Abdeen, M. M.; Tewksbury, B.; Abdelsalam, M. G.; Tarabees, E.
2017-12-01
This issue is dedicated to Professor Mohamed El-Bahay Issawi in recognition of his monumental contributions to an understanding of the Phanerozoic evolution of the northern part of Africa. During his long and productive career in the Egyptian Geological Survey and Mining Authority (EGSMA), he was committed to deciphering the geological history and resources of the Phanerozoic of Egypt. Professor Issawi is widely recognized for his influential stratigraphic-tectonic models that were an inspiration for generations of Egyptian geoscientists from the 1960s onward. His models and expertise helped to attract international interest and involvement in fundamental programs of research on the Phanerozoic geology of Egypt and specifically on geoarchaeology.
Analisis Ekosistem TIK Indonesia Untuk Mendorong Perkembangan Industri Local dan Ekonomi Kreatif
Directory of Open Access Journals (Sweden)
Vidyantina Heppy Anandhita
2016-03-01
Full Text Available Abstrak Sektor TIK merupakan pendorong utama pertumbuhan ekonomi sehingga kondisi ekosistem TIK menjadi faktor penting dalam pembangunan. Model New ICT Ecosystem dirumuskan Profesor Martin Fransman membagi ekosistem TIK menjadi 4 layer yaitu elemen jaringan (layer1, jaringan (layer2, platform, konten dan aplikasi (layer3 dan konsumen final (layer 4. Studi ini bertujuan untuk mengetahui peluang dan tantangan bagi pelaku industri ekosistem TIK Indonesia serta rekomendasi strategi pemerintah untuk mendukung pertumbuhan industri TIK local dan ekonomi kreatif. Studi ini menggunakan pendekatan kualitatif, pengumpulan data melalui FGD dan dept interview dengan narasumber pakar TIK, MIKTI, Kementerian Kominfo, Kementerian Perindustrian dan Detiknas. Dari hasil studi, peluang terbesar Indonesia untuk bersaing dalam industri TIK berada dalam layer 3 yaitu industri konten dan aplikasi. Sedangkan melalui analisis SWOT disimpulkan bahwa untuk mendorong pertumbuhan industri local dan ekonomi kreatif diperlukan strategi antara lain kerjasama sektor pemerintah dan swasta untuk membangun inkubasi TIK dan technopark, kebijakan pemerintah memberikan insentif, proteksi maupun promosi kepada industri TIK domestik. Strategi yang dapat dilakukan Pemerintah untuk mengurangi ketergantungan komponen LN dari industri elektronika dan telekomunikasi dengan pelaksanaan rencana aksi peraturan TKDN industri TIK dan fasilitasi akses finansial/pembiayaan bagi industri. Strategi lainnya adalah peningkatan kualitas tenaga kerja TIK dengan fasilitasi sertifikasi kompetensi (SKKNI bidang kominfo. Abstract The ICT sector is an important driver of economic growth. “New ICT Ecosystem” model was formulated by Professor Martin Fransman divides ICT Ecosystem in 4 layers, networked element (layer1,: networks (layer2, platform, content and application (layer3, and final consumer. The purpose of the study was to understand the opportunities and
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. MOHAMMED BELBACHIR. Articles written in Bulletin of Materials Science. Volume 38 Issue 1 February 2015 pp 57-63. Synthesis of poly(furfuryl alcohol)/montmorillonite nanocomposites by direct in-situ polymerization · Djamal Eddine Kherroub Mohammed Belbachir Saad ...
Indian Academy of Sciences (India)
Home; Journals; Sadhana. Mohammed Ashraf. Articles written in Sadhana. Volume 34 Issue 4 August 2009 pp 607-613. Fabrication of polymer-based reflowed microlenses on optical fibre with control of focal length using differential coating technique · Mohammed Ashraf Franck Chollet Murukeshan Matham Chun Yang.
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Mohammed Farooq Ahmed. Articles written in Resonance – Journal of Science Education. Volume 3 Issue 3 March 1998 pp 73-75 Book Review. Physical Chemistry · Mohammed Farooq Ahmed · More Details Fulltext PDF ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. Mohammed Abu-Bajeh. Articles written in Journal of Chemical Sciences. Volume 114 Issue 6 December 2002 pp 675-686. Absolute quantum yield measurements for the formation of oxygen atoms after UV laser excitation of SO2 at 222.4 nm · Mohammed Abu-Bajeh Melanie ...
Mohammed Rafiq Hussain Siddiqui
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. Mohammed Rafiq Hussain Siddiqui. Articles written in Journal of Chemical Sciences. Volume 127 Issue 9 September 2015 pp 1547-1556. Molecular structure investigation and tautomerism aspects of ()-3-benzylideneindolin-2-one · Assem Barakat Abdullah Mohammed ...
Mendes-Junior, Celso Teixeira; Simões, Aguinaldo Luiz
2009-11-01
To study the genetic structure of the Tikúna tribe, four major Native American mitochondrial DNA (mtDNA) founder haplogroups were analyzed in 187 Amerindians from eight Tikúna villages located in the Brazilian Amazon. The central position of these villages in the continent makes them relevant for attempts to reconstruct population movements in South America. In this geographic region, there is particular concern regarding the genetic structure of the Tikúna tribe, formerly designated "enigmatic" due to its remarkable degree of intratribal homogeneity and the scarcity of private protein variants. In spite of its large population size and geographic distribution, the Tikúna tribe presents marked genetic and linguistic isolation. All individuals presented indigenous mtDNA haplogroups. An intratribal genetic heterogeneity pattern characterized by two highly homogeneous Tikúna groups that differ considerably from each other was observed. Such a finding was unexpected, since the Tikúna tribe is characterized by a social system that favors intratribal exogamy and patrilocality that would lead to a higher female migration rate and homogenization of the mtDNA gene pool. Demographic explosions and religious events, which significantly changed the sizes and compositions of many Tikúna villages, may be reflected in the genetic results presented here.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Mohammed A Bin Hussain. Articles written in Bulletin of Materials Science. Volume 38 Issue 7 December 2015 pp 1731-1736. Sintered gahnite–cordierite glass-ceramic based on raw materials with different fluorine sources · Esmat M A Hamzawy Mohammed A Bin Hussain.
Directory of Open Access Journals (Sweden)
Diah Yuniarti
2012-09-01
Full Text Available Industri TIK merupakan bagian dari industri masa depan yang terdiri atas industri perangkat, infrastruktur/jaringan dan aplikasi/konten. Akhir-akhir ini, aspek lingkungan menjadi pertimbangan dalam menciptakan kesinambungan industri, termasuk industri TIK atau yang dikenal dengan istilah TIK hijau. Implementasi TIK Hijau pada penyelenggara telekomunikasi masih menemui beberapa kendala yaitu efisiensi rendah dan investasi tinggi pada penggunaan perangkat TIK berbasis energi alternatif. Selain itu, rencana implementasi TIK Hijau di lembaga pemerintah maupun swasta masih dibayangi isu terkait kekuatan industri dalam negeri. Penelitian ini bertujuan mengukur kesiapan industri manufatur TIK dalam negeri untuk mendukung implementasi TIK Hijau pada sektor telekomunikasi. Pendekatan penelitian menggunakan pendekatan kuantitatif berdasarkan indikator attitude, policy, practice, technology dan governance yang dimodifikasi pada Green IT Readiness Model oleh Molla, Alemayehu, et.al. Berdasarkan analisis LSR, secara umum lima responden industri manufaktur dikategorikan memiliki sikap positif. Indikator yang perlu mendapatkan perhatian dari responden yang tergolong memiliki sikap negatif adalah indikator policy dan governance.
MODEL PEMBERDAYAAN RELAWAN TIK DALAM MENINGKATKAN E-LITERASI MASYARAKAT DI KOTA SUKABUMI
Directory of Open Access Journals (Sweden)
Syarif Budhirianto
2016-10-01
Full Text Available Pemberdayaan masyarakat oleh relawan TIK merupakan langkah strategis menuju e-literasi dalam meningkatkan kualitas kehidupan. Fokus penelitian adalah bagaimana model pembelajaran yang efektif diterapkan pada masyarakat, sehingga transformasi informasi yang dilakukan relawan TIK mudah diserap (absorb the lessons. Untuk membangun persepsi positif dalam pembelajaran, diperlukan studi kualitatif dengan para pemangku kepentingan (stakeholder di Kota Sukabumi berdasar kompetensi empirik yang dimiliki, sehingga dapat memformulasikan model pembelajaran yang diharapkan. Hasil penelitian menunjukkan model pembelajaran dalam meningkatkan e-literasi, adalah dengan melakukan kolaborasi dan koordinasi secara sinergi dengan pemangku kepentingan dan menyatukan misi pembelajaran, selanjutnya melakukan pemetaan berdasar karakteristik masyarakat, seperti minat belajar, kemampuan, dan gaya belajar. Model pembelajaran yang bisa diadaptasikan kepada masyarakat memerlukan media berbasis TIK yang disesuaikan dengan bahan ajar (modul, untuk memerjelas penyajian pesan yang tidak terlalu verbalistis tetapi lebih mengedepankan praktek. Sistem pemaparan yang lebih komunikatif, dengan mengeleminir istilah-istilah TIK yang sulit dipahami akan menunjang percepatan proses belajar secara tepat dan dapat mengatasi sikap pasif anak didik.
PENGARUH KOMPETENSI GURU MATA PELAJARAN TIK TERHADAP MOTIVASI DAN HASIL BELAJAR SISWA
Directory of Open Access Journals (Sweden)
Mr Heri Sutarno
2011-10-01
Full Text Available Penelitian ini dimaksudkan untuk mengetahui sejauh mana kompetensi guru TIK berpengaruh terhadap motivasi dan hasil belajar siswa dalam mata pelajaran TIK. Penelitian ini dilakukan di sebuah sekolah sampel, dengan responden siswa SMA. Penelitian ini menggunakan metode deskriptif kuantitatif dengan metode survey eksplanatory. Analisis data dalam penelitian ini dilakukan dengan 3 (tiga cara, yaitu: Nilai Skala (Nilai Interval, untuk mengetahui kondisi dari masing-masing variabel; Analisis varians (ANOVA satu jalur; dan Korelasi untuk mengetahui keterhubungan variabel. Dari penelitian ini diperoleh hasil bahwa kompetensi pedagogik guru TIK yang ada di sekolah sampel tergolong cukup (56,07%, kompetensi kepribadian tergolong cukup (53,72%, kompetensi sosial tergolong cukup (45,22% dan kompetensi profesional tergolong tinggi (61,20%. Keterhubungan antara kompetensi guru dengan motivasi belajar diperkuat dengan kurangnya tingkat signifikansi sehingga dapat disimpulkan bahwa ada keterhubungan antara keempat kompetensi guru tersebut terhadap motivasi siswa untuk belajar mata pelajaran TIK. Secara parsial hanya kompetensi kepribadian (53,72% dan kompetensi profesional (61,20% yang terbukti dapat mempengaruhi motivasi belajar siswa. Untuk hasil belajar, dari hasil penelitian yang dilakukan ternyata keterhubungan antara kompetensi guru dan motivasi belajar terhadap hasil belajar sangat kecil (50%. Sebagai saran dari penelitian ini yaitu instansi pencetak guru harus memastikan agar mahasiswa yang dididiknya memiliki kemampuan kompetensi guru seperti tertulis dalam PP No. 74 tahun 2008 sehingga dapat meningkatkan motivasi dan hasil belajar siswa, yang pada akhirnya keberadaan guru benar-benar bermakna dalam sebuah pembelajaran. Kata Kunci: guru TIK, kompetensi guru, motivasi, hasil belajar
Ras, Etnisitas, dan Identitas Dalam Novel Batas Langit Karya Mohamed Latiff Mohamed
Directory of Open Access Journals (Sweden)
Ali Mustofa
2008-06-01
Full Text Available This article describes the issues of post-colonialism in one of contemporary Singaporean literatures Batas langit by Mohamed Latiff Mohamed: Post-colonial issues explored in the present paper are race, ethnicity, and identity. Latiff has successfully obscured his views about Malay people and their culture. His views are somewhat skeptical and pessimistic. However, Latiff has been successfully transforming the existentialism views into his works, and has made him one of the great authors of Singapore.
Do employers prefer Mark over Mohammed?
Iris Andriessen; Eline Nievers; Laila Faulk; Jaco Dagevos
2010-01-01
Original title: Liever Mark dan Mohammed? Does Mohammed have less chance of succeeding on the Dutch labour market than Mark, even though they both have the same qualifications and work experience? And are employers less friendly towards Sonaya than Paula? This study investigates the
Indian Academy of Sciences (India)
Home; Journals; Journal of Astrophysics and Astronomy. Mohammed Alanazi. Articles written in Journal of Astrophysics and Astronomy. Volume 38 Issue 1 March 2017 pp 1 Research Article. Preliminary Results of High-Energy Cosmic Ray Muons as Observed by a Small Multiwire Detector Operated at High Cutoff Rigidity.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. I Mohammed Bilal. Articles written in Bulletin of Materials Science. Volume 23 Issue 5 October 2000 pp 425-429 Polymers. Aliphatic amine cured PDMS–epoxy interpenetrating network system for high performance engineering applications—Development and characterization.
The Sidi Mohamed peridotites (Edough Massif, NE Algeria ...
Indian Academy of Sciences (India)
We suggest that the Sidi Mohamed ultramafic body was derived directly from the upper mantle and tectonically ... The aim of this paper is to determine the nature of the peridotite .... REE were enriched using the method described by. Zuleger .... Table 1. Chemical composition of the peridotites from Sidi Mohamed outcrop.
African Journals Online (AJOL)
Mohamed Mahroop, Raja M. Vol 15, No 38 (2016) - Articles Antibacterial potential of silver nanoparticle synthesized by marine actinomycetes in reference with standard antibiotics against hospital acquired infectious pathogens. Abstract PDF. ISSN: 1684-5315. AJOL African Journals Online. HOW TO USE AJOL.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Mohammed Rafiq Abdul Kadir. Articles written in Bulletin of Materials Science. Volume 36 Issue 6 November 2013 pp 1103-1113. Thermal characteristics and corrosion behaviour of Mg–Zn alloys for biomedical applications · Amir Fereidouni Lotfabadi Mohd Hasbullah Idris ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. MOHAMMED R H SIDDIQUI. Articles written in Journal of Chemical Sciences. Volume 129 Issue 9 September 2017 pp 1469-1481 Regular Aricle. Synthesis, crystallographic characterization, DFT and TD-DFT studies of Oxyma-sulfonate esters · SAIED M SOLIMAN HAZEM A ...
Directory of Open Access Journals (Sweden)
Eko Puji Utomo
2011-05-01
Full Text Available Makalah ini membahas tentang perancangan dan pembangunan e-learning berbasis web untuk mata pelajaran TIK. Tujuan dibuat web e-learning TIK ini adalah sebagai pelengkap (komplemen pembelajaran yang sifatnya untuk melengkapi materi pembelajaran, diprogramkan untuk menjadi materi reinforcement (pengayaan atau remedial bagi peserta didik di dalam mengikuti kebiatan pembelajaran konvensional. Sistem dibangun menggunakan PHP dan database SQL dan dikoneksikan dalam jaringan komputer client-server LAN dengan tujuan agar website yang dibangun menjadi lebih terpusat. Tahapan dalam perancangan dan pembangunan e-learning adalah menggunakan metode waterfall system.Hasil pengujian sistem telah berjalan dengan baik tanpa ada bug/error.
Directory of Open Access Journals (Sweden)
Nailil Faroh
2014-02-01
Full Text Available AbstrakPada kurikulum 2013 pelajaran TIK dihilangkan dan terintegrasi pada setiap matapelajaran.Ini menjadi tantangan bagi guru matematika supaya kompetensi TIK siswa tetap ditanamkan di sekolah meskipun pelajaran TIK telah dihilangkan.Skenario model MMPterpadu dengan TIK yaitu siswa diberi tugas terstrukturdengan memanfaatkan TIK pada setiap pertemuan.Tujuan penelitian ini adalahmenghasilkan perangkat pembelajaran yang valid, praktis, dan efektif. Penelitian inimerupakan penelitian pengembangan dengan menggunakan model Borg and Gall.Perangkat pembelajaran yang dikembangkan adalah Silabus, RPP, Buku Siswa,LKS, dan TKPM.Cara pengambilan data dengan dokumen, angket, observasi,wawancara, dan tes. Pengolahan data uji efektifitas dengan uji ketuntasan, ujipengaruh, uji banding, dan uji peningkatan. Hasil penelitian menunjukkan:perangkat pembelajaran yang dikembangkan valid dengan skor rataan 4.14;perangkat pembelajaran yang dikembangkan praktis karena respon positif siswa83,10 % dan skor kemampuan guru mengelola kelas 4,26; pembelajaran matematikaefektif karena rataan hasil TKPM kelas eksperimen 77,33 melebihi KKM = 70,rataan kelas ekperimen lebih tinggi daripada kelas kontrol, ada pengaruh positif kemandirian belajar dan keterampilan pemecahan masalah terhadap kemampuanpemecahan masalah sebesar 79%; serta terdapat peningkatan kemandirian,keterampilan pemecahan masalah, dan kemampuan pemecahan masalah.AbstractIn 2013 curriculum eliminated and integrated ICT lessons in each subject. It’s a challenge formathematics teachers ICT competencies that students stay in school despite the lessons instilledICT has removed.MMP Scenario models integrated with ICT that students are given structuredtasks with the use ICT at each meeting.The purpose this research to producemathematicallearningvalid, practical and effective. This research is development of model Borg and Gall. Learning device was developed syllabus, lesson plans, Student Book, worksheets
Review: Mohamed Saliou Camara, Political History of Guinea since World War Two (2014)
Carole Ammann; University of Basel
2015-01-01
Review of the monograph:Mohamed Saliou Camara, Political History of Guinea since World War Two, New York: Peter Lang, 2014, ISBN 9781433122439, 531 pp. Besprechung der Monographie:Mohamed Saliou Camara, Political History of Guinea since World War Two, New York: Peter Lang, 2014, ISBN 9781433122439, 531 Seiten
Mohamed - tark mees maa all / Mari Aigro
Aigro, Mari
2008-01-01
Tallinnas Vabaduse väljaku tunnelis idamaiste toodete poodi pidav egiptlane Mohamed Gamal Abdelmeged El Maayergy on Eestis elanud kolm aastat. Lisaks oma äri pidamisele on tal käsil kaks ülikooli : ta õpib Tallinna Ülikoolis antropoloogiat ja Tallinna Tehnikaülikoolis ärijuhtimist
A Tribute to Professor Steven L. Wechsler (1948-2016): The Man and the Scientist.
