are not prototypical (complementizer, causal interrogative adverb, interrogative pronoun and adverbial relative). In view of the complex semantic and functional network of how, it is necessary first to establish what decoding problems were experienced by the readers. As will be shown, almost each type of how can be misinterpreted in...
Directory of Open Access Journals (Sweden)
O. El-Ahmady
1993-01-01
Full Text Available Serum TPA and CA-125 were determined in 86 individuals (66 with breast cancer representing the different stages and grades of the disease and 20 normal healthy controls. TPA and CA-125 were estimated using the L1A reagents supplied by BYK Sangtec. TPA showed sensitivity rates of 31.8%, 42.4% and 51.5% while CA-125 showed sensitivities of 16.3%, 18.6% and 25.6% at specificity levels of 100%, 95% and 90% respectively. Combined determination of the two markers resulted in some improvement in sensitivity. For follow-up of breast cancer patients after surgery both markers were of value and showed near-identical patterns.
International Nuclear Information System (INIS)
Oesterud, B.; Rapaport, S.I.
Activation of Factor IX and Factor X was studied by adding 125 I-Factor IX or 125 I-Factor X to reaction mixtures and quantitating cleavage products by reduced sodium dodecylsulfate gel electrophoresis. Thrombin failed to activate Factors IX or X; Factor Xsub(a) produced insignificant amounts of cleavage products of both factors. In contrast, the reaction product of tissue factor and Factor VII cleaved large amounts of both Factor IX and Factor X in purified systems and in plasma. In incubation mixtures of plasma containing added 125 I-Factor IX or 125 I-Factor X, tissue factor and Ca 2+ ions, the percentage of total radioactivity in the heavy chain peak of 125 I-IXsub(a) and the heavy chain of 125 I-Xsub(a) increased at a similar rate. When the tissue factor was diluted, similar curves were obtained for percent cleavage of 125 I-Factor IX and percent cleavage of 125 I-Factor X plotted against tissue factor concentration. These findings support the hypothesis that activation of Factor IX by the tissue factor-Factor VII reaction product represents a physiologically significant step in normal haemostasis. (author)
Coretta Scott King Award Winner Javaka Steptoe Stands Tall "In Daddy's Arms."
Peck, Jackie; Hendershot, Judy
1999-01-01
Offers an interview with artist and author Javaka Steptoe, winner of the Coretta Scott King award for his book "In Daddy's Arms I Am Tall: African Americans Celebrating Fathers." Discusses his background in the arts, the variety of media he uses, how he begins thinking about his illustrations, his work with children's art, and aspects of his work.…
Critical Discourse Analysis of Martin Luther King's Speech in Socio-Political Perspective
Sipra, Muhammad Aslam; Rashid, Athar
2013-01-01
The article presents the Critical Discourse Analysis (CDA) of the first part of King Martin Luther's speech "When I Have a Dream" in socio-political context. The study investigates how it lies on the basis of application of Fairclough version of CDA in the first part of the text. Moreover, it explicates the terms like social, cultural…
The tragic 1824 journey of the Hawaiian king and queen to London: history of measles in Hawaii.
Shulman, Stanford T; Shulman, Deborah L; Sims, Ronald H
2009-08-01
The susceptibility of isolated island-based populations to acute infections like measles is well documented, most clearly in Fiji and the Faröe Islands. We review the remarkably tragic 1824 journey of King Kamehameha II and Queen Kamamalu of Hawaii to London and the later enormous impact of measles on Hawaii on first arrival in 1848. The young royalty came to seek an audience with King George IV to negotiate an alliance with England. Virtually the entire royal party developed measles within weeks of arrival, 7 to 10 days after visiting the Royal Military Asylum housing hundreds of soldiers' children. Within the month the king (27) and queen (22) succumbed to measles complications. Their bodies were transported to Hawaii by Right Honorable Lord Byron (Captain George Anson, the poet's cousin). Before 1848 measles was unknown in Hawaii. Several epidemics struck Hawaii in late 1848, beginning with measles and pertussis, then diarrhea and influenza. Measles arrived at this time from California, spreading from Hilo, Hawaii, through all the islands; 10% to 33% of the population died. Subsequent measles epidemics occurred in 1861, 1889 to 1890, 1898, and 1936 to 1937, the latter with 205 deaths. The imported epidemics of infections including measles diminished Hawaii's population from approximately 300,000 at Captain Cook's arrival in 1778 to 135,000 in 1820 and 53,900 in 1876. The measles deaths of the king and queen in London in 1824, likely acquired visiting a large children's home, was a harbinger of the devastating impact of measles upon Hawaiians 24 years later with its first arrival to the Sandwich (Hawaiian) Islands.
13 CFR 125.26 - What are the grounds for filing an SDVO SBC protest?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the grounds for filing an... GOVERNMENT CONTRACTING PROGRAMS Protests Concerning SDVO SBCs § 125.26 What are the grounds for filing an..., spouse or permanent caregiver of such veteran. [70 FR 14527, Mar. 23, 2005, as amended at 72 FR 50041...