Nesburn, Anthony B; BenMohamed, Lbachir
2017-01-01
Professor Steven L. Wechsler, a world-renowned eye researcher and virologist, passed away unexpectedly on June 12, 2016 at the age of 68. Many scientists came to know Professor Wechsler as a gifted researcher in the field of ocular Herpes Simplex Virus (HSV-1) latency, reactivation, and pathogenesis. Professor Wechsler published over 150 peer-reviewed scientific papers during his career, pushing forward the frontiers of his field eye research. His colleagues would say, 'Steve literally wrote the book on herpes latency and reactivation.' He was the first to show that the HSV-1 latency-associated transcript (LAT) is essential for the HSV-1 high spontaneous reactivation phenotype and that LAT has anti-apoptosis activity. This discovery of LAT's anti-apoptosis activity, which is a key factor in how the LAT gene enhances reactivation, was published in Science in 2000 and created a new paradigm that greatly increased understanding of HSV-1 latency and reactivation. In collaboration with Professor Lbachir BenMohamed, an immunologist, they later demonstrated that LAT also acts as an immune evasion gene. He was a caring scientist who truly enjoyed working and sharing his experience and expertise with young researchers. He will be remembered as a significant pillar within scientific and ocular herpes research communities worldwide. Professor Wechsler's dedication to science, his compassionate character, and wonderful sense of humor were exemplary. We, who were his friends and colleagues, will mourn his passing deeply.
Twee kwesties naar aanleiding van het vonnis tegen Mohammed B.
van Hattum, W.F.; de Jong, D.H.
2006-01-01
Aan de hand van twee kwesties rond de berechting van Mohammed B. willen wij laten zien dat een enge interpretatie van het strafprocesrecht - bijvoorbeeld een opvatting die voornamelijk uitgaat van het verdedigingsbelang - tekort kan doen aan het doel van het strafproces. In dat proces is ook plaats
Novel RepA-MCM proteins encoded in plasmids pTAU4, pORA1 and pTIK4 from Sulfolobus neozealandicus
DEFF Research Database (Denmark)
Greve, B.; Jensen, S.; Phan, H.
2005-01-01
Three plasmids isolated from the crenarchaeal thermoacidophile Sulfolobus neozealandicus were characterized. Plasmids pTAU4 (7,192 bp), pORA1 (9,689 bp) and pTIK4 (13,638 bp) show unusual properties that distinguish them from previously characterized cryptic plasmids of the genus Sulfolobus. Plas...
Directory of Open Access Journals (Sweden)
Regina M. de Carvalho Erthal
2001-03-01
Full Text Available O objetivo deste trabalho é buscar um entendimento a respeito da ocorrência de suicídios entre os índios Tikúna do Alto Solimões (Amazonas, um objeto de difícil aproximação e que aponta para a necessidade de abordagem interdisciplinar. A etnografia realizada preocupou-se em captar a vinculação entre os eventos de suicídio da última década com a exacerbação dos confrontos entre diferentes grupos faccionais que atualizam, em outro contexto histórico, os mecanismos de resolução de conflitos próprios das antigas malocas. Na base desses confrontos está o abandono a que tal população tem sido submetida pelos órgãos responsáveis pela definição e implementação das políticas públicas para as populações indígenas, com especial destaque para a falência do modelo de assistência proposto para a área do Alto Solimões.This study focuses on suicide among the Tikúna Indians on the Upper Solimões River in the Brazilian Amazonia. The very nature of the object requires an interdisciplinary approach. The ethnography is concerned with capturing links among suicides occurring over the last decade, in the process of confrontation between different factions or groups that express, in the present, an older historical context, the mechanisms of conflict characterizing the ancient malocas, or indigenous lodges. At the very base of such confrontations lies the abandonment inflicted on this population, especially the bankruptcy of the health care model proposed for the Upper Solimões area.
Directory of Open Access Journals (Sweden)
Sri Wahyuni
2017-02-01
Full Text Available Programming is a basic skill in computing (Teknologi Informasi dan Komunikasi–TIK feld. In our school partners located at Bangkalan, the teachers of computing course have non-computing background (physics, mathematics, biology. Tis condition means that their programming skill is not good enough. Tis is certainly a suboptimal circumstance since teacher’s mastery of a subject has a lot to do with the success of the teaching-learning process. Computer olympics (olimpiade komputer is a programming competition for high school students. It has two kinds of tests. Tey were mathematical logic and programming problem solving. Because of the lacking in teacher’s programming skill, the preparation event focused only on mathematical logic. Tis approach had led the students to pass through frst/city selection, but it was not enough to pass the second/provincial selection. In this community service, we gave programming learning modules to the school partners and also train them about pascal programming. Te initial targets were TIK teachers who were also the preparation event coaches. Afer several considerations, we asked the schools to also send their best students as participants for the training. Te purpose were to not only prepare the current participant team, but also to support the regeneration of future teams. By the end of this activity, our partners’ teachers and students have had a better pascal programming skills. Tis result is shown in the increasing scores they get in their pre, mid, and fnal training evaluations.
Ain’t No Neuroscience Mountain High Enough: Experiences of a Neurogardener
ABDULLAH, Jafri Malin
2015-01-01
16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato’ Dr Johari Siregar Bin Adnan, Dato’ Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato’ Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato’ Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history. PMID:26715890
Ain't No Neuroscience Mountain High Enough: Experiences of a Neurogardener.
Abdullah, Jafri Malin
2015-01-01
16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato' Dr Johari Siregar Bin Adnan, Dato' Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato' Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato' Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history.
Ain’t No Neuroscience Mountain High Enough: Experiences of a Neurogardener
ABDULLAH, Jafri Malin
2015-01-01
16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato’ Dr Johari Siregar Bin Adnan, Dato’ Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato’ Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato’ Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history.
Nimekad lektorid TLÜ suveülikoolis
2009-01-01
Juuli teises pooles saabuvad Tallinna ülikooli rahvusvahelisse suveülikooli õpetama USA filosoof, kirjanik ja tõlkija Alphonso Lingis, Briti kultuuripoliitika analüütik ja Londoni ülikooli professor Kate Oakley ning Kanadas elav Briti kirjanik Kathy Page
Student Evaluations of College Professors: Are Female and Male Professors Rated Differently?
Basow, Susan A.; Silberg, Nancy T.
1987-01-01
Over 1,000 undergraduates evaluated 16 male and female professors in terms of teaching effectiveness and sex-typed characteristics. Male students gave female professors significantly poorer ratings than male professors on the six teaching evaluation measures. Female students evaluated female professors less favorably than male professors on three…
Analysis and Geometry : MIMS-GGTM, in Honour of Mohammed Salah Baouendi
Kacimi, Aziz; Kallel, Sadok; Mir, Nordine
2015-01-01
This book includes selected papers presented at the MIMS (Mediterranean Institute for the Mathematical Sciences) - GGTM (Geometry and Topology Grouping for the Maghreb) conference, held in memory of Mohammed Salah Baouendi, a most renowned figure in the field of several complex variables, who passed away in 2011. All research articles were written by leading experts, some of whom are prize winners in the fields of complex geometry, algebraic geometry and analysis. The book offers a valuable resource for all researchers interested in recent developments in analysis and geometry.
DEFF Research Database (Denmark)
Hansen, Henrik
2014-01-01
DEBAT: Danske bistandskroner skal øge den interregionale handel i Afrika - det skaber vækst i Afrika og indirekte handel med danske virksomheder, mener Henrik Hansen, professor ved Økonomisk Institut på KU.......DEBAT: Danske bistandskroner skal øge den interregionale handel i Afrika - det skaber vækst i Afrika og indirekte handel med danske virksomheder, mener Henrik Hansen, professor ved Økonomisk Institut på KU....
Professor Igor Yevseyev: In Memoriam Professor Igor Yevseyev: In Memoriam
2012-06-01
Dear readers and authors, June 3, 2012 will mark five months since Professor Igor Yevseyev, Deputy Editor-in-Chief of both journals Laser Physics and Laser Physics Letters passed away, suddenly and unexpectedly. He was 67. Born in Moscow, he entered one of the world's best schools of physics, Moscow Engineering Physics Institute (MEPhI). With this renowned educational and research institution he bonded an alliance for his entire life, starting as an undergraduate student in the Department of Theoretical Physics and later continued as graduate student, assistant professor, associated professor, and full professor in the same department, a rare accomplishment of a person. All those years he retained the love of his life—the love for physics. He worked tirelessly as a teacher and scholar in this captivating field of knowledge. Professor Yevseyev was one of the founders of the international journal of Laser Physics in 1990, the first academic English language journal published in the former USSR. Later, in 2004, the second journal, Laser Physics Letters was brought to the forum of global laser physics community. The idea behind this new title was Professor Yevseyev's initiative to reach the readers and participants with new pioneering and break-through research results more rapidly. His leadership and indefatigable dedication to the quality of published materials made it possible that this journal reached international recognition in a few short years. Still, in order to attract even more attention of potential contributors and readers, Professor Yevseyev originally proposed to conduct the International Laser Physics Workshop (LPHYS) on the annual basis. Since 1992 the Workshop has been conducted every year, each year in a different country. As in all previous years, Professor Yevseyev was the key organizer of this year's workshop in Calgary, Canada. Sadly, this workshop will take place without him. Editorial Board
Directory of Open Access Journals (Sweden)
Ni Made Dwi Antari
2016-10-01
Abstract TIK learning must have to prepared student’s activities and creativities to obtained the own knowledge by means of learning process. An appropriate learning model election agree with students characteristics would help an success learning. The comparative study research would have to compared both of learning model, to know which model was better. This research aimed to know (1 The influenced about the result of students’ TIK study used Talking stick and Snowball Throwing learning model (2 the highest result of study between Talking stick and Snowball Throwing learning model (3 the students’ response toward Talking stick and Snowball Throwing learning model application. Kind of this research was quasi experiment by Post Test Only with Non Equivalent Control Group Design. The data accumulation done by multiple choice tests to measured cognitive domain and skill test to psychomotor domain. The students’ result study analyzed by prerequisite test was normality test and homogeneity by the result of the three group which normal distribution and homogeneous, continued by hypothesis test used a strip Anova then continued by t-Sheffe The result of one way onova exist a significance influenced on the used of Talking Stick leaarning model, Snowball Throwing and conventional. Because of thee was a significance difereences between each partner. Afterwards, seen from the result average of study can be concluded the Talking Stick learning model better than the higest result average of study. Meanwhile, the respond of used questionnaire method, the result of Talking stick model questionnaire known 36% very positive responses, 61% positive responses and 3% positive sufficient responses. Then, Snowball Throwing model known 25% very positive responses, 67% positive responses, and 8% positive sufficient responses. Keywords : The Comparrative Study, TIK, Talking stick, Snowball Throwing, the study result, students’ respond
Mohamed VI y la paradoja de la transición marroquí.
Desrues, Thierry
2000-01-01
En este artículo se analiza algunos aspectos del primer año de Mohamed VI en el trono de Marruecos. El nuevo soberano ha sido presentado como la encarnación del cambio al tiempo que éste ha situado su reinado bajo el signo de las reformas. Por ello, dicho análisis se enmarca dentro del debate sobre la transición democrática haciendo hincapié, por un lado, en el peso de las inercias heredadas del pasado así como en las nuevas oportunidades que pueden surgir bajo la presión de las n...
Autonomia profissional dos professores
Guerra, Teresa P.; Veiga, Feliciano
2007-01-01
Este estudo pretendeu analisar as representações dos professores acerca da sua autonomia em contexto escolar, com recurso a uma amostra de 203 professores de ambos os sexos, pertencentes a escolas dos distritos de Lisboa, Setúbal, Leiria e Aveiro. Utilizou-se a Escala de Autonomia Profissional dos Professores (EAPP).
TALAQIY AL-TAGHRIDAH AL-SYI’RIYAH HISAB AL-SYA’IR MOHAMMED ALMOQREN ANMUDZAJAN
Directory of Open Access Journals (Sweden)
Zafer Moshbbab Mohammad Alkinani
2017-06-01
Full Text Available This contemporary age faced large technical revolutions which have huge effects on all life areas. These technical revolutions cause dramatic changes in human natures particularly in terms of consumptions and communication. Therefore, the literature and its branches could not be separated from these technical age influences as the literature interacted with these evolutionary products and employed this age resources. Therefore, the focus of this study was the perception of poetical tweets on a Twitter account belonged to a poet namely Mohammed Almoqren. The steps of this study covered interjection, rerouting, written interaction, contradiction, visual shaping, dynamic shaping, summary and conclusion.
2013-03-01
... DEPARTMENT OF STATE [Public Notice 8210] Designation of Malang Wazir, Also Known as Wali Mohammed..., acts of terrorism that threaten the security of U.S. nationals or the national security, foreign policy, or economy of the United States. Consistent with the determination in section 10 of Executive Order...
O suicídio Tikúna no Alto Solimões: uma expressão de conflitos
Directory of Open Access Journals (Sweden)
Regina M. de Carvalho Erthal
Full Text Available O objetivo deste trabalho é buscar um entendimento a respeito da ocorrência de suicídios entre os índios Tikúna do Alto Solimões (Amazonas, um objeto de difícil aproximação e que aponta para a necessidade de abordagem interdisciplinar. A etnografia realizada preocupou-se em captar a vinculação entre os eventos de suicídio da última década com a exacerbação dos confrontos entre diferentes grupos faccionais que atualizam, em outro contexto histórico, os mecanismos de resolução de conflitos próprios das antigas malocas. Na base desses confrontos está o abandono a que tal população tem sido submetida pelos órgãos responsáveis pela definição e implementação das políticas públicas para as populações indígenas, com especial destaque para a falência do modelo de assistência proposto para a área do Alto Solimões.
Directory of Open Access Journals (Sweden)
Sara L. Sohr-Preston
2016-09-01
Full Text Available Undergraduate psychology students rated expectations of a bogus professor (randomly designated a man or woman and hot versus not hot based on an online rating and sample comments as found on RateMyProfessors.com (RMP. Five professor qualities were derived using principal components analysis (PCA: dedication, attractiveness, enhancement, fairness, and clarity. Participants rated current psychology professors on the same qualities. Current professors were divided based on gender (man or woman, age (under 35 or 35 and older, and attractiveness (at or below the median or above the median. Using multivariate analysis of covariance (MANCOVA, students expected hot professors to be more attractive but lower in clarity. They rated current professors as lowest in clarity when a man and 35 or older. Current professors were rated significantly lower in dedication, enhancement, fairness, and clarity when rated at or below the median on attractiveness. Results, with previous research, suggest numerous factors, largely out of professors’ control, influencing how students interpret and create professor ratings. Caution is therefore warranted in using online ratings to select courses or make hiring and promotion decisions.
African Journals Online (AJOL)
occupational exposure is 16% and for work-exacerbated asthma around 10%.3,4 ... Mohamed Jeebhay is a Professor of Occupational Medicine at the University of Cape Town. He convenes .... (obtain material safety data sheets. (MSDs) for ...
Sohr-Preston, Sara L.; Boswell, Stefanie S.; McCaleb, Kayla; Robertson, Deanna
2016-01-01
A sample of 230 undergraduate psychology students rated their expectations of a bogus professor (who was randomly designated a man or woman and "hot" versus "not hot") based on ratings and comments found on RateMyProfessors.com. Five professor qualities were derived using principal components analysis: dedication,…
Directory of Open Access Journals (Sweden)
Ana Luiza de Quadros
2016-06-01
Full Text Available In the last years, higher education teacher training has received more didactic-pedagogical attention. Despite numerous criticisms to professors' work, some practices present differentials that make them a reference to students, even among university professors with undergraduate and graduate degrees in their specific areas of knowledge. To analyze the classes of such professors who become a reference to students, we selected two higher education professors of chemistry and videotaped their classes seeking to identify the teaching strategies that they use. After analysis, we shared the results with the subjects and complemented them with a semi-structured interview. We found out that these professors perform based on counter-models of professors who they had had in their undergraduate courses and developed strategies aiming to minimize for their students the difficulties they themselves had experienced.
Accounting Professor Qualification in Digital Age: A Perception Study on Brazilian Professors
Vendruscolo, Maria Ivanice; Behar, Patrícia Alejandra
2015-01-01
This papers aims at analyzing the perception of Accounting professors about the necessary qualifications in Accounting undergraduate courses. The contribution of this study is to theoretically discuss the education of Accounting professors, with empirical data, because Accounting teaching requires specific competencies in the digital area. The…
Happy Birthday Professor Telegdi
2002-01-01
Professor Telegdi, pictured with Luciano Maiani and Alexander Skrinsky, receiving the medal of foreign member of the Russian Academy of Sciences in June 2000. Professor Valentine Telegdi celebrated his 80th birthday on Friday, 11th January. A brilliant American physicist of Hungarian origin, Professor Telegdi was a professor at the University of Chicago, the Swiss Federal Institute of Technology in Zurich (ETHZ) and the California Institute of Technology and took part in many CERN experiments, of which NA10 and L3 were the most recent. He served as Chairman of CERN's Scientific Policy Committee from 1981 to 1983. A member of numerous scientific academies, he shared the prestigious Wolf Prize with Maurice Goldhaber in 1991 in recognition of their separate seminal contributions to nuclear and particle physics, particularly those concerning weak interactions involving leptons.
Directory of Open Access Journals (Sweden)
Gemma-Louise Davies
2015-10-01
Full Text Available Professor Michael Levitt (Stanford University, USA won the 2013 Nobel Prize in Chemistry for the development of multiscale models for complex chemical systems—computational tools which can calculate the course of chemical reactions. Professor Levitt was born in Pretoria, South Africa; he came to the UK on a summer vacation aged 16, where he decided to stay and study for his A‑levels. His interest in the physics of living systems drove him to study biophysics at King’s College London, before securing a PhD position at the Laboratory of Molecular Biology in Cambridge. In the interim year between his degree and beginning his PhD, Professor Levitt worked at the Weizmann Institute of Science in Israel, where he met his future wife. They married later that year and moved to Cambridge, where their three children were born. After completing his PhD, he spent time working in Israel, Cambridge, the Salk Institute and Stanford (both California. Since 1986, he has split his time between Israel and California. Outside of science, he is a keen hiker and he is well-known to have attended the eclectic ‘Burning Man’ Festival in California.[1] Professor Levitt visited the University of Warwick to speak at the Computational Molecular Science Annual Conference in March 2015. In this interview, Dr Gemma-Louise Davies, an Institute of Advanced Study Global Research Fellow, spoke to Professor Levitt about the importance of Interdisciplinarity in his field, role models in Academia, and his plans for the future. Image: Professor Michael Levitt (left with Dr Scott Habershon (right, organiser of the 2015 Computational Molecular Science Annual Conference during his visit to the University of Warwick in March 2015. [1] ‘Burning Man’ is a unique annual festival dedicated to community, art, music, self-expression and self-reliance. Tens of thousands of people flock to this temporary metropolis built in the Californian desert.
"Almost at War". The Mohammed Cartoon Crisis in Norwegian Media
Directory of Open Access Journals (Sweden)
Solveig Steien
2008-04-01
Full Text Available In January and February 2006, Norwegians witnessed the burning of their national flag in Palestine, the burning of Norwegian embassies and consulates in Syria, Lebanon and Iran; all simply because twelve Danish Mohammed cartoons from Jyllands-Posten had been reprinted in Norway; the cartoons were published in a marginal Christian conservative weekly newspaper, Magazinet, three months after their original appearance in Denmark. In February 2006 the Norwegian ISAF-forces in Afghanistan were attacked. This conflict had a surprising impact on domestic and foreign policy, and the Norwegian publication of the cartoons triggered a global escalation of the controversy; Norwegian newspapers wrote that the country was "almost at war". I have focused on how some leading Norwegian newspapers (Aften, Aftenposten, Dagbladet, Dagens Næringsliv, Dagsavisen and VG covered this unexpected crisis and studied the different discourses that became a substantial part of the media coverage. In my analysis I have used an overall approach of War versus Peace journalism. War and Peace journalism was not created as a concept for analysing media texts or photographs, but to provide practical tools for journalists in the field of conflict and war situations. Nevertheless, this approach gives an opportunity to examine the results of journalistic work and compare them with the press'es ideals and ethical codes. At the same time, the occurrence of discourses like "clash of civilisations", freedom of speech, "us" versus "them", i.e., "us" versus the Muslims, and the newspapers' choice of sources for their stories, seem to fit with a model of War and Peace journalism. The focus is on opinion materials like editorials and comments, as well as on domestic reports and reportage by correspondents. By analysing samples of articles I have tried to outline some areas where the concept of Peace versus War journalism still needs to be developed, in order to become a comprehensive or more
Professor Igor Yevseyev: In Memoriam
International Nuclear Information System (INIS)
2012-01-01
Dear readers and authors, June 3, 2012 will mark five months since Professor Igor Yevseyev, Deputy Editor-in-Chief of both journals Laser Physics and Laser Physics Letters passed away, suddenly and unexpectedly. He was 67. Born in Moscow, he entered one of the world's best schools of physics, Moscow Engineering Physics Institute (MEPhI). With this renowned educational and research institution he bonded an alliance for his entire life, starting as an undergraduate student in the Department of Theoretical Physics and later continued as graduate student, assistant professor, associated professor, and full professor in the same department, a rare accomplishment of a person. All those years he retained the love of his life—the love for physics. He worked tirelessly as a teacher and scholar in this captivating field of knowledge. Professor Yevseyev was one of the founders of the international journal of Laser Physics in 1990, the first academic English language journal published in the former USSR. Later, in 2004, the second journal, Laser Physics Letters was brought to the forum of global laser physics community. The idea behind this new title was Professor Yevseyev's initiative to reach the readers and participants with new pioneering and break-through research results more rapidly. His leadership and indefatigable dedication to the quality of published materials made it possible that this journal reached international recognition in a few short years. Still, in order to attract even more attention of potential contributors and readers, Professor Yevseyev originally proposed to conduct the International Laser Physics Workshop (LPHYS) on the annual basis. Since 1992 the Workshop has been conducted every year, each year in a different country. As in all previous years, Professor Yevseyev was the key organizer of this year's workshop in Calgary, Canada. Sadly, this workshop will take place without him. Editorial Board
van Laanen, F.
2005-01-01
Op 21 juli 2005 werd in de media bericht dat de Rechtbank Amsterdam de verdachte Mohammed B. zou dwingen tot het aanhoren van de uitspraak in de strafzaak die tegen hem werd gevoerd, onder meer betreffende de moord op Theo van Gogh. De verdachte was al eerder verplicht om te verschijnen bij het
Alharbi, Wafa Owaydhah; Alturki, Khaled Ibrahim
2018-01-01
The study aimed to identify the degree of social media contribution to reinforcing digital citizenship meaning from the viewpoint of female students at Imam Mohammed bin Saud Islamic University in Riyadh. The study was an attempt to answer the following two questions in order to achieve the objectives of the study: To which extent does SnapChat…
Patrice Loiez
1999-01-01
Visit of Professor Shigehiko Hasumi. President of Tokyo University, Japan, Professor Kazuo Okamoto, Head of Graduate School of Mathematical Sciences, Professor Toshiteru Matsuura, Head of Graduate School of Arts and Sciences
DEFF Research Database (Denmark)
Larsen, Torben
2013-01-01
En samling af væsentlige artikler, og diskussion, om stormflod skrevet af professor Torben Larsen, Aalborg Universitet. Torben Larsen diskuterer i artiklerne et forslag om at lukke Thyborøn Kanal for at mindske risikoen for stormflod og oversvømmelse langs Limfjordens byer.......En samling af væsentlige artikler, og diskussion, om stormflod skrevet af professor Torben Larsen, Aalborg Universitet. Torben Larsen diskuterer i artiklerne et forslag om at lukke Thyborøn Kanal for at mindske risikoen for stormflod og oversvømmelse langs Limfjordens byer....
2014-06-01
Chairpersons Dr Dinesh Sathyamoorthy, Science & Technology Research Institute for Defence (STRIDE), Ministry of Defence, Malaysia Associate Professor Sr Dr Abdul Rashid Mohamed Shariff, Universiti Putra Malaysia (UPM), Malaysia Dr Ahmad Fikri Abdullah, Universiti Putra Malaysia (UPM), Malaysia Dr Farrah Melissa Muharram, Universiti Putra Malaysia (UPM), Malaysia Members Professor Dr Li Jing, Beijing Normal University, China Professor Dr Iyyanki Muralikrishna, Administrative Staff College of India (ASCI), India Professor Dr Alias Abdul Rahman, Universiti Teknologi Malaysia (UTM), Malaysia Professor Dr Ismat Mohamed El Hassan, King Saud University, Saudi Arabia Professor Dr George Miliaresis, Open University of Cyprus, Cyprus Professor Dr Christine Pohl, Universiti Teknologi Malaysia (UTM), Malaysia Professor Dr Mahender Kotha, Goa University, India Associate Professor Dr Paolo Gamba, University of Pavia, Italy Associate Professor Dr Behara Seshadri Daya Sagar, Indian Statistical Institute (ISI), India Associate Professor Sr Ranjit Singh, Infrastructure University Kuala Lumpur (IUKL), Malaysia Associate Professor Dr Abdul Nasir Matori, Universiti Teknologi Petronas (UTP), Malaysia Associate Dr Lucian Dragut, West University of Timişoara, Romania Associate Professor Dr Saied Pirasteh, Islamic Azad University, Iran Associate Professor Dr Peter Yuen, Cranfield University, United Kingdom Associate Professor Dr Lim Hwee San, Universiti Sains Malaysia (USM), Malaysia Associate Professor Dr Wayan Suparta, Universiti Kebangsaan Malaysia (UKM), Malaysia Associate Professor Dr Tuong Thuy Vu, The University of Nottingham Malaysia Campus, Malaysia Associate Professor Dr Maged Mahmoud Marghany, Universiti Teknologi Malaysia (UTM), Malaysia Associate Professor Dr Rami Al-Ruzouq, University of Sharjah, UAE Associate Professor Dr Biswajeet Pradhan, Universiti Putra Malaysia (UPM), Malaysia Associate Professor Dr Helmi Zulhaidi Mohd Shafri, Universiti Putra Malaysia (UPM), Malaysia
ICT Use by Journalism Professors in Colombia
Hung, Elias Said
2011-01-01
This article analyses how journalism professors at Colombian universities use information and communications technologies (ICT) in their teaching. Survey data was obtained during the first trimester of 2009 from 63 professors in journalism departments and from a total of 865 professors who are affiliated with journalism departments at 29…
Remembering for tomorrow: Professor Mansour Ali Haseeb.
Salih, Mustafa Abdalla M
2013-01-01
This is a highlight of the obituary ceremony in tribute to Professor Mansour Ali Haseeb (1910 - 1973), organized by the Medical Students Association of the Faculty of Medicine, the University of Khartoum (U of K). Professor Haseeb has been the first Sudanese Professor and first Dean of the Faculty of Medicine. He was an outstanding humane teacher, mentor and researcher, and was awarded the international Dr. Shousha Foundation Prize and Medal by the WHO. He was also an active citizen in public life and became Mayor of Omdurman City. The obituary ceremony reflected the feelings of the medical community and included speeches by Professor Abdalla El Tayeb, President of U of K; the Dean, Faculty of Medicine; the Late Professor Haseeb's colleagues and students, His family representative, and an elegy poem.
DEFF Research Database (Denmark)
Kaas, Eigil
2010-01-01
Det er koldt, og det har det været længe. Sammen med sneen har det en selvforstærkende effekt på vintervejret, forklarer professor og meteorolog. Kulde: - Det er koldt, fordi vinden kommer fra et sted, hvor det er koldt. Det er den enkle forklaring på, at Danmark og store dele af Europa lige nu...... oplever meget lave temperaturer - og for Danmarks vedkommende en usædvanlig lang periode med vintervejr. Forklaringen kommer fra professor Eigil Kaas fra Niels Bohr Instituttet ved Københavns Universitet. Han forklarer til jp.dk, at vintervejret dog er betinget af den mere eller mindre tilfældige måde...
Dr. Rudolph Binion: professor, mentor, psychohistorian.
Szaluta, Jacques
2015-01-01
As the title of my paper indicates, Dr. Rudolph Binion was my professor, mentor, and a leading psychohistorian. My paper in memoriam to Rudolph Binion is intended as both a retrospective and an introspective account of my relationship with him, as he had a pivotal influence on me when he was my professor at Columbia University. His help and influence continued after I left graduate school. In my paper I also deal with the enormous stresses of navigating through graduate school, for those students whose goal was to earn the Ph.D. degree. Some examinations were dreaded, For Example The "Examination in Subjects," popularly called the "Oral Exam." The "incubation" period was long indeed, frequently averaging nearly ten years, and it was an ordeal, as the rate of attrition was very high. There is then also the question of "ego strength" and that of "transference" toward the professor. Graduate school is indeed a long and strenuous challenge. I took a seminar in modern French history, a requirement for the Master's degree with Professor Binion, which was consequential for me, as he taught me to be objective in writing history. Professor Binion was a demanding and outstanding teacher.
In commemoration of professor V.P. Karpov
Directory of Open Access Journals (Sweden)
Semyonova L.S.
2013-10-01
Full Text Available This article is about professor Karpov V.P., a prominent scientist, first rector of Yekaterinoslav Medical Academy. Biography of a great investigator, his main achievements in the area of histology, biology, theory and history of medicine was studied. Professor Karpov V.P. always combined his great scientific, organizational and research work with social activity. Monographs of professor Karpov V.P. and conferences organized by him were of great importance in the solution of such new problems as theary of microscope and cell amitosis. Professor Karpov is a founder of a large school of histology. Thanks to his active participation and personal guidance, in 1917 department of histology was founded in Yekaterinoslav Medical Institute. The author of the article has analyzed Hippocrates` works translated into Russian by professor Karpov V.P. and pointed out their significance for modern medical science and practice.
Teaching Ethos of Reference Professors
Directory of Open Access Journals (Sweden)
Jules Marcel
2018-03-01
Full Text Available The present article discusses the teaching ethos of professors who are recognized for their good practice as trainers. The aim of our study is to analyze the influences of such professors’ professional constitution, as well as the explicit and/or tacit teaching knowledge they mobilize in their teaching practices. Based on Shulman, Gauthier, Tardif and Polanyi, we conducted interviews with three professors described by their students as reference. They were also observed in their classes, in the context of an undergraduate program in pedagogy at a public university. Data show similarities between the practices of the investigated professors, as well as a consistent description of their didactics, which is marked by intellective, moral, emotional and behavioral features.
Perda da voz em professores e não professores Voice loss in teachers and non-teachers
Directory of Open Access Journals (Sweden)
Kelly Park
2009-01-01
Full Text Available OBJETIVO: Verificar a percepção de professores e não-professores sobre as implicações de uma eventual perda de voz. MÉTODOS: Participaram 205 indivíduos sendo 105 professores e 100 não professores entre 23 a 65 anos, 106 mulheres e 99 homens. Foi aplicado um questionário contendo quatro perguntas referentes a uma eventual perda de visão, audição, voz e deambulação e o grau de impacto inferido (de 0 a 4. RESULTADOS: Para o grupo de professores, não enxergar gerou o maior impacto negativo (média de 3,8, seguido por não andar (média de 3,7, não ter voz (média de 3,7 e não ouvir (média de 3,6. Para o grupo de não-professores, não enxergar também gerou o maior impacto negativo (média de 3,4, seguido por não andar (média de 3,0; não ouvir (média de 2,2 e não ter voz (média de 2,0. Em relação ao maior impacto de uma eventual perda da voz, professores indicaram prejuízos no trabalho, relacionamento social e atividades rotineiras e, no grupo de não professores, nas atividades rotineiras, trabalho, relacionamento social e manifestações das emoções. CONCLUSÕES: Os professores valorizam sua voz de modo diverso dos não-professores e ambos os grupos avaliam a perda da voz como algo que não acarreta consequências negativas. Apesar de o professor perceber mais o impacto de um eventual problema de voz do que o não-professor, os sentimentos em relação à perda da voz foram muito semelhantes nos dois grupos.PURPOSE: To investigate teachers' and non-teachers' perception regarding the implications of an eventual loss of voice. METHODS: Participated in the study 205 individuals (106 women and 99 men, 105 teachers and 100 non-teachers, with ages varying from 23 to 65 years old. The participants were asked to answer a questionnaire with four questions regarding an eventual loss of vision, hearing, voice and deambulation, and the inferred impact degree (from 0 to 4. RESULTS: For the teachers group, not being able to see
22 CFR 62.20 - Professors and research scholars.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professors and research scholars. 62.20 Section... Specific Program Provisions § 62.20 Professors and research scholars. (a) Introduction. These regulations govern Exchange Visitor Program participants in the categories of professor and research scholar, except...
In Conversation with: Professor Liz Thomas
Directory of Open Access Journals (Sweden)
Karen Nelson
2012-08-01
Full Text Available Editors Karen Nelson, John Clarke and Sally Kift interview Professor Liz Thomas, Director of the Widening Participation Research Centre at Edge Hill University. She is also Lead Adviser Retention and Success at the Higher Education Academy, England. Professor Thomas was one of the keynote speakers at the 15th International First Year in Higher Education Conference held in Brisbane, Australia from the 26th – 29th of June, 2012. Professor Thomas joined the Journal Editors at the conclusion of the main conference program to explore some of the key themes raised in her address.
Satisfaction among accounting professors in Brazil
Directory of Open Access Journals (Sweden)
Tamires Sousa Araújo
Full Text Available ABSTRACT The aim of this study was to identify the prevalence of satisfaction among accounting professors in Brazil throughout their careers. The research is classified as descriptive and used a quantitative approach to data analysis. 641 valid responses were obtained from professors from all regions of Brazil. The results show that a feeling of satisfaction prevails among accounting course professors, as most of them “like the profession” and, in general, "are satisfied with it”. It was found that levels of satisfaction are higher among individuals with more experience, in that in their first years in the job (one to three years, professors have lower satisfaction rates; the highest levels of satisfaction are found in the final stage (over 35 years. The main factor that influences satisfaction is personal fulfillment (teaching work and relationship with students. It was also possible to identify that positive feelings about teaching predominate (67.3% compared to negative ones (32.7%. These results show the need for greater attention to be paid in the early years of the career in order to avoid a "reality clash". They also show the need for other studies to investigate how the phases in the life cycle of accounting professors are characterized.
Weibel, Peter; Ord, Garnet; Rössler, Otto
2005-01-01
Space and Time are the prison bars of reality. Space Time Physics and Fractality is an attempt to tunnel through the rigidity of it all -- by turning everything into dust or smoke. These two ancient traditions are brought together here for the first time -- in the spirit of Democritus and Anaxagoras. Mohamed El Naschie, the sexagenarian, is the "dust dragon". The book contains papers by people who are infected by the same virus of desperately wanting to understand, and represents an incomparable breakthrough.
As interações professor-professor na co-construção dos projetos pedagógicos na escola
Directory of Open Access Journals (Sweden)
Mírian Raposo
Full Text Available A qualidade das interações entre professores é uma realidade da cultura escolar de fundamental importância para o desenvolvimento do seu projeto pedagógico e do currículo vivido pelo aluno. Arquitetado nos pressupostos teóricos da abordagem sociocultural construtivista, este trabalho teve como objetivo investigar os processos co-construtivos presentes nas interações professor-professor, fundamentais para a elaboração e execução dos projetos vividos em uma escola pública de formação de professores do Distrito Federal. Participaram do estudo os 23 professores do curso normal, a coordenadora e o diretor. Procedimentos de observação participante das atividades pedagógicas de planejamento e execução de projetos e entrevista semi-estruturada com 10 desses participantes foram realizados em um período de três meses. A análise dos resultados focalizou (1 relações de confiança (2 interdependência indivíduo-grupo e (3 liderança. Estas categorias foram cruciais para o alcance dos objetivos estabelecidos na escola. Considera-se que estas são contribuições importantes da Psicologia aos cursos de formação inicial e continuada de professores.
Helping Moroccan women preserve the argan tree at the gateway to ...
International Development Research Centre (IDRC) Digital Library (Canada)
2010-11-01
Nov 1, 2010 ... ... Charrouf of the Faculté des sciences at the Université Mohammed V of Rabat, and Professor ... Therefore, the project aims not only to help prevent further ... the development of argan tree management scenarios; the selection of trees ... on the French networks (France 2 and FR3), and on Radio-Canada.
The housekeeper and the professor a novel
Ogawa, Yoko
2010-01-01
He is a brilliant math Professor with a peculiar problem—ever since a traumatic head injury, he has lived with only eighty minutes of short-term memory. She is an astute young Housekeeper—with a ten-year-old son—who is hired to care for the Professor. And every morning, as the Professor and the Housekeeper are introduced to each other anew, a strange and beautiful relationship blossoms between them. Though he cannot hold memories for long (his brain is like a tape that begins to erase itself every eighty minutes), the Professor's mind is still alive with elegant equations from the past. And the numbers, in all of their articulate order, reveal a sheltering and poetic world to both the Housekeeper and her young son. The Professor is capable of discovering connections between the simplest of quantities—like the Housekeeper's shoe size—and the universe at large, drawing their lives ever closer and more profoundly together, even as his memory slips away. Yoko Ogawa's The Housekeeper and the Professo...