Rühli, Frank; Ikram, Salima; Bickel, Susanne
2015-01-01
The Valley of the Kings (arab. Wadi al Muluk; KV) situated on the West Bank near Luxor (Egypt) was the site for royal and elite burials during the New Kingdom (ca. 1500-1100 BC), with many tombs being reused in subsequent periods. In 2009, the scientific project "The University of Basel Kings' Valley Project" was launched. The main purpose of this transdisciplinary project is the clearance and documentation of nonroyal tombs in the surrounding of the tomb of Pharaoh Thutmosis III (ca. 1479-1424 BC; KV 34). This paper reports on newly discovered ancient Egyptian human mummified remains originating from the field seasons 2010-2012. Besides macroscopic assessments, the remains were conventionally X-rayed by a portable X-ray unit in situ inside KV 31. These image data serve as basis for individual sex and age determination and for the study of probable pathologies and embalming techniques. A total of five human individuals have been examined so far and set into an Egyptological context. This project highlights the importance of ongoing excavation and science efforts even in well-studied areas of Egypt such as the Kings' Valley.
Rühli, Frank; Ikram, Salima
2015-01-01
The Valley of the Kings (arab. Wadi al Muluk; KV) situated on the West Bank near Luxor (Egypt) was the site for royal and elite burials during the New Kingdom (ca. 1500–1100 BC), with many tombs being reused in subsequent periods. In 2009, the scientific project “The University of Basel Kings' Valley Project” was launched. The main purpose of this transdisciplinary project is the clearance and documentation of nonroyal tombs in the surrounding of the tomb of Pharaoh Thutmosis III (ca. 1479–1424 BC; KV 34). This paper reports on newly discovered ancient Egyptian human mummified remains originating from the field seasons 2010–2012. Besides macroscopic assessments, the remains were conventionally X-rayed by a portable X-ray unit in situ inside KV 31. These image data serve as basis for individual sex and age determination and for the study of probable pathologies and embalming techniques. A total of five human individuals have been examined so far and set into an Egyptological context. This project highlights the importance of ongoing excavation and science efforts even in well-studied areas of Egypt such as the Kings' Valley. PMID:26347313
Monternier, Pierre-Axel; Marmillot, Vincent; Rouanet, Jean-Louis; Roussel, Damien
2014-08-01
Energy conservation is a key priority for organisms that live in environments with seasonal shortages in resource supplies or that spontaneously fast during their annual cycle. The aim of this study was to determine whether the high fasting endurance of winter-acclimatized king penguin chicks (Aptenodytes patagonicus) is associated with an adjustment of mitochondrial bioenergetics in pectoralis muscle, the largest skeletal muscle in penguins. The rates of mitochondrial oxygen consumption, and ATP synthesis and mitochondrial efficiency (ATP/O ratio) were measured in winter-acclimatized chicks. We used pyruvate/malate and palmitoyl-l-carnitine/malate as respiratory substrates and results from naturally fasted chicks were compared to experimentally re-fed chicks. Bioenergetics analysis of pectoralis muscle revealed that mitochondria are on average 15% more energy efficient in naturally fasted than in experimentally fed chicks, indicating that fasted birds consume less nutrients to sustain their energy-demanding processes. We also found that moderate reductions in temperature from 38°C to 30°C further increase by 23% the energy coupling efficiency at the level of mitochondria, suggesting that king penguin chicks realize additional energy savings while becoming hypothermic during winter. It has been calculated that this adjustment of mitochondrial efficiency in skeletal muscle may contribute to nearly 25% of fasting-induced reduction in mass-specific metabolic rate measured in vivo. The present study shows that the regulation of mitochondrial efficiency triggers the development of an economical management of resources, which would maximize the conservation of endogenous fuel stores by decreasing the cost of living in fasted winter-acclimatized king penguin chicks. © 2014. Published by The Company of Biologists Ltd.
Directory of Open Access Journals (Sweden)
Gillian P. Williams
2012-01-01
Full Text Available This article investigates the ‘illness’ of King Saul (as narrated in the Old Testament. The ‘anti-Saul narrative’ states that ‘God’s spirit had left Saul’ and ‘an evil one had taken its place’ (1 Sm 16:14; also cf. e.g. of his behaviour in 1 Sm 19:24; 1 Sm 18:28−29. The latter years of Saul’s reign were marred by his pre-occupation with David’s growing popularity. He eventually became mentally unstable and suspected everyone of plotting against him. Saul’s battle against the Ammonites, as well as his last battle against the Philistines at Mount Gilboa, was fraught with difficulty. It is postulated that Saul experienced epileptic-like fits and assumedly suffered from some kind of ‘depression’ as a result of post-traumatic stress disorder (cf. 1 Sm 18:9; 1 Sm 18:28, 29; 1 Sm 19:24. This was possibly exacerbated by the enemy herem principle. Talmudic and other perspectives were also provided in the article where possible.
deBruijn, HWA; vanderZee, AGJ; Aalders, JG
Although the nature of the cancer antigen 125 leaves many questions unanswered, the use of serum measurements as a means to assess the response to surgery and chemotherapy in ovarian cancer is now well documented. Good prognostic significance is attributed to a rapid decline in cancer antigen 125
1,25 dihydroxyvitamin D3 (1,25) regulation of c-myc mRNA in HL-60 leukemia cells
International Nuclear Information System (INIS)
Simpson, R.U.; Bresnick, E.H.; Begley, D.A.