The Professors behind the MOOC Hype
Kolowich, Steve
2013-01-01
The largest-ever survey of professors who have taught MOOCs, or massive open online courses, shows that the process is time-consuming, but, according to the instructors, often successful. Nearly half of the professors felt their online courses were as rigorous academically as the versions they taught in the classroom. The survey, conducted by "The…
Forecasting the student–professor matches that result in unusually effective teaching
Gross, Jennifer; Lakey, Brian; Lucas, Jessica L; LaCross, Ryan; R Plotkowski, Andrea; Winegard, Bo
2015-01-01
Background Two important influences on students' evaluations of teaching are relationship and professor effects. Relationship effects reflect unique matches between students and professors such that some professors are unusually effective for some students, but not for others. Professor effects reflect inter-rater agreement that some professors are more effective than others, on average across students. Aims We attempted to forecast students' evaluations of live lectures from brief, video-recorded teaching trailers. Sample Participants were 145 college students (74% female) enrolled in introductory psychology courses at a public university in the Great Lakes region of the United States. Methods Students viewed trailers early in the semester and attended live lectures months later. Because subgroups of students viewed the same professors, statistical analyses could isolate professor and relationship effects. Results Evaluations were influenced strongly by relationship and professor effects, and students' evaluations of live lectures could be forecasted from students' evaluations of teaching trailers. That is, we could forecast the individual students who would respond unusually well to a specific professor (relationship effects). We could also forecast which professors elicited better evaluations in live lectures, on average across students (professor effects). Professors who elicited unusually good evaluations in some students also elicited better memory for lectures in those students. Conclusions It appears possible to forecast relationship and professor effects on teaching evaluations by presenting brief teaching trailers to students. Thus, it might be possible to develop online recommender systems to help match students and professors so that unusually effective teaching emerges. PMID:24953773
Refletindo sobre a relação professor-aluno em um grupo de professores do Esino Fundamental
Directory of Open Access Journals (Sweden)
Antônio dos Santos Andrade
1999-06-01
Full Text Available A partir das concepções de Donald Schön sobre a formação do professor como prático reflexivo, os princípios de trabalho com pequenos grupos, baseados nas concepções de J. L Moreno, foram utilizados com o objetivo de facilitar o processo de reflexão sobre suas práticas de sala de aula, com seis professores do Ensino Fundamental. Foram realizados nove encontros de 90 a 120 minutos de duração. Nas discussões, os casos dos alunos mais problemáticos quanto ao seu comportamento foram trazidos pelos professores e analisados pelo grupo a luz das concepções da Pragmática da Comunicação Humana. Como resultado destas discussões, os professores foram levados a considerar os aspectos mais latentes, e portanto significantes, de suas relações com os alunos. Estas reflexões conduziram a uma "resignificação" das mesmas, com efeitos surpreendentes sobre os comportamentos dos alunos.
Ishii, Katsuya
2011-08-01
This issue includes a special section on computational fluid dynamics (CFD) in memory of the late Professor Kunio Kuwahara, who passed away on 15 September 2008, at the age of 66. In this special section, five articles are included that are based on the lectures and discussions at `The 7th International Nobeyama Workshop on CFD: To the Memory of Professor Kuwahara' held in Tokyo on 23 and 24 September 2009. Professor Kuwahara started his research in fluid dynamics under Professor Imai at the University of Tokyo. His first paper was published in 1969 with the title 'Steady Viscous Flow within Circular Boundary', with Professor Imai. In this paper, he combined theoretical and numerical methods in fluid dynamics. Since that time, he made significant and seminal contributions to computational fluid dynamics. He undertook pioneering numerical studies on the vortex method in 1970s. From then to the early nineties, he developed numerical analyses on a variety of three-dimensional unsteady phenomena of incompressible and compressible fluid flows and/or complex fluid flows using his own supercomputers with academic and industrial co-workers and members of his private research institute, ICFD in Tokyo. In addition, a number of senior and young researchers of fluid mechanics around the world were invited to ICFD and the Nobeyama workshops, which were held near his villa, and they intensively discussed new frontier problems of fluid physics and fluid engineering at Professor Kuwahara's kind hospitality. At the memorial Nobeyama workshop held in 2009, 24 overseas speakers presented their papers, including the talks of Dr J P Boris (Naval Research Laboratory), Dr E S Oran (Naval Research Laboratory), Professor Z J Wang (Iowa State University), Dr M Meinke (RWTH Aachen), Professor K Ghia (University of Cincinnati), Professor U Ghia (University of Cincinnati), Professor F Hussain (University of Houston), Professor M Farge (École Normale Superieure), Professor J Y Yong (National
Professor I I Glass A Tribute and Memorial
Igra, Ozer
2013-01-01
The book provides personal memories along with description of scientific works written by ex-graduate students and research associates of the late Professor Glass. The described research work covers a wide range of shock wave phenomena, resulting from seeds planted by Professor Glass. Professor Glass was born in Poland in 1918. He immigrated together with his parents to Canada at the age of 12 and received all his professional education at the University of Toronto, Canada. He became a world recognized expert in shock wave phenomena, and during his 45 years of active research he supervised more than 125 master and doctoral students, post-doctoral fellows and visiting research associates. In this book seven of his past students/research-associates describe their personal memories of Professor Glass and present some of their investigations in shock wave phenomena which sprung from their past work with Professor Glass. Specifically, these investigations include underwater shock waves, shock/bubble interaction, m...
Professor Kodi Husimi promoted accelerator projects
International Nuclear Information System (INIS)
Kikuchi, Ken
2009-01-01
The main aim of my article is to describe how deeply Professor Husimi devoted himself to promote large accelerator projects in Japan, as the establishment of National Laboratory for High Energy Physics (KEK), Photon Factory and TRISTAN, in which I myself was deeply involved. In addition, some topics related that I was a student of Professor Husimi are also reported. (author)
Professor Nukem - et eksperiment med oplevelsesbaseret forskningsformidling
DEFF Research Database (Denmark)
Sandvik, Kjetil; Thorhauge, Anne Mette
2007-01-01
Professor Nukem er resultatet af et forskningsprojekt om oplevelsesbaseret forskningsformidling der har form som et computerspil med tilhørende website, hvor brugeren interaktivt kan engagere sig i forskning omkring sociale og kulturelle aspekter ved computerspil. Professor Nukem kan spilles på...
The Reluctant Professor: Implications for University Management
Schein, Edgar H.
1973-01-01
Stating the belief that most analyses of the university fail to deal realistically with the role of the professor, the author's purpose is to show why it is difficult and possible undesirable to involve professors deeply in issues of university government. (Author/JB)
Variables That Can Affect Student Ratings of Their Professors
Gotlieb, Jerry
2013-01-01
Attribution theory was applied to help predict the results of an experiment that examined the effects of three independent variables on students' ratings of their professors. The dependent variables were students' perceptions of whether the professor caused the students' grades and student satisfaction with their professor. The results suggest…
Categorization of Quantum Mechanics Problems by Professors and Students
Lin, Shih-Yin; Singh, Chandralekha
2010-01-01
We discuss the categorization of 20 quantum mechanics problems by physics professors and undergraduate students from two honours-level quantum mechanics courses. Professors and students were asked to categorize the problems based upon similarity of solution. We also had individual discussions with professors who categorized the problems. Faculty…
Special issue dedicated to Professor Johann M. Schepers
Directory of Open Access Journals (Sweden)
Gideon P De Bruin
2006-10-01
Full Text Available It is a great pleasure for me to have been associated with this special issue of the SA Journal of Industrial Psychology dedicated to Professor Johann M. Schepers. The purpose of the special issue is to honour Professor Schepers for his contributions to the development of Psychology and Industrial Psychology as empirical fields of study in South Africa. The contributors have worked with Professor Schepers as students or colleagues and share his academic interests. The articles reflect his areas of interest and employ analytic techniques taught and championed by him. We are grateful to Professor Schepers for his cooperation throughout this project. Thanks are due to all the contributors and referees.
Professor dr hab. Anna Maria Bujakiewicz
Directory of Open Access Journals (Sweden)
Anna Kujawa
2015-08-01
Full Text Available The article presents the biography and scientific achievements of Professor Anna Bujakiewicz. After receiving her master’s degree and doctorate in biology and mycology from Adam Mickiewicz University in Poznań, Professor Bujakiewicz continued her exciting research and teaching on mycology at her Alma Mater Posnaniensis for more than 50 years. Her publications in this field include many books, articles, and other scholarly reports.
Baas, Pieter
1991-01-01
On 13 December 1990 Prof. Dr. Cornelis (Kees) Kalkman retired from the positions of Professor of Plant Systematics and Scientific Director of the Rijksherbarium/ Hortus Botanicus by presenting his valedictory lecture to the academic community of Leiden University and the assembled Dutch Botanical
Mydlík, M; Derzsiová, K
2010-11-01
Professor Frantisek Por MD and Professor Robert Klopstock MD were contemporaries, both born in 1899, one in Zvolen, the other in Dombovar, at the time of Austro-Hungarian Monarchy. Prof. Por attended the Faculty of Medicine in Budapest from 1918 to 1920, and Prof. Klopstock studied at the same place between 1917 and 1919. From 1920 until graduation on 6th February 1926, Prof. Por continued his studies at the German Faculty of Medicine, Charles University in Prague. Prof. Klopstock had to interrupt his studies in Budapest due to pulmonary tuberculosis; he received treatment at Tatranske Matliare where he befriended Franz Kafka. Later, upon Kafka's encouragement, he changed institutions and continued his studies at the German Faculty of Medicine, Charles University in Prague, where he graduated the first great go. It is very likely that, during their studies in Budapest and Prague, both professors met repeatedly, even though their life paths later separated. Following his graduation, Prof. Por practiced as an internist in Prague, later in Slovakia, and from 1945 in Kosice. In 1961, he was awarded the title of university professor of internal medicine at the Faculty of Medicine, Pavol Jozef Safarik University in Kosice, where he practiced until his death in 1980. Prof. Klopstock continued his studies in Kiel and Berlin. After his graduation in 1933, he practiced in Berlin as a surgeon and in 1938 left for USA. In 1962, he was awarded the title of university professor of pulmonary surgery in NewYork, where he died in 1972.
Forecasting the Student-Professor Matches That Result in Unusually Effective Teaching
Gross, Jennifer; Lakey, Brian; Lucas, Jessica L.; LaCross, Ryan; Plotkowski, Andrea R.; Winegard, Bo
2015-01-01
Background: Two important influences on students' evaluations of teaching are relationship and professor effects. Relationship effects reflect unique matches between students and professors such that some professors are unusually effective for some students, but not for others. Professor effects reflect inter-rater agreement that some professors…
E-Mail from Professor Enhances Student Motivation and Attitudes
Legg, Angela M.; Wilson, Janie H.
2009-01-01
Traditionally, professors use the first day of class to build rapport. However, current technology allows professors to contact students prior to the first day of class. This study assessed how the receipt of a welcoming e-mail from a female professor 1 week before the first day of class affected student motivation and attitudes toward the…
Do Professors Have Customer-Based Brand Equity?
Jillapalli, Ravi K.; Jillapalli, Regina
2014-01-01
This research endeavors to understand whether certain professors have customer-based brand equity (CBBE) in the minds of students. Consequently, the purpose of this study is to conceptualize, develop, and empirically test a model of customer-based professor brand equity. Survey data gathered from 465 undergraduate business students were used to…
University Curriculum Project--Professors Reflect on Impact.
Babbitt, Beatrice C.
This paper describes the reflections of the university professors in eight colleges at the University of Nevada, Las Vegas, who were pioneers in integrating assistive technology and related content into their courses and who continue to provide leadership in curricular change. Professors from the colleges of fine and performing arts, business,…
Formação do eu professor na abordagem Walloniana*
Directory of Open Access Journals (Sweden)
Ana Lúcia Batista Aranha
2015-12-01
Full Text Available RESUMO Objetivos Analisar como o professor percebe a construção de seu Eu Professor na perspectiva de Wallon e conhecer como vivencia seu cotidiano na escola na condição de ser o si mesmo e o outro. Método Estudo qualitativo que contou com 13 participantes atuantes no Curso Bacharelado em Enfermagem. A coleta de dados foi realizada em 2013, por meio de entrevistas submetidas à análise temática. Resultados Emergiram três categorias: Construção do Eu Professor; Viver o cotidiano apoiado em si mesmo e no outro; e Componentes da construção do Eu Professor, com destaque para a conscientização e valorização de si mesmo e do outro, edificando a construção do Eu Professor. Conclusão Os professores percorreram uma trajetória na qual permitiu reconhecer o si mesmo em diferentes movimentos da internalização do Eu.
ENSAIO: HOMENAGEM AO PROFESSOR REINIER ROZESTRATEN
Directory of Open Access Journals (Sweden)
Antonio C. R. Tupinambá
2014-02-01
Full Text Available Trata-se de uma homenagem póstuma ao Professor Doutor Reinier Rozestraten. O texto apresenta, suscintamente, o percurso acadêmico do nomeado professor, em especial a sua passagem pela Psicologia do Trânsito. Paralelamente discorre sobre sua principal obra na área, que, de certo modo introduz o discurso psicológico sobre o comportamento de trânsito em perspectiva nacional, juntamente com sua preocupação em imprimir um caráter científico ao tema e introduzi-lo no contexto da academia e na sociedade em perspectivas teórica e prática. A obra escolhida é considerada um marco para o estabelecimento teórico da disciplina da psicologia do trânsito no Brasil. A homenagem foi originalmente escrita por ocasião dos cinco anos de falecimento do professor Reinier.
DISCOURSE SPACE OF THE LINGUOCULTURAL CHARACTER TYPE PROFESSOR
Directory of Open Access Journals (Sweden)
Lara Sinelnikova
2014-10-01
Full Text Available The article offers an analysis of the linguocultural character type professor taking into consideration both traditional set of signs and those transformations that indicate accumulation of evolutionary changes. The methodological base for the systematic description were the achievements of such areas of scientific knowledge as personology, linguopersonology and discourseology. The linguocultural character type (LCCT is a generalised image of persons, whose behaviour and value orientations influence culture, language and show social originality of the society. The peculiarity of the studied linguocultural character type is in its interrelation with the linguocultural character types intellectual and teacher as well as in the fact of the traditional connection with the concept elite. The exposure of such kind of multidimensional relations allowed to focus attention on the qualities of the LCCT professor that ensure its relative self-sufficiency. The sign of elitism and belonging to the intellectuals of the LCCT professor is asserted by the high social status recognised by the society, which is based on professionalism and compliance with moral principles. The axiological generality of the LCCT professor and teacher is ensured by the peculiarities of the modern pedagogical discourse with its typical image settings. One of the main features of the image of a professor is its belonging to the elite language person. The transformational processes in the contents of the LCCT professor are connected with the globalisation: including the international dimension in the evaluation of the professional activity, complication of the language environment, marketisation of the university sphere.
Hamid, K M; Onoja, A B; Tofa, U A; Garba, K N
2014-03-01
Primary Cytomegalovirus (CMV) infection during pregnancy is a frequent and serious threat to the fetus. As there is no vaccine alternative measures are needed to prevent congenital CMV infection. This study determined CMV Immunoglobulin G (IgG) antibody among pregnant women in order to ascertain the immune status of mothers to guide policy makers. A semi-structured questionnaire was initially administered to obtain information on demographic details, stage of pregnancy and risk factors. Blood was collected by venipuncture from 180 women attending the antenatal clinic in Murtala Mohammed Specialist Hospital Kano, Kano State, Nigeria. Sera samples were screened using CMV IgG ELISA kit (Dialab, Austria). Out of 180 pregnant women, 164 (91.1%) were seropositive. Based on stages of pregnancy 6/6(100%), 52/60(86.7%) and 106/114(93.0%) were seropositive among women in the first, second and third trimesters respectively. Seroprevalence of pregnant women to CMV Ig G is high, hence the need for CMV - IgM screening to know the extent of active infection. There is also need for public enlightenment on the methods of transmission, effective prevention and control strategies.
Professor Tiina Tasmuth Helsingis
2000-01-01
Tervisekasvatuse õppetooli professor Tiina Tasmuth osales 11.-14. juunini Helsingis toimunud rahvusvahelise konverentsi "2nd Psycho-Social Impacts of Breast Cancer" töös ning esines ettekandega teemal "Chronic post-treatment symptoms in patients with breast cancer" : [täistekst
Afetividade entre professor e aluno no processo ensino-aprendizagem
Directory of Open Access Journals (Sweden)
Jéssica Simone Galdino Schaefer
2015-06-01
Full Text Available Este artigo tem como objetivo analisar as relações de afetividade entre professor e aluno no processo ensino-aprendizagem. Utiliza de metodologia com abordagem qualitativa, observação participante, e entrevistas semi-estruturadas. O lócus da pesquisa foi a Escola Municipal de Educação Básica Lizamara Aparecida Oliva de Almeida em Sinop, entre Fevereiro e Maio de 2014. Enquanto sujeitos, contou-se com professores e alunos do 3º ano do Ensino Fundamental. Dos resultados parciais, verificou-se que mesmo que a afetividade e a aprendizagem sejam reconhecidas teoricamente por Henri Wallon como elos fundamentais para o processo ensino-aprendizagem, ainda não é bem compreendido pelos sujeitos professores. Palavras-chave: psicologia educacional; afetividade; professores e alunos.
Professor Stewart's casebook of mathematical mysteries
Stewart, Ian
2014-01-01
Like its wildly popular predecessors Cabinet of Mathematical Curiosities and Hoard of Mathematical Treasures, Professor Stewart's brand-new book is a miscellany of over 150 mathematical curios and conundrums, packed with trademark humour and numerous illustrations. In addition to the fascinating formulae and thrilling theorems familiar to Professor Stewart's fans, the Casebook follows the adventures of the not-so-great detective Hemlock Soames and his sidekick Dr John Watsup (immortalised in the phrase 'Watsup, Doc?'). By a remarkable coincidence they live at 222B Baker Street, just a
Professor om kystsikring: Ingen universelle løsninger
DEFF Research Database (Denmark)
Arnbjerg-Nielsen, Karsten
2017-01-01
DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU.......DEBAT: Der findes ikke universalløsninger mod stigende risiko for stormfloder, men løsninger skal findes, skriver Karsten Arnbjerg-Nielsen, professor ved DTU....
Effects of Social Support on Professors' Work Stress
Moeller, Christin; Chung-Yan, Greg A.
2013-01-01
Purpose: The purpose of this paper is to examine how various types of workplace social support from different support sources interact with occupational stressors to predict the psychological well-being of university professors. Design/method/approach: A total of 99 full-time professors participated via an online or paper questionnaire. Findings:…
Academic Labor Markets and Assistant Professors' Employment Outcomes
Hargens, Lowell L.
2012-01-01
Using data for 638 assistant professors who joined graduate sociology departments between 1975 and 1992, I examine the claim that when the labor market for new doctorates is weak, assistant professors experience less favorable employment outcomes than when that labor market is strong. Surprisingly, I find that those hired during the weak…
The Roles of a University Professor in a Teacher Study Group
Yeh, Hui-Chin; Hung, Hsiu-Ting; Chen, Yi-Ping
2012-01-01
The opportunities in which university professors collaborate with the practicing school teachers in a teacher study group are few. This study investigated how a university professor facilitated a collaborative teacher study group to enhance teachers' professional growth. Five primary school teachers and a university professor collaborated on…
University Student Expectations of Confidentiality When Disclosing Information to Their Professors
Harris, Gregory E.; Dalton, Stephanie
2014-01-01
The purpose of this study was to explore university students' expectations of confidentiality when they make disclosures to their university professors. A secondary purpose was to consider if students have a higher expectation of confidentiality when talking with Psychology professors versus professors in other disciplines. Students were asked to…
What I Wish My Professors Had Told Me
Collins, Jennifer
2016-01-01
What do you wish your undergraduate professors told you before you ever set foot in a classroom? Jennifer Collins, one such professor who prepares pre-service teachers, has a list of six "truths" she shares with her students. In this article, Collins outlines those pieces of advice, which include understanding your larger purpose,…
The I Professor Formation in the Wallonian approach.