1986-01-01
Recently, 1,25 was shown to induce differentiation and decrease c-myc levels in HL-60 cells. The authors have confirmed these observations by RNA dot blot analysis. Cells treated with 50 nM 1,25 for 4, 24 and 48 hr showed c-myc mRNA levels of 26, 17 and 15% of control respectively. β-Actin mRNA levels were not altered. To ascertain whether 1, 25 regulated c-myc transcriptionally, an HL-60 nuclear RNA runoff assay was developed. Assay of total nuclei transcriptional activity revealed that 50% of RNA elongation was α-amanitin (0.8 μg/ml) sensitive and was linear with nuclei concentration (0.1-1 x 10 7 nuclei). 1,25 (50 nM) treated (45-96 hr) cells had decreased (approx.40%) total transcription rate relative to control. Decreased total RNA synthesis occurred concomitant with NBT reducing activity. 32 P-RNA runoff transcripts from HL-60 nuclei were hybridized to excess (5 μg DNA was excess) Pst I linearized c-myc and β-actin clones (in pBR322) immobilized on nitrocellulose filter. 32 P-RNA input from 2 x 10 6 to 2 x 10 7 cpm yielded linear hybridization signal. Analysis of blot dot intensity revealed no difference in transcription of c-myc in nuclei from 1,25 dosed or control cells. (myc/actin ratios: 1,25 (50 nM, 72 hr) =1.1 +/- 0.3 and control (72 hr) = 1.0, N=3 or 2 or 3 dots ea). These preliminary data suggest 1,25 does not affect c-myc transcription in HL-60 nuclei and may regulate c-myc mRNA post-transcriptionally
Determination of radiochemical purity of 125I-TOC and 125I-F-PGA
International Nuclear Information System (INIS)
Yang Keya; Fan Wo; Zhang Youjiu; Xu Yujie; Zhu Ran; Hu Mingjiang
2006-01-01
To explore whether there is accordance among three determination methods of the radiochemical purity of [Tyr 3 ] octreotide (TOC) and folate-penicillin G amidase conjugate (F-PGA), which are both labeled with 125 I by Iodogen method, the RCP of the labelings are determined by high performance liquid chromatography (HPLC), paper chromatography and trichloroacetic acid (TCA) precipitation, in which four different concentrations of proteins are used to investigate the effect of them on the determination of RCP. It is shown that both HPLC and paper chromatography can separate the labelings from free iodine efficiently, though HPLC is the most precise and reliable method to determinate RCP of such labelings. In TCA precipitation, the RCP measured with 0.2%BSA is the lowest, but those with three other concentrations of the BSA are similar (P>0.05). When RCP 0.05), whereas higher than that with HPLC (P 10%, the RCP of 125 I-TOC obtained by TCA precipitation is a bit lower than those by two other methods (P 0.05), and there are no significant differences to determinate the RCP of 125 I-F-PGA (P>0.05). The three methods are correlated each other (r=0.0996-0.999, P<0.001). (authors)
16 CFR 1500.125 - Labeling requirements for accompanying literature.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Labeling requirements for accompanying literature. 1500.125 Section 1500.125 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL... REGULATIONS § 1500.125 Labeling requirements for accompanying literature. When any accompanying literature...
International Nuclear Information System (INIS)
Berk, L.S.; Webb, G.; Imperio, N.C.; Nehlsen-Cannarella, S.L.; Eby, W.C.
1986-01-01
We modified the Sandoz cyclosporine radioimmunoassay because of our need for frequent clinical monitoring of cyclosporine drug levels in allo- and xenograft pediatric cardiac transplant patients. With application of a commercially available [ 125 I]cyclosporine label in place of [ 3 H]cyclosporine and a second antibody/polyethylene glycol (PEG) method of separation in place of charcoal separation, we simplified and enhanced the speed and precision of assay performance. Studies of 140 whole blood samples comparing this new method to the [ 3 H]cyclosporine radioimmunoassay (RIA) method of Berk and colleagues yielded a coefficient of correlation of 0.96 (p less than 0.00001) with means of 626 and 667 ng/ml for [ 3 H]RIA and [ 125 I]RIA, respectively, and a regression equation of y = 28 + 1.02x. The major advantages are that total assay time is reduced to approximately 1 h; [ 125 I]cyclosporine label is used, avoiding the problems associated with liquid scintillation counting; and precision is enhanced by separating bound and free fractions with second antibody/PEG. These modifications should provide for greater ease of assay performance and improved clinical utility of cyclosporine monitoring not only in the pediatric but also in the adult transplant patient
International Nuclear Information System (INIS)
Ward, W.F.; Moss, A.L.
1985-01-01
To further evaluate the role of the lysosomal system in insulin degradation, the authors have compared the effects of inhibitors of lysosomal function on the degradation of 125 I-insulin with 125 I-asialofetuin, a lysosomally targeted molecule, by the intact, perfused rat liver and the isolated rat hepatocyte. The inhibitors employed were chloroquine ( 125 microM), NH 4 Cl (10 mM), and leupeptin (50 micrograms/ml). In the intact, perfused liver the observed inhibition of 125 I-asialofetuin degradation at 30 min was as follows: chloroquine, 38%; NH 4 Cl, 32%; and leupeptin, 86%. Chloroquine also inhibited 125 I-insulin degradation in the intact, perfused liver (29%), but NH 4 Cl and leupeptin had no effect. Using the isolated hepatocyte, the observed values for inhibition of 125I-asialofetuin at 60 min were: chloroquine, 85%; NH 4 Cl, 76%; and leupeptin, 81%. Chloroquine produced a 28% inhibition of 125I-insulin degradation, while NH 4 Cl and leupeptin had no effect. Chloroquine and NH 4 Cl decreased cell-associated radioactivity when isolated hepatocytes were incubated with 125I-asialofetuin (leupeptin had no effect), whereas chloroquine caused a 107% increase in cell-associated radioactivity when 125I-insulin was added to the incubation media (NH 4 Cl and leupeptin had no effect). These results indicate that the effects of chloroquine on insulin degradation are an extralysosomal action and that lysosomes appear not to be involved in the physiologic degradation of the insulin molecule
The Ride of the Kings in Vlčnov from the Perspective of Contemporary Research
Czech Academy of Sciences Publication Activity Database
Stavělová, Daniela
2015-01-01
Roč. 25, č. 5 (2015), s. 47-64 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Ride of the Kings * field research * methodology * festival * traditional custom * Vlčnov Subject RIV: AC - Archeology, Anthropology, Ethnology
Scheffer, Annette; Trathan, Philip N.; Edmonston, Johnnie G.; Bost, Charles-André
2016-02-01
Investigating the responses of marine predators to environmental features is of key importance for understanding their foraging behaviour and reproductive success. In this study we examined the foraging behaviour of king penguins breeding at Kerguelen (southern Indian Ocean) in relation to oceanographic and bathymetric features within their foraging ambit. We used ARGOS and Global Positioning System tracking together with Time-Depth-Temperature-Recorders (TDR) to follow the at-sea movements of incubating and brooding king penguins. Combining the penguin behaviour with oceanographic data at the surface through satellite data and at depth through in-situ recordings by the TDRs enabled us to explore how these predators adjusted their horizontal and vertical foraging movements in response to their physical environment. Relating the observed behaviour and oceanographic patterns to local bathymetry lead to a comprehensive picture of the combined influence of bathymetry and meso-scale circulation on the foraging behaviour of king penguins. During both breeding stages king penguins foraged in the area to the south-east of Kerguelen, where they explored an influx of cold waters of southern origin interacting with the Kerguelen Plateau bathymetry. Foraging in the Polar Front and at the thermocline was associated with high prey capture rates. However, foraging trip orientation and water mass utilization suggested that bathymetrically entrained cold-water features provided the most favourable foraging locations. Our study explicitly reports the exploration of bathymetry-related oceanographic features by foraging king penguins. It confirms the presence of Areas of Ecological Significance for marine predators on the Kerguelen Plateau, and suggests the importance of further areas related to the cold-water flow along the shelf break of the Kerguelen Plateau.
Transmedia Narrative in the Era of the Social mobbile. Carlos, King Emperor
Directory of Open Access Journals (Sweden)
José L. CARREÑO VILLADA
2016-06-01
Full Text Available Transmedia narratives are an integral part of mobile communication and are becoming one of the most recurrent when presenting a new audiovisual format forms. Carlos, King Emperor series makes use of transmedia storytelling to reach the user and interact with it through the different elements of your macro narrative universe, elements such as video game or profiles on social networks.
DEFF Research Database (Denmark)
Mosbech, Anders; Johansen, Kasper Lambert; Sonne, Christian
In late July 2009, two female king eiders were caught on the breeding grounds in Myggbukta, Northeast Greenland and equipped with satellite transmitters. Both individuals were tracked for approximately two years. The birds remained in the Myggbukta area until the onset of the autumn migration...... arrival 6 April) where they stayed for some time before returning on the spring migration to Greenland. During a ship-based survey in the offshore winter location at Spitsbergenbanken in April 2013, a previously unknown wintering ground with approximately 10.000 king eiders was discovered. The birds were...... concentrated in a partly ice-covered area 79 km from shore and of about 20 m depth. The number of king eiders indicated that Spitsbergenbanken is a wintering area for both the East Greenland and the Svalbard breeding populations. The discovery has important conservation implications due to the expanding...
Tactile arousal threshold of sleeping king penguins in a breeding colony.
Dewasmes, G; Telliez, F
2000-09-01
The tactile arousal threshold of sleeping birds has not been investigated to date. In this study, the characteristics of this threshold were assessed by stimulating either the upper back or a foot of two groups (one cutaneous site per group) of 60 sleeping king penguins (Aptenodytes patagonica) in the breeding colony of Baie du Marin (Crozet Archipelago). Increasing weights were put onto one of the feet or the upper back of individuals that had been sleeping for more than 5 min until they showed behavioural signs of arousal (head raising). The weight applied to the upper back that was needed to awaken a sleeper (837 +/- 73 g) was 20 times greater than that applied to a foot (38 +/- 6 g). In terms of pressure, the difference remained five times higher for the back (209 +/- 18 g/cm(2)) than the foot (40 g +/- 7 g/cm(2)). Because the king penguin incubates its single egg and rears its young chick on its feet, the low threshold measured at this level could be viewed as an adaptation against progeny predation. Sleepers are frequently bumped by conspecifics walking through the colony. The increased arousal threshold associated with tactile stimulation of the back may help to preserve sleep continuity under these conditions.
Sachs, M. K.; Yoder, M. R.; Turcotte, D. L.; Rundle, J. B.; Malamud, B. D.