Aranha, Ana Lúcia Batista; Mrech, Leny Magalhaes; Zacharias, Adriana Pereira Gonçalves; Figueredo, Luana Prado; Mendonça, Catarina Terumi Abe; Fernandes, Maria de Fátima Prado
2015-12-01
Objectives Analyze how teachers perceive the construction of their I Professor from the perspective of Wallon and learn about their everyday experiences in school in the condition of being self and other. Method Qualitative, with 13 participants from the Bachelor of Nursing Program. Data collection was carried out in 2013 using interviews that were subjected to thematic analysis. Results Three categories emerged: Construction of the I Professor; living daily life supported by oneself and the other; and the components for constructing the I Professor, highlighting consciousness and valuing of oneself and the other. Conclusion The teachers traveled a path that allowed them to recognize themselves in different movements of the internalization of the I.
Illustrated & Dissected: Professor Richard Sawdon Smith.
2015-06-01
This Alternative Gallery feature introduces the photographic artist Professor Richard Sawdon Smith. Professor Sawdon Smith's work stems around a fascination with representations of anatomy that have been fuelled by his experience as a hospital patient. The work has allowed him to explore ideas through the use of medical illustrations which include early anatomical drawings, personal medical photography and facial modelling. The work highlights how such imagery can be used in the context of a patient seeking understanding and acceptance of ill health and disease using the body as a canvas on which to translate the experience.
[Professor Kazimierz Jaegermann--forensic pathologist--scientist--thinker].
Nasiłowski, Władysław
2009-01-01
Professor Kazimierz Jaegermann, a founder of the theory of medico-legal opinionating, passed away 20 years ago. Numerous specialists in forensic medicine and an ever increasing number of lawyers substantiate the importance and value of the creative thought and the entire research work of Professor Jaegermann that have been an inspiration of progress in forensic medicine and in the science of applied law. His unique ability to perform a scientific synthesis leading to recognizing forensic medicine as an applied bridging knowledge points to the eminently creative role played by Professor Jaegermann in development of forensic medicine. There is an urgent need to recall his research activities and to publish a complete collection of his articles and publications. With this idea in mind, I present below an article based on the text published in No. 1 of the Zeszyty Naukowe Katedry Medycyny Sadowej Slaskiej Akademii Medycznej in 1995.
Ali Saqer
2016-01-01
Professor Alex Callinicos is a renowned social theorist and scholar of international political economy. He conducts research on Marx and Marxism, European social and political theory, contemporary political philosophy, critical theory, historiography, and international political economy. His work provides invaluable insights on issues of race and racism, social justice, the Third Way, imperialism, austerity, and EU politics, among many other fascinating contemporary issues. Alex studied Philo...
2007-01-01
"Professor Wolfgang panofsky, who died on September 24 aged 88, was a particle physicists and director of the Stanford Linear Accelerator Centre (SLAC) in California; with Jack Steinberger, he was the first to isolate the neutral pi meson, one of the subatomic particles which had been predicted by theoretical scientists to account for the strng force which binds the nuclei of atoms." (1 page)
"They Are Weighted with Authority": Fat Female Professors in Academic and Popular Cultures
Fisanick, Christina
2007-01-01
The images of fat professors encountered in popular culture are few in number and negative in depiction. In this article, the author discusses on how will the professorial body affect the way in which students perceive the professor's teaching abilities. The author concludes that bias against fat professors, professors of color, and other…
Wanted: More Squares Among Professors
Fisher, William H.
1969-01-01
Professors who see the world and life in a context of sincerely held religious beliefs should be given the same tolerance and understanding which atheists and agnostics used to demand for themselves. (AD)
Biography of Professor M. El-Bahay Issawi
Abdeen, Mamdouh M.
2017-12-01
Prof. Mohamed El-Bahay Issawi is a remarkable geologist and is without doubt one of the most important Egyptian geologists ever. His work in the Western Desert is extensive and legendary, and it is hard to imagine any single geologist ever again matching the extent of his field work in that remote region. He has had an enormously productive career involving a wide variety of research and applied topics. He discovered the Abu Tartur phosphate deposits, iron ore deposits of the Bahariya Oasis, and the Kalabsha kaolin deposits south of Aswan. He did extensive field work and aerial-photo mapping of the Western Desert over many years and authored many carefully documented papers that are still cited today. He wrote several books about the Phanerozoic geology of Egypt. Prof. Issawi has served his science and his nation over his long and outstanding career.
Lee, Soo Rin; Lee, Ji-Hyun; Kim, Ah Ran; Kim, Sanghee; Park, Hyun; Baek, Hea Ja; Kim, Hyun-Woo
2016-02-01
Three full-length cDNAs encoding lipoprotein homologs were identified in Tigriopus kingsejongensis, a newly identified copepod from Antarctica. Structural and transcriptional analyses revealed homology with two vitellogenin-like proteins, Tik-Vg1 and Tik-Vg2, which were 1855 and 1795 amino acids in length, respectively, along with a third protein, Tik-MEP, which produced a 1517-residue protein with similarity to a melanin engaging protein (MEP) in insects Phylogenetic analysis showed that Vgs in Maxillopods including two Tik-Vgs belong to the arthropod vitellogenin-like clade, which includes clottable proteins (CPs) in decapod crustaceans and vitellogenins in insects. Tik-MEP clustered together with insect MEPs, which appear to have evolved before the apoB-like and arthropod Vg-like clades. Interestingly, no genes orthologous to those found in the apoB clade were identified in Maxillopoda, suggesting that functions of large lipid transfer proteins (LLTPs) in reproduction and lipid metabolism may be different from those in insect and decapod crustaceans. As suggested by phylogenetic analyses, the two Tik-Vgs belonging to the arthropod Vg-like clade appear to play major roles in oocyte maturation, while Vgs belonging to the apoB clade function primarily in the reproduction of decapod crustaceans. Transcriptional analysis of Tik-Vg expression revealed a 24-fold increase in mature and ovigerous females compared with immature female, whereas expression of Tik-MEP remained low through all reproductive stages. Acute temperature changes did not affect the transcription of Tik-Vg genes, whereas Tik-MEP appeared to be affected by temperature change. Among the three hormones thought to be involved in molting and reproduction in arthropods, only farnesoic acid (FA) induced transcription of the two Tik-Vg genes. Regardless of developmental stage and hormone treatment, Tik-Vg1 and Tik-Vg2 exhibited a strong positive correlation in expression, suggesting that expression of these
Subjective well-being and time use of brazilian PhD professors
Directory of Open Access Journals (Sweden)
Maiana Farias Oliveira Nunes
2014-12-01
Full Text Available The university professor suffers high pressure to achieve productivity and performs under work conditions that are not always satisfactory. This study seeks to analyze the subjective well-being, the time-use strategies, and the satisfaction with their use of time of PhD-holding professors with and without productivity grants from the National Council for Scientific and Technological Development (CNPq. A total of 83 professors participated in the study (48 with productivity grants, with an average age of 50 years. A total of 89% of participants were from public institutions. The majority of the participants exhibited high levels of negative affect and low-average levels of satisfaction with their use of time. There was no difference in the subjective well-being or in the satisfaction with the use of time when comparing professors who had received a CNPq grant with professors who had not received a CNPq grant. The most important reason for dissatisfaction with the use of time was an excess of work, whereas peer recognition was the primary achievement obtained with the work. How work demands and conditions influence the well-being of the professors is discussed in this study.
The Effects of Professors' Race and Gender on Student Evaluations and Performance
Basow, Susan A.; Codos, Stephanie; Martin, Julie L.
2013-01-01
This experimental study examined the effects of professor gender, professor race, and student gender on student ratings of teaching effectiveness and amount learned. After watching a three-minute engineering lecture presented by a computer-animated professor who varied by gender and race (African American, White), female and male undergraduates…
Student and Professor Gender Effects in Introductory Business Statistics
Haley, M. Ryan; Johnson, Marianne F.; Kuennen, Eric W.
2007-01-01
Studies have yielded highly mixed results as to differences in male and female student performance in statistics courses; the role that professors play in these differences is even less clear. In this paper, we consider the impact of professor and student gender on student performance in an introductory business statistics course taught by…
Lifescience Database Archive (English)
Full Text Available .. 203 6e-51 tr|B3TIK7|B3TIK7_ARATH Slow walker 2 OS=Arabidopsis thaliana GN=... 183 6e-45 tr|Q9C9E2|Q9C9E2_... Sbjct: 339 NKLGDPERRAASSAAYLLTSLLSAHPNMKMVVIDEVDSFL 378 >tr|B3TIK7|B3TIK7_ARATH Slow walker 2 OS=Arabidopsi
The Search for Peace in Mindanao: Resolving a Wicked Problem
2012-03-22
negotiating panel, still led by Mohagher Iqbal, but with new members such as Professor Abhoud Syed Linga and Datu Antonio Kinoc of B‘laan tribe...that the MILF received funds from charitable institutions operated by Mohammed Jamal Khalifa, Osama Bin Laden‘s brother-in-law.53 The MILF has...Crucible: A Reader (Quezon City: CenPeg Publications), 2008, p. 136. 19 7 Hermoso, p. 61. 8 Dato‘ Md Ismael bin Ahmad Khan, ―The International
Directory of Open Access Journals (Sweden)
NASSIF, Vânia Maria Jorge
2006-01-01
Full Text Available RESUMOO objetivo dessa pesquisa foi o de verificar se a função Recursos Humanos das universidades privadas brasileiras estimula o desenvolvimento das competências do professor necessário para aumentar a competitividade das mesmas. A pesquisa qualitativa foi conduzida por meio de entrevistas com principais executivos das universidades. Uma outra pesquisa quantitativa foi desenvolvida por meio de um questionário fechado e auto-aplicável em 282 professores. A análise fatorial gerou algumas categorias de competências do professor. Os resultados revelaram que os professores reconhecem as competências necessárias para o exercício da docência, por outro lado, as universidades não percebem as ações e práticas de Recursos Humanos que facilitam o desenvolvimento dessas competências, propiciando um diferencial competitivo no ambiente acadêmico.ABSTRACTThe objective of this research was to verify if the Human Resources function in five Brazilian private universities stimulates the development and the exercise of the professor’s competences needed to raise their competitiveness. A qualitative research was conducted interviewing top management and Human Resources professionals of these universities. Another quantitative research was carried out using a self applied and closed questionnaire answered by 282 professors. A factor analysis identified 12 factors of professor’s competences that are viewed fundamental to exercise teacher’s function. Results revealed the professors recognize what are the competencies needed; however, the universities do not realize Human Resources actions facilitating them to develop these competences, promoting competitiveness in the academic market.RESUMENEsta investigación tuvo por finalidad verificar si la función Recursos Humanos de las universidades privadas brasileñas estimula el desarrollo de las competencias del profesor, necesario para aumentar la competitividad de las mismas. La investigaci
A Group Interview about Publishing with Professor Jack Zipes
Directory of Open Access Journals (Sweden)
Emma Louise Parfitt
2016-10-01
Full Text Available The conversation piece is the product of a group interview with Professor Jack Zipes and provides useful insights about publishing for early career researchers across disciplines. Based on his wider experiences as academic and writer, Professor Zipes answered questions from PhD researchers about: writing books, monographs and edited collections; turning a PhD thesis into a monograph; choosing and approaching publishers; and the advantages of editing books and translations. It presents some general advice for writing and publishing aimed at postgraduate students. Professor Zipes is an Emeritus Professor at the University of Minnesota Twin Cities, United States, a world expert on fairy tales and storytelling highlighting the social and historical dimensions of them. Zipes has forty years of experience publishing academic and mass-market books, editing anthologies, and translating work from French, German and Italian. His best known books are Breaking the Magic Spell (1979, Fairy Tales and the Art of Subversion (1983, The Irresistible Fairy Tale: The Cultural and Social History of a Genre (2012, and The Original Folk and Fairy Tales of the Brothers Grimm (2014.
Professors of the New Economy.
Wilson, Robin
2000-01-01
Profiles four professors who epitomize the increasing influence of academe on new technology-driven Internet business: a start-up maven, Steven Kaplan; a social psychologist, Michael Ray; a cyberlawyer, David Post; and an e-commerce expert, Andrew B. Whinston. (DB)
The College Professor's Professional Liability
Griggs, Walter S.; Rubin, Harvey W.
1977-01-01
The growing number of professional liability suits against professors warrants a close examination of the need for and provisions of available insurance coverage. The evolution of tort liability, the question of negligence, and the professional liability policy are discussed. (LBH)
ATLANTIC and beyond: an interview with Professor Azfar Zaman.
Zaman, Azfar; Wu, Wing
2015-01-01
Professor Azfar Zaman speaks to Wing Wu, Commissioning Editor: Professor Azfar Zaman is a Consultant Interventional Cardiologist at Freeman Hospital and Professor of Cardiology at Newcastle University. Following graduation at Leeds Medical School, he completed postgraduate training in cardiology at regional centres in Leeds, London and Cardiff. Prior to his appointment in Newcastle upon Tyne, he was a Fulbright Scholar and British Heart Foundation International Fellow at Mount Sinai Medical Center, New York, USA. He is the Clinical Lead for Coronary Intervention and Director of the Cardiac Catheter Laboratories. In 2012, he was appointed Specialty Group Lead for Cardiovascular Research and has an interest in clinical research, with a particular interest in atherothrombosis in diabetes and clinical trials.
[Learning styles in medical residents and their professors of a pediatric hospital.
Juárez-Muñoz, Irina Elizabeth; Gómez-Negrete, Alonso; Varela-Ruiz, Margarita; Mejía-Aranguré, Juan Manuel; Mercado-Arellano, José Agustín; Sciandra-Rico, Martha Minerva; Matute-González, Mario Manuel
2013-01-01
Background: the learning styles are cognitive, emotional, and psychological characteristics, which function as relatively stable indicators of how teachers and students perceive, interact, and respond to their learning environments. Knowing students' styles allows teachers to have tools to improve medical education. Our objective was to identify learning styles in pediatric residents and professors from a pediatric hospital. Methods: a learning styles questionnaire was applied to residents and theirs professors; data was analyzed in SPSS 12 software. Results: the dominant learning style in pediatric residents was reflexive and for professors was theoretical. There wasn't any difference between sexes or between medical or surgical specialities. There was more correlation between professors and residents when there was an increase in training time. Conclusions: the learning styles between professors and residents are different, especially at the beginning of the medical specialty courses; that's why it is necessary to realize a confrontation between the students' learning styles and teaching methods used by professors to improve significant learning. To know learning styles gives residents an important alternative to find a better study strategy.
O professor_: de quem estamos falando mesmo?
Directory of Open Access Journals (Sweden)
Santos, Fabiane Konowaluk
2004-01-01
Full Text Available O presente texto procura abordar a temática relacionada à auto-imagem do professor, constatada através de uma enquete e da construção de um website que subsidiou o tensionamento com o real. Segundo Arroyo (2000, p. 124, carregamos a função que exercemos, que somos e a imagem de professor(a que internalizamos. Dessa forma, o tema em estudo segue, ainda hoje, sendo altamente significativo, pois não podemos esquecer os momentos históricos, políticos e sociais vivenciados pelos professores, buscando justamente explicações sobre como as questões de auto-imagem, o fazer e suas competências, suas possibilidades e limites e outros tantos fatores que estão a alterar seu comportamento. Arroyo (2000, p. 124 assinala que a auto-imagem docente é apreendida em múltiplos espaços e tempos, em múltiplas vivências, como resultado das condições psicológicas e sociais que afetam sua docência
Estilos motivacionais de professores: preferência por controle ou por autonomia
Directory of Open Access Journals (Sweden)
Amélia Carolina Terra Alves Machado
Full Text Available A motivação é fundamental para o envolvimento dos estudantes na escola. Para a teoria da autodeterminação, o estilo motivacional do professor, que pode controlar ou promover a autonomia, contribui para fomentar a ocorrência de tipos qualitativamente diferenciados de motivação. Neste estudo, de natureza exploratória, foram analisadas as interações entre dois professores e seus alunos. A amostra foi composta de acordo com o desempenho de 39 professores na avaliação do estilo motivacional, mediante a aplicação de um instrumento de autorrelato, problemas na escola. Desse total, dois professores, um com estilo motivacional promotor de autonomia e outro com uma orientação para o controle, tiveram suas aulas observadas em sete sessões, com o objetivo de levantar dados para a elaboração de um protocolo que continha categorias de interações. Foram então realizadas outras sete sessões de observação. Os resultados indicaram que, apesar de terem sido encontradas diferenças entre os desempenhos na avaliação do estilo motivacional, os professores interagiram com seus alunos de modo preferencialmente controlador. No entanto, o professor que promovia a autonomia interagiu de modo menos controlador no gerenciamento do tempo destinado para a realização das atividades em classe quando comparado ao professor controlador, além de oferecer feedback informativo. As implicações educacionais dos resultados são analisadas.
University Pedagogy for Assistant Professors at Aalborg University (Part 2)
DEFF Research Database (Denmark)
Kolmos, Anette; Krogh, Lone
2003-01-01
In issue 1-2003, Anette Kolmos and Lone Krogh reported on the two-semester study course " University Pedagogy for Assistant Professors at Aalborg University (DK)". Now, in part 2, they are adressing guidelines for supervison and advising of assistant professors in the university teacher education...
Faculty Agency in Applying for Promotion to Professor
Directory of Open Access Journals (Sweden)
Susan K. Gardner
2017-02-01
Full Text Available Aim/Purpose: In the United States, faculty who wish to pursue promotion to the rank of professor do so without clear guidance or structure. Even the timing of such a process is nebulous. As such, an individual engages in agentic action to pursue the rank. Background: This study examined the experiences of faculty members who chose to pursue the application process to be promoted to professor but were rejected or dissuaded. Methodology: Utilizing a case study of one institutional setting, we conducted 10 in-depth qualitative interviews. Contribution: Very little is known about the process of promotion to full professor in the U.S. and even less empirical research exists. This study advances knowledge of the process and the experiences of those undertaking it. Findings: We learned that cues from the social context greatly influenced these faculty members’ sense of agency.