2012-05-01
Extreme events that change global society have been characterized as black swans. The frequency-size distributions of many natural phenomena are often well approximated by power-law (fractal) distributions. An important question is whether the probability of extreme events can be estimated by extrapolating the power-law distributions. Events that exceed these extrapolations have been characterized as dragon-kings. In this paper we consider extreme events for earthquakes, volcanic eruptions, wildfires, landslides and floods. We also consider the extreme event behavior of three models that exhibit self-organized criticality (SOC): the slider-block, forest-fire, and sand-pile models. Since extrapolations using power-laws are widely used in probabilistic hazard assessment, the occurrence of dragon-king events have important practical implications.
10 CFR 600.125 - Revision of budget and program plans.
2010-01-01
... requires additional Federal funds. (iii) The extension involves any change in the approved objectives or... regulations may restrict the transfer of funds among direct cost categories or programs, functions and... objective of the project or program. (2) The need arises for additional Federal funds to complete the...
Ramos, Vânia Raquel Raimundo
2014-01-01
Dissertação de Mestrado em Gestão/MBA apresentada à Universidade Aberta O presente trabalho tem por objectivo central, estudar a satisfação dos clientes da empresa King Pie na Cidade de Maputo. O King Pie é uma cadeia sul-africana de fast-food, que em Moçambique opera em regime de franchising, estando presente no mercado local desde o ano de 2004. Neste momento, o King Pie dispõe quatro (4) estabelecimentos localizados na Cidade de Maputo com dois (2) investidores no país que detêm o direi...
47 CFR 69.125 - Dedicated signalling transport.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Dedicated signalling transport. 69.125 Section... (CONTINUED) ACCESS CHARGES Computation of Charges § 69.125 Dedicated signalling transport. (a) Dedicated signalling transport shall consist of two elements, a signalling link charge and a signalling transfer point...
Measurement of circulating 1,25-dihydroxyvitamin D employing radioimmunoassay
International Nuclear Information System (INIS)
Yamamoto, Itsuo; Hamazu, Hisatoshi; Kigami, Yuusuke; Morita, Rikushi
1997-01-01
Measurement of serum 1,25-dihydroxyvitamin D levels is important for diagnosis of various calcium metabolism disorders. Conventional assays for 1,25-dihydroxyvitamin D employed specific 1,25-dihydroxyvitamin D receptor as binding site for the ligand and thus, biologically active 1,25-dihydroxyvitamin D ligand, which is labeled with 3 H, was required. Usage of 3 H made assays cumbersome works. A new assay which uses specific antibody as the binding site and the radioligand labeled with 125 I is now available as a commercial kit. Using these kits, we first studied basically the reproducibility, recovery, cross-reactivity and comparison with conventional assays. All of those results were satisfactory. Secondly, we measured clinically in 111 healthy adults and in patients with various disorders such as renal failure, primary hyperparathyroidism, hypoparathyroidism and sarcoidosis. This newly available kit for measurement of circulating 1,25-dihydroxyvitamin D is proved to be useful in clinical evaluation of calcium metabolic disorders. (author)
Characterization of Binding Epitopes of CA125 Monoclonal Antibodies
DEFF Research Database (Denmark)
Marcos-Silva, Lara; Narimatsu, Yoshiki; Halim, Adnan
2014-01-01
The most used cancer serum biomarker is the CA125 immunoassay for ovarian cancer that detects the mucin glycoprotein MUC16. Several monoclonal antibodies (mAbs) including OC125 and M11 are used in CA125 assays. However, despite considerable efforts, our knowledge of the molecular characteristics...
Terpenos y flavonoides de ageratina fastigiata (H.B.K. King & Robinson
Directory of Open Access Journals (Sweden)
Rubén Torrenegra G.
2010-07-01
Full Text Available De los extractos lipofílicos tanto de hojas como de flores, se aislaron e identificaron dos derivados del kaurano: el ent-kauran-16B-ol y el entkauran-] 6,20-diol y, dos flavonas metoxiladas: la 5-hidroxi-7,4'-dimetoxiflavona y la 5-hidroxi-3,7,4'-trimetoxi-flavona, Los dos diterpenos confirman la ubicación taxonómica de dicha especie según King y Robinson.
TERPENOS Y FLAVONOIDES DE Ageratina fastigiata (H.B.K. King & Robinson
Directory of Open Access Journals (Sweden)
Ruben Torrenegra G.
2010-09-01
Full Text Available De los extractos lipofílicos tanto de hojas como de flores, se aislaron e identificaron dos derivados del kaurano: el ent-kauran-16B-ol y el entkauran-] 6,20-diol y, dos flavonas metoxiladas: la 5-hidroxi-7,4' dimetoxiflavona y la 5-hidroxi-3,7,4'-trimetoxi-flavona, Los dos diterpenos confirman la ubicación taxonómica de dicha especie según King y Robinson.
International Nuclear Information System (INIS)
Yang Jingxiu; Shi Shaohong; Wang Yuping
2005-01-01
Objective: To explore the diagnostic values of changes of serum EMAb and CA125 levels in patients with endometriosis. Methods: Serum EMAb levels were measured with ELISA and CA125 levels with RIA in 54 patients with endometriosis and 35 controls. Results: Positive rate of serum EMAb was significantly higher in the patients with endometriosis than those in controls (P≤0.01). Serum CA125 levels were also significantly higher than those in controls (P<0.01). Conclusion: Combined detection of serum EMAb positive rate and CA125 levels was of diagnostic value in patients with endometriosis. (authors)
21 CFR 175.125 - Pressure-sensitive adhesives.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pressure-sensitive adhesives. 175.125 Section 175...) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADHESIVES AND COMPONENTS OF COATINGS Substances for Use Only as Components of Adhesives § 175.125 Pressure-sensitive adhesives. Pressure-sensitive...
Széles, Lajos; Keresztes, Gábor; Töröcsik, Dániel; Balajthy, Zoltán; Krenács, László; Póliska, Szilárd; Steinmeyer, Andreas; Zuegel, Ulrich; Pruenster, Monika; Rot, Antal; Nagy, László
2009-02-15
Activation of vitamin D receptor (VDR) by 1,25-dihydroxyvitamin D(3) (1,25-vitD) reprograms dendritic cells (DC) to become tolerogenic. Previous studies suggested that 1,25-vitD could inhibit the changes brought about by differentiation and maturation of DCs. Underpinning the described phenotypic and functional alterations, there must be 1,25-vitD-coordinated transcriptional events. However, this transcriptional program has not been systematically investigated, particularly not in a developmental context. Hence, it has not been explored how 1,25-vitD-regulated genes, particularly the ones bringing about the tolerogenic phenotype, are connected to differentiation. We conducted global gene expression analysis followed by comprehensive quantitative PCR validation to clarify the interrelationship between 1,25-vitD and differentiation-driven gene expression patterns in developing human monocyte-derived and blood myeloid DCs. In this study we show that 1,25-vitD regulates a large set of genes that are not affected by differentiation. Interestingly, several genes, impacted both by the ligand and by differentiation, appear to be regulated by 1,25-vitD independently of the developmental context. We have also characterized the kinetics of generation of 1,25-vitD by using three early and robustly regulated genes, the chemokine CCL22, the inhibitory receptors CD300LF and CYP24A1. We found that monocyte-derived DCs are able to turn on 1,25-vitD sensitive genes in early phases of differentiation if the precursor is present. Our data collectively suggest that exogenous or endogenously generated 1,25-vitD regulates a large set of its targets autonomously and not via inhibition of differentiation and maturation, leading to the previously characterized tolerogenic state.
King penguin demography since the last glaciation inferred from genome-wide data.
Trucchi, Emiliano; Gratton, Paolo; Whittington, Jason D; Cristofari, Robin; Le Maho, Yvon; Stenseth, Nils Chr; Le Bohec, Céline
2014-07-22
How natural climate cycles, such as past glacial/interglacial patterns, have shaped species distributions at the high-latitude regions of the Southern Hemisphere is still largely unclear. Here, we show how the post-glacial warming following the Last Glacial Maximum (ca 18 000 years ago), allowed the (re)colonization of the fragmented sub-Antarctic habitat by an upper-level marine predator, the king penguin Aptenodytes patagonicus. Using restriction site-associated DNA sequencing and standard mitochondrial data, we tested the behaviour of subsets of anonymous nuclear loci in inferring past demography through coalescent-based and allele frequency spectrum analyses. Our results show that the king penguin population breeding on Crozet archipelago steeply increased in size, closely following the Holocene warming recorded in the Epica Dome C ice core. The following population growth can be explained by a threshold model in which the ecological requirements of this species (year-round ice-free habitat for breeding and access to a major source of food such as the Antarctic Polar Front) were met on Crozet soon after the Pleistocene/Holocene climatic transition. © 2014 The Author(s) Published by the Royal Society. All rights reserved.
Smartphone-based immunosensor for CA125 detection.
Hosu, Oana; Ravalli, Andrea; Lo Piccolo, Giuseppe Mattia; Cristea, Cecilia; Sandulescu, Robert; Marrazza, Giovanna
2017-05-01
In this work, we report the design, the development and the characterization of the analytical performances of a colorimetric smartphone-based immunosensor for the detection of cancer antigen 125 (CA125). The immunosensor was based on a sandwich strategy in which the primary antibody was immobilized by spotting onto the 3D nitrocellulose membrane. The immunospots were subsequently incubated with CA125 solutions, followed by the affinity reaction with a secondary antibody labeled with gold nanoparticles (AuNPs). The antibody-AuNPs captured onto immunospots induced the silver deposition from a silver enhancer solution leading to the formation of gold-silver nanoparticles of different grey color spots depending on CA125 concentration. The 8 megapixels smartphone camera was integrated in a home-made dark box and used as transducer of color image acquisition and data handling. The pixel intensity of the captured images was determined by an image processing algorithm. The experimental parameters involved in each step of the immunosensor design were studied and optimized, obtaining a limit of detection of 30U/mL CA125. The selectivity of the immunoassay was proven against different concentration solutions of Vascular Endothelial Growth Factor (VEGF) antigen as an unspecific protein when a blank signal was obtained for all tested solutions. Finally, preliminary experiments in human serum samples spiked with CA125 protein were also performed. Therefore, the proposed system could represent a powerful point-of-care tool for the next generation technology for detecting and monitoring cancer biomarkers at early stages by taking advantage of nowadays gadgets with enhanced features such as smartphones. Copyright © 2017 Elsevier B.V. All rights reserved.