Kai Adolf Jensen, professor i almindelig patologi
DEFF Research Database (Denmark)
Høiby, Niels
2016-01-01
for the Bacillus Calmette-Guérin vaccine production and supervised many young scientists’ doctoral theses on the aspects of tuberculosis. He became internationally recognized, and he revealed an important scientific fraud in the laboratory of the Austrian professor Ernst Löwenstein (1878-1950), who claimed that he...... could detect M. tuberculosis in blood cultures as a cause of a multitude of diseases. He was a pioneer in eradication of bovine tuberculosis in Denmark which became the first country in the world where this happened. Kai Adolf Jensen held the position as professor of general pathology from 1940 to 1965...
Professor: Danmarkskanon skal give plads til mangfoldighed
DEFF Research Database (Denmark)
Schmidt, Garbi
2016-01-01
DEBAT: Danmark har igennem størstedelen af sin historie været et flerkulturelt land. Vi kan derfor ikke diskutere danske værdier til en Danmarkskanon uden at kaste et blik på globale strømninger og vores mangfoldige fortid, skriver Garbi Schmidt, professor ved RUC......DEBAT: Danmark har igennem størstedelen af sin historie været et flerkulturelt land. Vi kan derfor ikke diskutere danske værdier til en Danmarkskanon uden at kaste et blik på globale strømninger og vores mangfoldige fortid, skriver Garbi Schmidt, professor ved RUC...
[The essence of Professor Wu Lian-Zhong's acupuncture manipulation].
Liu, Jing; Guo, Yi; Wu, Lian-Zhong
2014-05-01
The painless needle insertion technique, summarized by Professor WU Lian-zhong during his decades of acupuncture clinical practice is introduced in this article, which is characterized as soft, flexible, fast, plucking and activating antipathogenic qi. The Sancai (three layers) lifting and thrusting manipulation technique is adopted by Professor WU for getting the qi sensation. And features of 10 kinds of needling sensation such as soreness, numbness, heaviness, distension, pain, cold, hot, radiation, jumping and contracture are summarized. Finger force, amplitude, speed and time length are also taken as the basis of reinforcing and reducing manipulations. Moreover, examples are also given to explain the needling technique on some specific points which further embodies Professor WU's unique experiences and understandings on acupuncture.
Engaging Undergraduates in Feminist Classrooms: An Exploration of Professors' Practices
Spencer, Leland G.
2015-01-01
This article reports the results of a feminist action research project that sought to ascertain professors' best practices for engaging undergraduates in feminist classrooms. In semi-structured interviews, professors recommended assigning readings from a variety of positionalities; creating a safe space for class discussion; relying on data to…
The benefits of being economics professor A (rather than Z)
van Praag, C.M.; van Praag, B.M.S.
2008-01-01
Alphabetical name ordering on multi-authored academic papers, which is the convention in economics and various other disciplines, is to the advantage of people whose last name initials are placed early in the alphabet. Professor A, who has been a first author more often than Professor Z, will have
Mental Health Assessment in Professors' Training in Two Chilean Universities
Ossa, Carlos J.; Quintana, Ingrid M.; Rodriguez, Felipe F.
2015-01-01
This study analyzed the evaluation of professors of pedagogy and directors programs, about the importance of mental health in vocational training, and factors that might influence this valuation. The methodology includes participation of 17 academicians (professors and belonging to the managerial staff) of two universities in southern Chile. A…
Work process of nursing professors 1
Parra Giordano, Denisse; Felli, Vanda Elisa Andres
2017-01-01
ABSTRACT Objective: to analyze the work process of nursing professors. Method: descriptive, exploratory and qualitative study, developed with a focus on critical epidemiology, carried out at a School of Nursing in Chile. The research subjects consist of 17 nursing professors, with whom individual semi-structured interviews were carried out and nine participated in a focus group. The Ethics Committee approved this study. Results: 88.2% were female, mean age of 42 years, 47% were married, 94% were Chilean, average length of service in the institution of 2.8 years, and 23.5% had a master’s degree. Regarding the work process, the students were the work object, the tools used were the knowledge and the experience as a nurse, and the work environment was considered good. Regarding the form of work organization, 76% have a 44-hour workweek, the wage was considered inadequate and the workload was higher than foreseen in the contract. The dialectic of the nursing work process is evidenced, demonstrating the contradiction between the low wages and labor overload and the narratives reporting a good work environment, personal fulfillment and transcendence that goes far beyond work. Conclusions: the work process allows describing the work components of the nursing professors, which are consistent with the results of the literature and show the dialectic of the nursing work process. PMID:29211193
Professor Witold Nowicki - a greatly spirited pathologist.
Wincewicz, A; Szepietowska, A; Sulkowski, S
2016-06-01
This paper presents a complete overview of the scientific, professional and social activity of a great Polish pathologist, Witold Nowicki (1878-1941), from mainly Polish-written, original sources with a major impact on mostly his own publications. The biographical commemoration of this eminent professor is not only due to the fact that he provided a profound microscopic characterization of pneumatosis cystoides in 1909 and 1924. Nowicki greatly influenced the development of anatomical pathology in Poland, having authored over 82 publications, with special reference to tuberculosis, lung cancer, sarcomatous carcinomas, scleroma and others. However, the first of all his merits for the readership of Polish pathologists was his textbook titled Anatomical Pathology, which was a basic pathology manual in pre-war Poland. Witold Nowicki - as the head of the academic pathological anatomy department and former dean of the medical faculty - was shot with other professors by Nazi Germans in the Wuleckie hills in Lvov during World War Two. Professor Nowicki was described as being "small in size but great in spirit" by one of his associates, and remains an outstanding example of a meticulous pathologist, a patient tutor and a great social activist to follow.
Seniorforsker Ole Hertel udnævnt til adjungeret professor
DEFF Research Database (Denmark)
Pedersen, Jens Christian
2009-01-01
Sektionsleder og seniorforsker Ole Hertel, Danmarks Miljøundersøgelser (DMU) ved Aarhus Universitet, er udnævnt til adjungeret professor ved Institut for Miljø, Samfund og Rumlig Forandring på Roskilde Universitet.......Sektionsleder og seniorforsker Ole Hertel, Danmarks Miljøundersøgelser (DMU) ved Aarhus Universitet, er udnævnt til adjungeret professor ved Institut for Miljø, Samfund og Rumlig Forandring på Roskilde Universitet....
Directory of Open Access Journals (Sweden)
Ali Saqer
2016-04-01
Full Text Available Professor Alex Callinicos is a renowned social theorist and scholar of international political economy. He conducts research on Marx and Marxism, European social and political theory, contemporary political philosophy, critical theory, historiography, and international political economy. His work provides invaluable insights on issues of race and racism, social justice, the Third Way, imperialism, austerity, and EU politics, among many other fascinating contemporary issues. Alex studied Philosophy, Politics, and Economics at Balliol College, Oxford, and Philosophy of Science at the London School of Economics before writing a DPhil on Marx's Capital, also at Balliol. He was a Junior Research Fellow in Contemporary Social Thought at St Peter's College, Oxford from 1979 to 1981, after which he taught social and political theory at the Department of Politics at the University of York until 2005, when he moved to King's College London. Alex is currently the Professor of European Studies at King's and editor of International Socialism. Alex has been an active contributor to the development of the movement for another globalization, participating in the World Social Forum and an animator of the European Social Forum. Among his best known books are The Revolutionary Ideas of Karl Marx (1983, Against Postmodernism (1990, Social Theory (1999, An Anti-Capitalist Manifesto (2003, The Resources of Critique (2006, Imperialism and Global Political Economy (2009. His most recent book is entitled Deciphering Capital: Marx’s Capital and its Destiny (2014.
The Limited Role of Journalism Professors in Direct Media Criticism.
Bass, Abraham Z.
This paper discusses reasons why few journalism professors are personally confronting the news media with criticism or praise. One of the primary reasons for this is that journalism professors may fear retribution or keep inbred ties with the media or be following academic tradition. A survey was conducted in Spring 1975 for this report. The…
Elmarjany, Mohammed; Maghous, Abdelhak; Razine, Rachid; Marnouche, Elamin; Andaloussi, Khalid; Bazine, Amine; Lalya, Issam; Zaghba, Noha; Hadadi, Khalid; Sifat, Hassan; Habib, Baba; Kouach, Jaouad; Mansouri, Hamid
2015-01-01
Cancer of uterine cervix is the second most common cause of cancer related deaths among women. The aim of this study is to report the experience of Military Hospital Mohamed V in the management of cervical cancer and their results. All cervical cancer managed at the radiotherapy department of Military Hospital Mohamed V between January 2005 and February 2010, were included for investigation of their demographic, histological, therapeutic and follow-up characteristics. Of the 162 cases managed, 151 (93.2 %) cases were treated in our department. In our study the median age was 51.5 years (33-82). The median duration of symptoms before diagnosis was four [3, 7] months. The major presenting complaints were abnormal vaginal bleeding (89.8 %). Squamous cell carcinoma cervix was seen in 86.2 % (n = 137), adenocarcinoma in 11.3 % (n = 18) and adenosquamous carcinoma in 2.4 % (n = 4). One hundred seventeen (84.8 %) cases were seen at late stage. An abdominal and pelvic computed tomography (CT) scan was performed in 34.6 % (n = 56) of cases, magnetic resonance imaging (MRI) in 62.9 % (n = 102). The pelvic lymph nodes were achieved in 16.6 % of cases. Over half of patients 58.3 % (n = 88) were treated with a combination of external beam radiation therapy (EBRT) and a concurrent cisplatin based chemotherapy (40 mg /m2 weekly). With a mean of 51.6 months (2 to 109), we recorded 19 (12.6 %) pelvic relapse and 15 (9.9 %) metastases. The median time to onset was 19.4 months (2-84 months). The local control rate was 63.6 % (n = 96) and 21 (13.9 %) patients were lost to follow-up. The overall survival (OS) at 3 years and 5 years was respectively 78.3 % and 73.6 % and the relapse-free survival (RFS) was respectively 80 % and 77.2 %. Most of cervical cancer patients in Morocco are seen at late stage necessitating referral for radiotherapy, chemotherapy or palliative care. This may reflect lack of cervical screening in order to early
Tachi, Tomoya; Noguchi, Yoshihiro; Teramachi, Hitomi
2017-01-01
The clinical professors at Gifu Pharmaceutical University (GPU) provide pharmaceutical services at GPU Pharmacy, Gifu University Hospital, and Gifu Municipal Hospital to keep their clinical skills up-to-date; they also perform clinical research in collaboration with many clinical institutes. The Laboratory of Clinical Pharmacy is part of the Department of Pharmacy Practice and Science, to which the clinical professors belong, and is composed of three clinical professors (a professor, an associate professor, and an assistant professor). The professor administers the GPU Pharmacy as its director, while the associate professor and assistant professor provide pharmaceutical services to patients at Gifu Municipal Hospital, and also provide practical training for students in the GPU Pharmacy. Collectively, they have performed research on such topics as medication education for students, clinical communication education, and analysis of clinical big data. They have also conducted research in collaboration with clinical institutes, hospitals, and pharmacies. Here, we introduce the collaborative research between the Laboratory of Clinical Pharmacy and Gifu Municipal Hospital. These studies include "Risk factors contributing to urinary protein expression resulting from bevacizumab combination chemotherapy", "Hyponatremia and hypokalemia as risk factors for falls", "Economic evaluation of adjustments of levofloxacin dosage by dispensing pharmacists for patients with renal dysfunction", and "Effect of patient education upon discharge for use of a medication notebook on purchasing over-the-counter drugs and health foods". In this symposium, we would like to demonstrate one model of the association and collaborative research between these clinical professors and clinical institutes.
Directory of Open Access Journals (Sweden)
Antonio Javier Martín Castellanos
2014-10-01
Full Text Available Dahiri, Mohammed; Carmelo García, Juan; González, Santiago; Lozano, Carlos; Otega, Alejandra y Thieux, Laurence (eds., Sociedad civil y transiciones en el norte de África. Egipto, Túnez, Argelia, Marruecos. Barcelona, Icaria Editorial, 2013, 250 pp.
Professor Created On-line Biology Laboratory Course
Bowman, Arthur W.
2010-01-01
This paper will share the creation, implementation, and modification of an online college level general biology laboratory course offered for non-science majors as a part of a General Education Curriculum. The ability of professors to develop quality online laboratories will address a growing need in Higher Education as more institutions combine course sections and look for suitable alternative course delivery formats due to declining departmental budgets requiring reductions in staffing, equipment, and supplies. Also, there is an equal or greater need for more professors to develop the ability to create online laboratory experiences because many of the currently available online laboratory course packages from publishers do not always adequately parallel on-campus laboratory courses, or are not as aligned with the companion lecture sections. From a variety of scientific simulation and animation web sites, professors can easily identify material that closely fit the specific needs of their courses, instructional environment, and students that they serve. All too often, on-campus laboratory courses in the sciences provide what are termed confirmation experiences that do NOT allow students to experience science as would be carried out by scientists. Creatively developed online laboratory experiences can often provide the type of authentic investigative experiences that are not possible on-campus due to the time constraints of a typical two-hour, once-per-week-meeting laboratory course. In addition, online laboratory courses can address issues related to the need for students to more easily complete missing laboratory assignments, and to have opportunities to extend introductory exercises into more advanced undertakings where a greater sense of scientific discovery can be experienced. Professors are strongly encourages to begin creating online laboratory exercises for their courses, and to consider issues regarding assessment, copyrights, and Intellectual Property
Turning university professors into competent learners
Stefanova, Eliza; Ilieva, Miroslava; Nikolova, Nikolina; Stefanov, Krassen
2008-01-01
Stefanova, E., Ilieva, M., Nikolova, N, & Stefanov, K. (2008). Turning university professors into competent learners. In H. W. Sligte & R. Koper (Eds.), Proceedings of the 4th TENCompetence Open Workshop. Empowering Learners for Lifelong Competence Development: pedagogical, organisational and
Economos, Jennifer Lynn
2013-01-01
Some professors are expected to remain competitive research scholars, as well as teach, particularly in research-intensive universities. It has been argued that some professors spend too much time on research to obtain institutional incentives or promotion, and not enough time on teaching. Consequently, some adjuncts assume the responsibility for…
A formação do professor indígena
Directory of Open Access Journals (Sweden)
Vanessa Nunes Ramos
2014-03-01
Full Text Available O artigo aborda a temática Formação do Professor Indígena e teve como objetivo destacar os desafios e avanços no processo de formação docente no Estado de Mato Grosso. A pesquisa teve uma análise qualitativa, baseada na pesquisa bibliográfica. Concluiu-se que o professor indígena tem como função principal contribuir para a formação integral de sua comunidade, atuando para além da sala de aula, ele contribui com o desenvolvimento econômico, político, social e cultural da comunidade. Palavras-chave: educação; formação do professor indígena; cultura.
Discurso da autoajuda na formação do professor de língua
Directory of Open Access Journals (Sweden)
Wagner Rodrigues SILVA
2013-10-01
Full Text Available Este trabalho investiga a interferência do discurso de autoajuda nas representações de professor, construídas por alunos-mestres no contexto de formação de professores de língua. O embasamento teórico ancora-se no conceito de transdisciplinaridade como um fator central para a prática científica pós-moderna em Linguística Aplicada. Os resultados mostram que os discursos da autoajuda responsabilizam os professores tanto pelo sucesso quanto pelo fracasso de seus aprendizes. Consequentemente, o uso desse tipo de linguagem, durante os cursos de treinamento de professores, pode camuflar o empoderamento do professor, o que, por sua vez, pode comprometer a sua formação
Qualidade do sono entre professores e fatores associados
Denise Andrade Pereira Meier
2016-01-01
O sono desempenha função notável na prevenção de doenças, manutenção e recuperação da saúde física e mental. Como processo reparador, sofre influências de fatores determinantes e condicionantes, que o tornam complexo e multifacetado. As condições adversas de trabalho enfrentadas por professores podem prejudicar sua qualidade de vida e, consequentemente, seu padrão de sono. Este estudo objetivou analisar a qualidade do sono e fatores associados em professores da educação básica. Trata-se de um...
UNCOVERING RESISTANCE TO ICT USE IN LANGUAGE INSTRUCTION
Directory of Open Access Journals (Sweden)
Nur Kamilah
2016-04-01
Penelitian ini memaparkan hasil studi kasus terhadap seorang guru bahasa Inggris SMA di Situbondo yang resistan untuk menggunakan TIK di kelas. Berawal dari keprihatinan terhadap guru yang memilih untuk abai terhadap penggunaan TIK, terlepas dari penting dan berpotensinya TIK tersebut dalam meningkatkan keterampilan berbahasa siswa. Ditemukan bahwa variabel usia yang lanjut menjadi penyebab munculnya variabel lain seperti kurangnya motivasi belajar TIK dan rendahnya kemampuan menggunakannya yang berujung pada pilihannya untuk tidak menggunakan TIK di kelas sehingga tetap menggunakan metode mengajar konvensional. Variabel usia tersebut ternyata bukanlah pemicu utama sikap resistan tersebut, melainkan lemahnya kemampuan guru dalam memahami dan memenuhi tuntutan profesinya sebagai guru bahasa Inggris. Oleh karenanya, saran penelitian ditujukan pada guru agar lebih siap terhadap tuntutan dan tantangan lain dalam profesinya sehingga menjadi guru profesional.
Professor Rastislav Dzúrik: the Man and the Scientist.
Derzsiová, Katarina; Mydlík, Miroslav
2016-02-01
Rastislav Dzrik, finished his medical study at the Medical School of Comenius University in Bratislava in 1953. After graduation he began to work at the Institute of chemistry and biochemistry of the Medical School and in 1957 he continued working at the IIIrd Internal Clinic of this faculty, which became later the base of "Internal School of Professor T. R. Niederland" with biochemical focusing. In the year 1967 ProfessorDzrik in cooperation with ProfessorJan Brod founded the Nephrological Section of the Slovak Internal Society and then the postgraduate scientific-research activity in nephrology began. The main topics of his scientific activity, in which he received many priority results, were: Isolation and characteristic of inhibitor of glucose utilisation and of inhibitor of renal gluconeogenesis; Effect of "middle molecular substances, especially in the development of renal insufficiency; Isolation and identification of hippurate and pseudouridine. His publishing activity was manifested in more than 500 scientific papers, several monographs and many chapters in various textbooks and manuals of internal medicine and clinical biochemistry, and more than 1,000 citations. The most important success of Professor Dzrik was the textbook "Nephrology which was published in 2004 and he was its main editor. Rastislav Dzriks impact on the field of Nephrology in Slovakia was manifold. It included his complex work of clinical nephrology, his pedagogical activities, and last but not least his excellent organizing abilities.
Professor Jacques Cortes prantsuse keele lektoraadis
2000-01-01
Juuni alguses külastas filoloogiateaduskonna romaani-germaani filoloogia osakonda Roueni ülikooli professor Jacques Cortes (Prantsusmaa). Ta korraldas 4. õa üliõpilastele prantsuse keele intensiivkursuse ja võttis vastu eksami ning kohtus prantsuse keele lektoraadi õppejõududega : [täistekst
[Professor WU Zhongchao's experience of penetration needling].
Zhang, Ning; Wang, Bing; Zhou, Yu
2016-08-12
Professor WU Zhongchao has unique application of penetration needling in clinical treatment. Professor WU applies penetration needling along meridians, and the methods of penetration needling include self-meridian penetration, exterior-interior meridian penetration, identical-name meridian penetration, different meridian penetration. The meridian differentiation is performed according to different TCM syndromes, locations and natures of diseases and acupoint nature, so as to make a comprehensive assessment. The qi movement during acupuncture is focused. In addition, attention is paid on anatomy and long-needle penetration; the sequence and direction of acupuncture is essential, and the reinforcing and reducing methods have great originality, presented with holding, waiting, pressing and vibrating. Based on classical acupoint, the acupoint of penetration needling is flexible, forming unique combination of acupoints.
Analysis of Job Satisfaction of University Professors from Nine Chinese Universities
Du, Ping; Lai, Manhong; Lo, Leslie N. K.
2010-01-01
Research on work life and job satisfaction of university professors is becoming an important research issue in the field of higher education. This study used questionnaires administered to 1 770 teachers from different levels, types, and academic fields of Chinese universities to investigate job satisfaction among university professors and the…
Redox Pioneer: Professor Vadim N. Gladyshev.
Hatfield, Dolph L
2016-07-01
Professor Vadim N. Gladyshev is recognized here as a Redox Pioneer, because he has published an article on antioxidant/redox biology that has been cited more than 1000 times and 29 articles that have been cited more than 100 times. Gladyshev is world renowned for his characterization of the human selenoproteome encoded by 25 genes, identification of the majority of known selenoprotein genes in the three domains of life, and discoveries related to thiol oxidoreductases and mechanisms of redox control. Gladyshev's first faculty position was in the Department of Biochemistry, the University of Nebraska. There, he was a Charles Bessey Professor and Director of the Redox Biology Center. He then moved to the Department of Medicine at Brigham and Women's Hospital, Harvard Medical School, where he is Professor of Medicine and Director of the Center for Redox Medicine. His discoveries in redox biology relate to selenoenzymes, such as methionine sulfoxide reductases and thioredoxin reductases, and various thiol oxidoreductases. He is responsible for the genome-wide identification of catalytic redox-active cysteines and for advancing our understanding of the general use of cysteines by proteins. In addition, Gladyshev has characterized hydrogen peroxide metabolism and signaling and regulation of protein function by methionine-R-sulfoxidation. He has also made important contributions in the areas of aging and lifespan control and pioneered applications of comparative genomics in redox biology, selenium biology, and aging. Gladyshev's discoveries have had a profound impact on redox biology and the role of redox control in health and disease. He is a true Redox Pioneer. Antioxid. Redox Signal. 25, 1-9.
Gender and teamwork: an analysis of professors' perspectives and practices
Beddoes, Kacey; Panther, Grace
2018-05-01
Teamwork is increasingly seen as an important component of engineering education programmes. Yet, prior research has shown that there are numerous ways in which teamwork is gendered, and can lead to negative experiences for women students. This article presents the first interview findings on professors' perspectives on gender and teamwork. Semi-structured interviews were conducted with 39 engineering professors to determine what and how they thought about gender in engineering and engineering education. For this article, the parts of the interviews about teamwork are analysed. We conclude that professors need tools to help them facilitate gender-inclusive teamwork, and those tools must address the beliefs that they already hold about teamwork. The findings raise questions about the adoption of evidence-based instructional practices and suggest current teamwork practices may exacerbate gender inequalities in engineering.
comparação entre professores do ensino público e privado
Silva, Ana Vanessa Pereira
2016-01-01
Face à atual conjuntura de grande volatilidade nas políticas no sector educativo, é fundamental perceber quais as consequências das mudanças sociais e curriculares na vida dos professores. Existe um interesse geral por parte dos meios de comunicação social, professores, sindicatos e opinião pública sobre o estado da Educação em Portugal e sobre a problemática do stress profissional dos professores. Vários estudos de âmbito nacional e internacional têm vindo a assinalar os efeitos destas mu...
From movement to models: a tribute to professor Alan G. Hannam
Hylander, W.L.; McMillan, A.S.; Lam, E.W.N.; Watanabe, M.; Langenbach, G.E.J.; Stavness, I.; Peck, C.C.; Palla, S.
2008-01-01
This tribute article to Professor Alan G. Hannam is based on 7 presentations for him at the July 1, 2008 symposium honoring 3 "giants" in orofacial neuroscience: Professors B.J. Sessle, J.P. Lund, and A.G. Hannam. This tribute to Hannam’s outstanding career draws examples from his 40-year academic
Kuda Malwathumullage, Chamathca Priyanwada
Recent advancements in instructional technology and interactive learning space designs have transformed how undergraduate classrooms are envisioned and conducted today. Large number of research studies have documented the impact of instructional technology and interactive learning spaces on elevated student learning gains, positive attitudes, and increased student engagement in undergraduate classrooms across nation. These research findings combined with the movement towards student-centered instructional strategies have motivated college professors to explore the unfamiliar territories of instructional technology and interactive learning spaces. Only a limited number of research studies that explored college professors' perspective on instructional technology and interactive learning space use in undergraduate classrooms exist in the education research literature. Since college professors are an essential factor in undergraduate students' academic success, investigating how college professors perceive and utilize instructional technology and interactive learning environments can provide insights into designing effective professional development programs for college professors across undergraduate institutions. Therefore, the purpose of this study was to investigate college professors' pedagogical reasoning behind incorporating different types of instructional technologies and teaching strategies to foster student learning in technology-infused interactive learning environments. Furthermore, this study explored the extent to which college professors' instructional decisions and practices are affected by teaching in an interactive learning space along with their overall perception of instructional technology and interactive learning spaces. Four college professors from a large public Midwestern university who taught undergraduate science courses in a classroom based on the 'SCALE-UP model' participated in this study. Major data sources included classroom
Eller, Amanda
2016-07-01
This paper adds to discussion of transactional sex relationships in Africa by examining the distinction between transactional sex and sexual harassment in the context of professor-student relationships and their inherent power dynamics. By exploring the ways in which female university students in urban Benin toe the line between empowered agent and victim, I show how the power differential between professor and student obstructs the professor's ability to objectively determine consent, and examine why, in spite of this differential, male professors are frequently perceived as the victims of these relationships. Ethnographic data were gathered through participant observation on a public university campus in Benin and in-depth interviews and focus groups with 34 students and 5 professors from that university. Findings suggest that the problem of sexual harassment on campus will be difficult to address so long as transactional sex relationships between professors and students are permitted to continue.
Enabling Possibility: Women Associate Professors' Sense of Agency in Career Advancement
Terosky, Aimee LaPointe; O'Meara, KerryAnn; Campbell, Corbin M.
2014-01-01
In this multimethod, qualitative study we examined associate women professors' sense of agency in career advancement from the rank of associate to full. Defining agency as strategic perspectives or actions toward goals that matter to the professor, we explore the perceptions of what helps and/or hinders a sense of agency in career advancement. Our…
Marraccini, Marisa E; Weyandt, Lisa L; Rossi, Joseph S
2015-01-01
This study developed and examined the psychometric properties of a newly formed measure designed to assess professor/instructor bullying, as well as teacher bullying occurring prior to college. Additionally, prevalence of instructor bullying and characteristics related to victims of instructor bullying were examined. Participants were 337 college students recruited in 2012 from a northeastern university. An online questionnaire was administered to college students. A split-half, cross-validation approach was employed for measurement development. The measure demonstrated strong criterion validity and internal consistency. Approximately half of students reported witnessing professor/instructor bullying and 18% reported being bullied by a professor/instructor. Report of teacher bullying occurring prior to college was related to professor/instructor bullying in college, and sex was a moderating variable. College students perceive instructor bullying as occurring but may not know how to properly address it. Prevention efforts should be made by university administrators, faculty, and staff.
[Digital educational materials in nursing: assessment by professors from an undergraduate course].
Cogo, Ana Luísa Petersen; Pedro, Eva Néri Rubim; da Silva, Ana Paula Scheffer Schell; Schatkoski, Aline Modelski; Catalan, Vanessa Menezes; Alves, Rosa Helena Kreutz
2009-06-01
This study addresses the use of digital learning materials in the format of hypertext, educational games and simulations about oxygen therapy with professors of an Undergraduate Nursing Course. It is a cross-sectional exploratory study that was carried out at the Federal University of Rio Grande do Sul in 2006 with 10 intentionally selected professors. Data collection was performed by means of a questionnaire, using a Likert scale to assess the suitability of the content, visual presentation and use of learning materials. Descriptive statistics was used to organize and process the data. Results showed that the professors approved of the presentation of educational materials, they agreed with the suitability of the contents presented and with using the materials with the content regarding oxygen therapy. There was no significant relation between the professors' opinion and their age group, nor with their computer technology knowledge, their time in teaching and the addressed contents.
Communications and Informational Technologies: professional preparation of the Informatics professor
Directory of Open Access Journals (Sweden)
Adrian Robaina Valdés
2017-09-01
Full Text Available The development of the society it is sign by the development of the techniques and the science that has challenges the educational system in the formation of the new generation. The Cuban Educational politics had defined the social mission to each subsystem of education, in the particular case of the professional polytechnic education, belongs to the professors of Informatics, the accomplish of this mission, develop an important role in the educational use of the communication and informational technologies that requires and an adequate professional preparation. The aim of this article is to based form the theoretical and methodological point, the process of the professional preparation of the professors of informatics in the technical schools while they apply the communication and informational technologies, the theorical bases offered the historical past and tendencies of the professional preparation while they apply the communication and information technologies, the educative use of information technologies in the pedagogical process and the theoretical support in this process, using revision methods bibliography and systematizing . We may say that the research work concludes that the preparation of the professors had passed for different stages that had point to the need of the formation of professor to give answers to the introduction of the informatics subject at school, using different ways, the postgraduate updates and all the variety of ways to upgrade the professors will use. Form the educative point of view a part from the study as a subject must be use as an intermediate in the pedagogical process, also, to determine the characteristic that distinguish the professional preparation process.
Modos de ser enfermeiro-professor-no-ensino-do-cuidadode-enfermagem: um olhar heideggeriano
Directory of Open Access Journals (Sweden)
Luciara Fabiane Sebold
2013-08-01
Full Text Available Estudo qualitativo de abordagem fenomenológica. Objetivou desvelar, à luz do pensamento de Martin Heidegger, os modos de ser dos enfermeiros-professores na vivência de ensinar-aprender o cuidado de enfermagem em uma instituição federal de ensino superior do sul do Brasil. A técnica utilizada para captar os significados foi a entrevista fenomenológica com 11 docentes. A análise permitiu compreender os Modos de Ser enfermeiro-professor, que foram didaticamente apresentados em duas unidades de significado: Modo de ser enfermeiro para o cuidado; Modo de ser professor para o ensino do cuidado. Alguns professores identificam-se como enfermeiros, suas experiências profissionais são suas bases e a coexistência com outros pôde lhes servir de exemplo. Outros se percebem professores de enfermagem e desejam ensinar os desafios de ser enfermeiro, e aprimoram o cuidado através de pesquisas. Ao ensinar, envolvem-se com o universo de ensino no qual o cuidar também é aprender e ensinar.
Aspectos gerais da formação de professores
Directory of Open Access Journals (Sweden)
Edson do Carmo Inforsato
1996-08-01
Full Text Available Este artigo, ancorado em estudos recentes e antigos, mostra o afastamento dos cursos de formação de professores em relação aos elementos que compõem a prática profissional docente. Favorável a uma aproximação efetiva com o contexto das práticas de sala de aula, o autor defende a idéia de uma formação de professores atrelada aos problemas e necessidades da prática docente no ensino formal de 1º e 2º graus.
[Effective acupoints for bulbar paralysis by professor GAO Weibin].
Kang, Lianru; Zheng, Shuang
2016-04-01
Professor GAO Weibin academically advocates, based on basic theory of TCM and theories of different schools, modern science technology should be used for the methods and principles of acupuncture and Chinese medicine for neuropathy, so as to explore and summarize the rules, characteristics and advantages of TCM for nervous system disease, especially bulbar paralysis. During the treatment of bulbar paralysis, professor GAO creatively proposes the effective acupuncture points such as Gongxue, Tunyan-1, Tunyan-2, Fayin, Tiyan and Zhifanliu from the aspects of neuroanatomy, and analyzes their anatomical structure and action mechanism.
Interview met professor Joan Wallach Scott
Bijl, Greetje; Tijhoff, Esmeralda
2012-01-01
Joan Scott, professor at the School of Social Science in the Institute for Avanced Study in Princeton, New Jersey (USA), was the keynote speaker at the conference 'Uitsluitend emancipatie' in de Beurs van Berlage in Amsterdam in October 2012. An interview on gender, history, feminism and her book
Reflections of a Latino Associate Professor
Peguero, Anthony A.
2018-01-01
The following reflection essay is about my experiences as a Latino Associate Professor who focuses on criminology, youth violence, juvenile justice, and the associated disparities with race, ethnicity, and immigration. I reflect about the "race and justice" job market, pursuing and establishing a Latina/o Criminology working group, often…
Blanc
2004-01-01
CERN 50th Anniversary Official Celebration : keynote speech from Professor Federico Mayor Zaragoza, Professor in the Molecular Biology at the Universidad Autónoma of Madrid, Former Director-General of UNESCO
An Interview with Professor Melquíades de Dios Leyva, December 2008
Arias de Fuentes, Olimpia
When writing about the history of physics in Cuba, this remarkable professor of quantum mechanics must be mentioned, for he embodies a most genuine example of the turn taken by national educational policy after 1959: Education for all, at all levels, with no discrimination or elitism. The following is an interview granted by Dr. Melquíades de Dios Leyva, Outstanding Full Professor of the Physics Faculty of the University of Havana, to Dr. Olimpia Arias de Fuentes, Associate Professor at the same, and Senior Researcher of the Institute of Materials Science and Technology (IMRE) of the University of Havana.
Tecnologias e professores de Química: um programa brasileiro de desenvolvimento profissional
Directory of Open Access Journals (Sweden)
Marcelo Prado Amaral-Rosa
2017-01-01
Full Text Available O setor educacional é uma das esferas sociais afetadas diretamente pelas tecnologias digitais. Destinar atenção aos caminhos tomados por tais aparatos é vital para compreender os próprios processos educacionais. Nessa situação, enquadra-se a formação de professores. Assim, o objetivo geral é apresentar as nuances gerais do Programa de Desenvolvimento Profissional para Professores com a finalidade de contextualizar uma estratégia inovadora de formação de professores da rede básica pública de educação a partir das ações formativas desenvolvidas na área de Química. O programa foi ofertado pelo governo brasileiro aos professores da educação básica por meio de um acordo de cooperação internacional entre Brasil e Portugal. As formações ocorreram na Universidade do Porto e na Universidade de Aveiro. Foram ofertadas 175 vagas para professores de todas as regiões do Brasil nas áreas de Língua Portuguesa, Pedagogia, Física, Matemática e Química. A área de Química foi a única que ocorreu em ambas as instituições parceiras, sendo acompanhadas in loco. Percebe-se que o conhecimento por parte da comunidade de professores e pesquisadores sobre a ocorrência dessa formação ofertada pelo governo brasileiro é praticamente inexistente, assim faz-se se suma importância a divulgação dos contextos de ocorrência da mesma, tendo enquanto macro destaque a valorização dos professores da rede pública nacional.
Rakesh K. Kapania named Norris and Laura Mitchell Professor of Aerospace Engineering
Crumbley, Liz
2008-01-01
Rakesh K. Kapania, a professor in the Department of Aerospace and Ocean Engineering in the College of Engineering at Virginia Tech, was appointed the Norris and Laura Mitchell Professor of Aerospace Engineering by the Virginia Tech Board of Visitors during the board's quarterly meeting March 31.
IN MEMORIAM: PROFESSOR STELIAN PETRESCU (1951 – 2011
Directory of Open Access Journals (Sweden)
Ioan Mămăligă
2011-12-01
Full Text Available Today, I want to believe in the old saying that the soul, the spirit of the departed lingers on for a while among the living. I like to believe our homage here today will somehow reach Stelian Petrescu, our professor, colleague, mentor and coworker, who put his passion, talent, love and devotion into serving the chemical engineering school in Iaşi. His life and work have been closely related to our Faculty of Chemical Engineering and Environmental Protection. In 1975, he graduated from the Faculty of Industrial Chemistry of the Polytechnic Institute with a degree in the Technology of Inorganic Substances, and in 1980, he went on to teach at the “Gheorghe Asachi” Technical University in Iaşi, where he gradually built an exceptional career. In 1987, he earned a PhD in chemical engineering, and he became a full professor in 1996. A hard worker and brilliant researcher, Professor Petrescu has published over 15 books and textbooks and over 150 valuable scientific articles. He was also the author of over 40 patents, many of which received awards at international invention fairs. An outstanding member of the group of teachers with the Chemical Engineering Department, which he has run and coordinated for a long time, he has contributed to the education of over 30 generations of engineers and the development of a new generation of doctors in chemical engineering. He was beloved and held in high regard both by his students and his colleagues. Professor Petrescu has left this world prematurely, unexpectedly and unjustly. We will all miss him and will surely remember all the wonderful times we spent together. On behalf of his colleagues and students, I would like to extend my deepest condolences to his family.
Marraccini, Marisa E.; Weyandt, Lisa L.; Rossi, Joseph S.
2016-01-01
Objective This study developed and examined the psychometric properties of a newly formed measure designed to assess professor/instructor bullying, as well as teacher bullying occurring prior to college. Additionally, prevalence of instructor bullying and characteristics related to victims of instructor bullying were examined. Participants Participants were 337 college students recruited in 2012 from a northeastern university. Methods An online questionnaire was administered to college students. A split-half, cross-validation approach was employed for measurement development. Results The measure demonstrated strong criterion validity and internal consistency. Approximately half of students reported witnessing professor/instructor bullying and 18% reported being bullied by a professor/instructor. Report of teacher bullying occurring prior to college was related to professor/instructor bullying in college, and sex was a moderating variable. Conclusion College students perceive instructor bullying as occurring but may not know how to properly address it. Prevention efforts should be made by university administrators, faculty and staff. PMID:26151235
Physical activities practicing among scholar professors: focus on their quality of life
Directory of Open Access Journals (Sweden)
Jaqueline Dias
2017-10-01
Full Text Available Abstract Objective: To investigate the practice of physical activity among scholar professors focusing on their quality of life. Methods: A cross-sectional study was carried out with 121 professors at one of the campuses of a state university in the State of Paraná, using a questionnaire created by Baecke and adapted for the study. Results: The analyzed group presented a level of inadequate physical activity of 54.4%, with mean body mass of 26.20, considered overweight. Conclusion: The study indicated that professors do not practice physical activity at the level recommended by the World Health Organization; therefore, they are, for the most part, sedentary and have complaints of anxiety. It is advisable to carry out actions aimed at the health of the professors, directed to the modification in the lifestyle, with regular practice of physical activities and balanced diet, for the improvement of the quality of life.