The last Viking King: a royal maternity case solved by ancient DNA analysis.
Dissing, Jørgen; Binladen, Jonas; Hansen, Anders; Sejrsen, Birgitte; Willerslev, Eske; Lynnerup, Niels
2007-02-14
The last of the Danish Viking Kings, Sven Estridsen, died in a.d. 1074 and is entombed in Roskilde Cathedral with other Danish kings and queens. Sven's mother, Estrid, is entombed in a pillar across the chancel. However, while there is no reasonable doubt about the identity of Sven, there have been doubts among historians whether the woman entombed was indeed Estrid. To shed light on this problem, we have extracted and analysed mitochondrial DNA (mtDNA) from pulp of teeth from each of the two royals. Four overlapping DNA-fragments covering about 400bp of hypervariable region 1 (HVR-1) of the D-loop were PCR amplified, cloned and a number of clones with each segment were sequenced. Also a segment containing the H/non-H specific nucleotide 7028 was sequenced. Consensus sequences were determined and D-loop results were replicated in an independent laboratory. This allowed the assignment of King Sven Estridsen to haplogroup H; Estrid's sequence differed from that of Sven at two positions in HVR-1, 16093T-->C and 16304T-->C, indicating that she belongs to subgroup H5a. Given the maternal inheritance of mtDNA, offspring will have the same mtDNA sequence as their mother with the exception of rare cases where the sequence has been altered by a germ line mutation. Therefore, the observation of two sequence differences makes it highly unlikely that the entombed woman was the mother of Sven. In addition, physical examination of the skeleton and the teeth strongly indicated that this woman was much younger (approximately 35 years) at the time of death than the 70 years history records tell. Although the entombed woman cannot be the Estrid, she may well be one of Sven's two daughters-in-law who were also called Estrid and who both became queens.
Gowtham, Yashonandana J; Mahadeswaraswamy, Y H; Girish, K S; K, Kemparaju
2014-07-01
The venom of the largest venomous snake, the king cobra (Ophiophagus hannah), is still out of league for the production of therapeutic polyvalent antivenom nor it is characterized immunologically in the Indian subcontinent. In the present study, the king cobra venom is comparatively studied for the cross-reactivity/reactivity and toxicity neutralization by the locally available equine therapeutic polyvalent BSV and VB antivenoms, and monovalent antivenom (OH-IgG) prepared in rabbit. None of the two therapeutic antivenoms procured from two different firms showed any signs of cross-reactivity in terms of antigen-antibody precipitin lines in immunodouble diffusion assay; however, a weak and an insignificant cross-reactivity pattern was observed in ELISA and Western blot studies. Further, both BSV and VB antivenoms failed to neutralize proteolytic, hyaluronidase and phospholipase activities as well as toxic properties such as edema, myotoxicity and lethality of the venom. As expected, OH-IgG showed strong reactivity in immunodouble diffusion, ELISA and in Western blot analysis and also neutralized both enzyme activities as well as the toxic properties of the venom. Thus, the study provides insight into the likely measures that are to be taken in cases of accidental king cobra bites for which the Indian subcontinent is still not prepared for. Copyright © 2014 Elsevier B.V. All rights reserved.
Talbot, Darren A; Duchamp, Claude; Rey, Benjamin; Hanuise, Nicolas; Rouanet, Jean Louis; Sibille, Brigitte; Brand, Martin D
2004-07-01
Juvenile king penguins develop adaptive thermogenesis after repeated immersion in cold water. However, the mechanisms of such metabolic adaptation in birds are unknown, as they lack brown adipose tissue and uncoupling protein-1 (UCP1), which mediate adaptive non-shivering thermogenesis in mammals. We used three different groups of juvenile king penguins to investigate the mitochondrial basis of avian adaptive thermogenesis in vitro. Skeletal muscle mitochondria isolated from penguins that had never been immersed in cold water showed no superoxide-stimulated proton conductance, indicating no functional avian UCP. Skeletal muscle mitochondria from penguins that had been either experimentally immersed or naturally adapted to cold water did possess functional avian UCP, demonstrated by a superoxide-stimulated, GDP-inhibitable proton conductance across their inner membrane. This was associated with a markedly greater abundance of avian UCP mRNA. In the presence (but not the absence) of fatty acids, these mitochondria also showed a greater adenine nucleotide translocase-catalysed proton conductance than those from never-immersed penguins. This was due to an increase in the amount of adenine nucleotide translocase. Therefore, adaptive thermogenesis in juvenile king penguins is linked to two separate mechanisms of uncoupling of oxidative phosphorylation in skeletal muscle mitochondria: increased proton transport activity of avian UCP (dependent on superoxide and inhibited by GDP) and increased proton transport activity of the adenine nucleotide translocase (dependent on fatty acids and inhibited by carboxyatractylate).
The contamination on farm products from 125I
International Nuclear Information System (INIS)
Zhao Wenhu; Xu Shiming; Hou Lanxin
1990-02-01
The 125 I contamination on 15 farm products have been investigated. The effects of 12 farm crops (wheat, bean, eggplants and other vegetables) contaminated by 125 I during the growing stage on their fruits and seeds have been studied. The results show that the 125 I radioactive substance is mainly concentrated on the fruit surface, and the radioactivity rapidly decreased towards its kernel. The fruits and seeds would not be contaminated when plants were contaminated in the seedling stage
14 CFR 125.265 - Flight engineer requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...
Hall, Charles A. S.
2012-03-01
I first came across Carey King when, out of the blue, he invited me to a special session of the annual meeting of the American Association for the Advancement of Science (the largest and most prestigious US scientific meeting) where he was developing a special session on energy return on investment (EROI). At that meeting and since, I have found Carey to be a refreshing new colleague, extremely intelligent, very knowledgeable about many diverse aspects of energy and other things, able to take criticism and to dish it out, and very ambitious, which is mostly a good thing. He is becoming a leader in thinking about EROI and its implications, and I am delighted to see him honored by Environmental Research Letters. This is important because in the US, there is little insight about energy or, especially, its potential physical limitations except when gas prices increase. There is also little awareness of the very strong historical connection in both the US and the world between increased affluence and increased use of energy, especially petroleum. It is not understood by all that many of the economic problems we have now (such as the budgetary problems faced by most of our State governments, pension plans and universities) have substantial origin in the fact that oil and other energy production no longer increase reliably year after year, as they once did (Murphy and Hall 2011). Many economists have argued in the past that energy is not important because it constituted only 5 per cent or so of GDP, or because they believe that market forces and innovations will substitute for any shortage (e.g. Barnett and Morse 1963, Passell et al 1972, Solow 1974, Denison 1989). One problem with that view is that if you remove that five per cent the economy comes to a dead stop, as Cuba found out in 1989 when Russia removed its oil subsidy. Additionally if that five per cent goes up to 10 or 15 per cent, as it did in the early 1980s, and again in 2008, recession steps in (Murphy and
Surface Flux Measurements at King Sejong Station in West Antarctica
Choi, T.; Lee, B.; Lee, H.; Shim, J.
2004-12-01
The Antarctic Peninsula is important in terms of global warming research due to pronounced increase of air temperature over the last century. The first eddy covariance system was established and turbulent fluxes of heat, water vapor, CO2 and momentum have been measured at King Sejong Station (62 \\deg 13øØS, 58 \\deg 47øØW) located in the northern edge of the Antarctic Peninsula since December in 2002. Our objectives are to better understand the interactions between the Antarctic land surface and the atmosphere and to test the feasibility of the long-term operation of eddy covariance system under extreme weather conditions. Various lichens cover the study area and the dominant species is Usnea fasciata-Himantormia. Based on the analyses on turbulent statistics such as integral turbulence characteristics of vertical velocity (w) and heat (T), stationarity test and investigation of correlation coefficient, they follow the Monin-Obukhov similarity and eddy covariance flux data were reliable. About 50 % of total retrieved sensible heat flux data could be used for further analysis. We will report on seasonal variations of energy and mass fluxes and environmental variables. In addition, factors controlling these fluxes will be presented. Acknowledgement: This study was supported by ¡rEnvironmental Monitoring on Human Impacts at the King Sejong Station, Antarctica¡_ (Project PP04102 of Korea Polar Research Institute) and ¡rEco-technopia 21 project¡_ (Ministry of Environment of Korea).
31 CFR 1.25 - Accounting of disclosures.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Accounting of disclosures. 1.25... Privacy Act § 1.25 Accounting of disclosures. (a) Accounting of certain disclosures. Each component, with respect to each system of records under its control, shall: (1) Keep an accurate accounting of: (i) The...
14 CFR 125.75 - Airplane flight manual.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 125.75 Section 125... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Airplane flight manual. (a) Each certificate holder shall keep a current approved Airplane Flight Manual or...
21 CFR 14.125 - Procedures of TEPRSSC.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Procedures of TEPRSSC. 14.125 Section 14.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PUBLIC HEARING...) The agenda and other material to be considered at any meeting will be sent to members whenever...
Early, Mary Frances; Terry, Cynthia
This lesson begins with a very brief biography of Martin Luther King, Jr. The lesson identifies its educational objectives; addresses National Standards for Music Education; lists materials needed; details six step-by-step classroom procedures for lesson implementation; and provides curriculum connections for language arts, visual art, physical…
Energy Technology Data Exchange (ETDEWEB)
Guenther, Ilonka; Hall, Haakan; Halldin, Christer; Swahn, Carl-Gunnar; Farde, Lars; Sedvall, Goeran
1997-10-01
The binding of the three dopamine transporter radioligands ([{sup 125}I]{beta}-CIT, [{sup 125}I]{beta}-CIT-FE, and [{sup 125}I]{beta}-CIT-FP) was studied using whole-hemisphere autoradiography on postmortem human brains. The autoradiograms revealed an intense and homogeneous labeling of the nucleus caudatus and putamen but also to varying extent to serotonergic and noradrenergic transporters of neocortex and thalamus. The order of specificity estimated (striatum over neocortex ratios) was {beta}-CIT-FP > {beta}-CIT-FE >> {beta}-CIT, suggesting that {beta}-CIT-FE and {beta}-CIT-FP should be preferred for in vivo studies of the dopamine transporter in the human brain.
19 CFR 125.2 - Supervision of cartage and lighterage.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of cartage and lighterage. 125.2 Section 125.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARTAGE AND LIGHTERAGE OF MERCHANDISE General Provisions § 125.2 Supervision of cartage and lighterage. All licensed vehicles or...