Psychological well-being and psychological distress for professors in Brazil and Canada.
Directory of Open Access Journals (Sweden)
Ana Alice Vilas Boas
2014-12-01
Full Text Available Mental health, an important object of research in psychology as well as social psychology, can be determined by the relationship between psychological well-being and psychological distress. In this context, we search to understand: “How do compare mental health of professors working in public universities in an emerging country like Brazil with the one of professors working in a developed country like Canada?” and “What are the main differences in the indicators of mental health in work domain?”. This paper assesses psychological well-being and psychological distress for professors working in these two countries and test for their differences. The sample consists of 354 Brazilian professors and 317 Canadian professors. Data were collected through an on-line questionnaire assessing the following mental health indicators: anxiety, depression, loss of control, general positive affect and emotional ties. We compared the components of psychological distress and psychological well-being to analyse their relations. Additionally, we compared these components with work-life balance indicator. Reliability analyses demonstrated that all tested components are consistent to evaluate mental health. There are small mean differences between Brazilian and Canadian professors in all five components of mental health, but these differences are not statistically significant. Mean differences for work-life balance, gender, age, and bias of conformity are statistically different, although the size effects are small. Linear regression analysis, step by step, controlled for life events, showed that general positive affect, anxiety and emotional ties predict 31.5% of the scores of work-life balance. Additionally, we observed that Brazilian professors find more balance between professional and private life than do their Canadian colleagues. Promoting mental health is a challenge for public management sector, thus, public managers and governmental organizations can
The transformative experiences of a scientist-professor with teacher candidates
Lashley, Terry Lee Hester
This case study documented the pedagogical and philosophical change experiences of a senior research scientist-professor at a large Research I University as he implemented an open inquiry immersion course with secondary science teacher candidates. The 4-semester hour graduate-level credit course (Botany 531) is titled "Knowing and Teaching Science: Just Do-It!" The students were 5th-year education students who possessed an undergraduate degree in the biological sciences. The premise for the course is that to teach science effectively, one must be able to DO science. Students were provided with extensive opportunities to design and carry out experiments and communicate the results both orally and in a written format. The focus of this dissertation was on changes in the pedagogical philosophy and practice of the scientist-professor as he taught this course over a 4-year period, 1997--2000. The data used in this study include the scientist-professor's reflective journals (1997--2000), the students' journals (1997--2000), and interviews with the scientist-professor (2001--2002). HyperRESEARCH 2.03 software was used to code and analyze the reflective journals and transcribed interviews. Data were reviewed and then placed into original codes. The codes were then grouped into themes for analysis. Identified themes included (1) Reflective Practice, (2) Social Construction of Knowledge, (3) Legitimate Peripheral Participation, and (4) the Zone of Proximal Development. There is clear evidence that the scientist-professor experienced transformative changes in his philosophy and practice over the 4-year period. This is shown by (1) differences in learning outcomes and expectations for Do-It! course students and traditional course students, (2) documentation of the scientist-professor's movement through the Concerns Based Adoption Model (CBAM) Stages of Concern, (3) increased collaboration and support from the college of education, (4) development and delivery of two other
Patrice Loïez
2002-01-01
Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.
Professor Peter Higgs: "My Life as a Boson"
CERN. Geneva
2012-01-01
Professor Peter Higgs played a key role in the development of the Standard Model, our current theory of fundamental physics. The search for the Higgs Boson is the centrepiece of the LHC programme at CERN, and the existence of this famously elusive particle is likely to be confirmed or refuted with data currently being collected, using apparatus partly designed at Bristol. Professor Higgs will introduce the ideas of spontaneous symmetry breaking, and discuss how these developed from their application in condensed matter through the earlier work of Yoichiro Nambu and Jeffrey Goldstone, to the work of Robert Brout, Francois Englert and himself in 1964. The subsequent application of these ideas to electroweak theory will be discussed briefly.
Strategies for Professors Who Service the University to Earn Tenure and Promotion
Gentry, Ruben; Stokes, Dorothy
2015-01-01
Tenure and promotion are great aspirations for college professors. They are indicators of success in the professions. Universities stipulate in their official documents and numerous higher education publications specify what professors must achieve in order to earn tenure and promotion; which almost always cite effectiveness in teaching, research,…
Olivas-Ávila, José A; Musi-Lechuga, Bertha
2010-11-01
The purpose of the present study is to analyze the scientific production of the more productive Psychology faculty member of Spain through advised doctoral theses in the data base TESEO. The sample consisted of the 100 more productive professors of each one of the areas of Spanish Psychology. We reviewed a total of 4036 records of which 2339 belong to the 610 professors who conformed the sample. The results reveal that the percentage of professors who have not directed any thesis accounts for 24%. On the other hand, the proportion of thesis by professor by areas oscillates in a range of between 5.25 and 2.50, being Personality, Evaluation and Psychological Treatment the highest of this rank and Behavioral Sciences Methodology the last. In the last 7 years, the most productive professors have duplicated their theses direction. Finally, there is a rising trend in terms of theses read in every area, reaching the greater frequency in the years of 2003 and 2005. We discuss the considerations that represent the doctoral thesis direction for professors as criterion in their evaluation.
Yue Joseph Wang named Grant A. Dove Professor of Electrical and Computer Engineering
Owczarski, Mark
2009-01-01
Yue Joseph Wang, professor of electrical and computer engineering in the College of Engineering at Virginia Tech, has been named the Grant A. Dove Professor of Electrical and Computer Engineering by the Virginia Tech Board of Visitors.
Gross, Rachel; Kmeic, Julie; Worell, Judith; Crosby, Faye
2001-01-01
Examined whether feminist professors of psychology at women's colleges derived more job satisfaction than feminist professors at coed colleges. Surveys and interviews indicated that feminist professors were generally satisfied with their pedagogical situations and generally dedicated to and successful at teaching. Institutional affiliation…
Florida Tech professor gets three-year grant
2003-01-01
"Dr. Marc Baarmand, Florida Tech associate professor of physics, has received a three-year grant from the U.S. Department of Energy's Division of High Energy Physics, to conduct research with the Compact Muon Solenoid experiment" (1/3 page).
A formação do professor de biologia
Schlichting, Maria Cristina Rodrigues Maranhão
1997-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciencias da Educação O estudo evidencia o tratamento dicotômico mantido na estrutura curricular dos cursos de formação do professor de biologia considerando ser essa prática responsável pelos preconceitos que levam à desvalorização da prática pedagógica. O estudo parte da análise da estrutura curricular e aprofunda-se com entrevistas que buscam levantar o posicionamento dos professores dos cursos de Ciências Biológi...
Directory of Open Access Journals (Sweden)
Castaño Madroñal, Ángeles
2005-06-01
Full Text Available The Naked Bread was the first novel written by Moroccan writer Mohammed Chukri. The author himself has described it as an autobiographical work, for it narrates the misadventures of a kid from the rural Rift migrating with his family to Tangiers, where they settle in a slum. The novel illustrates the passing from rural poverty to urban destitution in the Morocco of the Spanish Protectorate. By analyzing the novel, Castaño Madroñal discusses the validity of literary works as suitable sources of ethnographic data for the social conditions reigning in the underprivileged areas of Moroccan cities. A parallel can be established with current rural migration to urban areas and to countries north of Morocco. The analysis builds upon the hypothesis of an ethnoliterature that draws from literary sources to approach the social reality ethnographically. Ethnoliterature can be a useful source for cultural knowledge prior to ethnographic study. It can also be a tool for cross-cultural comparisons and the anthropological analysis of social communities.
El Pan Desnudo fue la primera novela del escritor marroquí Mohammed Chukri. El propio autor la ha definido como una novela autobiográfica. En ella se narran las peripecias de un chiquillo de origen rifeño que emigra con su familia desde una zona rural rifeña a Tánger, donde se ubican en un barrio marginal de la ciudad. Se plantea a través del análisis de esta obra la validez de este tipo de textos literarios como fuente etnográfica de una realidad social existente en los barrios marginales de las grandes urbes marroquíes. En el análisis se parte de la hipótesis de una etnoliteratura que nace de las fuentes literarias y permite un acercamiento etnográfico a la realidad social. La etnoliteratura se revelaría como una útil fuente de conocimiento cultural, previo al trabajo etnográfico, así como una herramienta para la comparación transcultural y el análisis antropológico.
Olivas-Ávila, José A; Musi-Lechuga, Bertha
2010-11-01
The present work is a descriptive study by means of document analysis that aims to make the analysis of the more productive professors of psychology in Spain trough indexed Web of Science journal articles. The sample was conformed of the first one hundred more productive professors of each one of the six academic areas of Spanish Psychology. A total of 85492 records were analyzed of which 8770 correspond to the 610 analyzed professors. The main results are that from the more productive professors ranking, six belong to the Psychobiology area and only 4 belong to different areas. With respect to the average proportion of articles by Professor of the six areas of psychology, it was found that that range of the proportion oscillates between 25 and 6. The journal Psicothema maintains the most frequency of records among the professors of the sample since they are 1461 which represents a 17% of the total. Finally, we discuss the results and mentioned the implications in the professor's evaluation.
Professor: A motorized field-based phenotyping cart
An easy-to-customize, low-cost, low disturbance, motorized proximal sensing cart for field-based high-throughput phenotyping is described. General dimensions, motor specifications, and a remote operation application are given. The cart, named Professor, supports mounting multiple proximal sensors an...
Lifelong learning: Science professors need leadership training
Leiserson, Charles E.; McVinney, Chuck
2015-01-01
Education does not stop. Professors must update and develop their technical skills throughout their careers. But as they progress, few take the time — or are offered the opportunity — to become educated in how to be an effective leader.
Professor Stewart's incredible numbers
Stewart, Ian
2015-01-01
Ian Stewart explores the astonishing properties of numbers from 1 to10 to zero and infinity, including one figure that, if you wrote it out, would span the universe. He looks at every kind of number you can think of - real, imaginary, rational, irrational, positive and negative - along with several you might have thought you couldn't think of. He explains the insights of the ancient mathematicians, shows how numbers have evolved through the ages, and reveals the way numerical theory enables everyday life. Under Professor Stewart's guidance you will discover the mathematics of codes,
Professor de Hevesy traces radioisotope history
International Nuclear Information System (INIS)
1965-01-01
Professor George de Hevesy, who was a pioneer in the field of radioactive tracers, prepared this paper for the IAEA symposium on Radiochemical Methods of Analysis, held at Salzburg in October 1964. Professor de Hevesy was born in Budapest in 1885. He studied in Budapest, Berlin and Freiburg, and spent some years at Zurich when Einstein was there. In 1911 he went to Manchester to work with Rutherford and there witnessed some of the greatest discoveries in the history of physics. At the end of 1912 he visited the Vienna Institute for Radium Research, where he worked with Paneth, and in 1913 applied the method of labelled lead for the first time. After the first world war, he worked at the Institute for Theoretical Physics in Copenhagen; since 1943, his chief activities have been in Sweden. In 1923, with Coster, he discovered the element hafnium. He made notable discoveries on the mobility of ions, and isotope separation, and his work on radioisotope tracers, which has had important biological applications, won him the Nobel Prize for Chemistry in 1943
26 CFR 509.115 - Visiting professors or teachers.
2010-04-01
...) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.115 Visiting professors or teachers. (a... not exceeding two years at any university, college, school, or other educational institution situated...
Han, Suejung; Pistole, M. Carole; Caldwell, Jarred M.
2017-01-01
This study examined parental and professor attachment as buffers against acculturative stress and as predictors of college adjustment of 210 Asian international students (AISs). Moderated hierarchical regression analyses revealed that acculturative stress negatively and secure parental and professor attachment positively predicted academic…
Professor Sergei Semjonovic Golovin (1866-1931): A Pioneer of Ocular Surgery.
Moschos, Marilita M
2017-10-01
Professor Sergei Semjonovic Golovin (1866-1931) is considered as one of the founders of ophthalmology in Russia. He received a worldwide reputation thanks to his achievements in ocular surgery and pathology. He introduced new surgical techniques such as Golovin's operation (Exenteratio orbitosinualis), Golovin's osteoplastic frontal sinus operation, ligation of orbital veins, and opticociliary neurectomy. He also introduced his "cytotoxic theory" to interpret sympathetic ophthalmia. He was a reputable professor of ophthalmology.
Aspectos motivacionais e afetivos na mediação de professores alfabetizadores
Directory of Open Access Journals (Sweden)
Azevedo, Cleomar
2010-01-01
Full Text Available Este artigo é o resultado de uma pesquisa que parte da seguinte questão: o que diferencia o professor que obtém sucesso no processo de alfabetização? Levanto a hipótese que na mediação os aspectos motivacionais e afetivos são componentes que se fazem presente na atuação desses professores alfabetizadores. O objetivo desta pesquisa foi o de levantar os aspectos motivacionais e afetivos na mediação do processo de alfabetização, através da fala de professores alfabetizadores. Foram entrevistados 18 professores com a premissa de serem bons alfabetizadores. Investigar o que mobiliza e caracteriza a ação dos docentes, que mesmo possuindo inúmeras variáveis que interfiram negativamente nesse processo, conseguem obter êxito no desenvolvimento da alfabetização de seus alunos é uma possibilidade de levantar questões voltadas à problemática da aprendizagem do processo de alfabetização
Outline of an intellectual biography of Professor Waldemar Dutkiewicz (1939–2007
Directory of Open Access Journals (Sweden)
Paweł Grzybek
2017-09-01
Full Text Available The date of February 19, 2017 has marked the 10th death anniversary of Prof. Waldemar Dutkiewicz, who was an outstanding pedagogue, organiser of didactic and educational work, great social worker, and above all an eminent scholar. Professor Dutkiewicz died suddenly on February 19, 2007, still with his full creative forces. The professor was born on June 2, 1939 in Rivne, in Volhynia. In the period 1957–1963 he studied at the School of Physical Education in Krakow. He completed his pedagogical studies in 1970 at the Higher School of Pedagogy in Krakow. In 1973 he obtained a doctoral degree in physical education. His doctorate in pedagogy was publicly defended in 1982. At the Academy of Physical Education in Warsaw he received his Doctor of Letters (habilitation degree in the field of physical education in 1986. By a decision of the President of the Republic of Poland of August 22, 1995 he was awarded the title of Professor. Due to his studies and didactic work the heritage of Professor Dutkiewicz is composed of two parts: auxological and pedagogical.
Professor Andrzej Nespiak (1921-1981
Directory of Open Access Journals (Sweden)
Tomasz Majewski
2014-08-01
Full Text Available The biography of a professor of the Laboratory of Pharmaceutical Botany of the Medical Academy in Wrocław, who was formerly an investigator of the Agricultural Academy in Wrocław. He worked on mycorhiza, the participation of Macromycetes in forest communities and the use of fungi for synthesis of some organic compounds, he was also the author of the Polish flora of the genus Cortinarius (1975,1981 and Inocybe (manuscript.
Professor Andrzej Nespiak (1921-1981)
Tomasz Majewski
2014-01-01
The biography of a professor of the Laboratory of Pharmaceutical Botany of the Medical Academy in Wrocław, who was formerly an investigator of the Agricultural Academy in Wrocław. He worked on mycorhiza, the participation of Macromycetes in forest communities and the use of fungi for synthesis of some organic compounds, he was also the author of the Polish flora of the genus Cortinarius (1975,1981) and Inocybe (manuscript).
Professor dr hab. Maria Lisiewska
Directory of Open Access Journals (Sweden)
Małgorzata Stasińska
2015-08-01
Full Text Available The article presents the biography and scientific achievements of Professor Maria Lisiewska. She earned master’s degree and Ph.D. in natural sciences from Adam Mickiewicz University in Poznań. After earning her doctoral degree, she stayed at Adam Mickiewicz University in Poznań and conducted her thrilling research on mycology and taught until now. Prof. Maria Lisiewska is an author of many books, articles, and other scholarly reports.
Benchmarking for Best Practice
Zairi, Mohamed
1998-01-01
Benchmarking for Best Practice uses up-to-the-minute case-studies of individual companies and industry-wide quality schemes to show how and why implementation has succeeded. For any practitioner wanting to establish best practice in a wide variety of business areas, this book makes essential reading. .It is also an ideal textbook on the applications of TQM since it describes concepts, covers definitions and illustrates the applications with first-hand examples. Professor Mohamed Zairi is an international expert and leading figure in the field of benchmarking. His pioneering work in this area l
Ewing, John C.; Whittington, M. Susie
2009-01-01
The purpose of this study was to describe the cognitive level of professor discourse and student cognition during selected college of agriculture class sessions. Twenty-one undergraduate class sessions were videotaped in 12 professors' courses. Results were interpreted to show that professors' discourse was mostly (62%) at the knowledge and…
King, Berkley Nathaniel, Jr.
This study was conducted to analyze professors' perceptions on the institutional redevelopment of brownfield sites into usable greenspaces. The U.S. Environmental Protection Agency (2016) refers to brownfields as sites, (either facility or land) under public law § 107-118 (H.R. 2869), which are contaminated with a substance that is classified as a hazard or a pollutant. Usable greenspaces, however, are open spaces or any open piece of land that is undeveloped, has no buildings or other built structures, and is accessible to the public (EPA, 2015). Open green spaces provide recreational areas for residents and help to enhance the beauty and environmental quality of neighborhoods (EPA, 2015). In addition, in a study conducted by Dadvand et al. (2015), exposure to green space has been associated with better physical and mental health among elementary school children, and this exposure, according to Dadvand et al., could also influence cognitive development. Because of the institutional context provided in these articles and other research studies, a sequential mixed-methods study was conducted that investigated the perceptions of professors towards the redevelopment of brownfields near their campuses. This study provided demographics of forty-two college and university professors employed at two institutions in the state of Alabama, a southeastern region of the United States. Survey questions were structured to analyze qualitative data. The secondary method of analysis utilized descriptive statistics to measure the most important indicators that influences professors' perceptions. The collection of quantitative data was adapted from an instrument designed by Wernstedt, Crooks, & Hersh (2003). Findings from the study showed that professors are knowledgeable and aware of the sociological and economic challenges in low income communities where brownfields are geographically located. Pseudonyms are used for the three universities which were contacted. Findings also
O PROFESSOR DAS ESCOLAS DO CAMPO: TRABALHADOR DE MÚLTIPLAS JORNADAS DE TRABALHO
Odimar J. Peripolli; Alceu Zoia
2014-01-01
As crescentes transformações socioeconômicas e o desenvolvimento do modo de produção têm provocado mudanças significativas no mundo do trabalho. As mudanças se fazem sentir também na escola. Neste trabalho nos propomos trazer para a reflexão um pouco da realidade da educação do campo, mais especificamente, as condições de trabalho do professor. Trabalhador dividido entre os muitos afazeres. Na roça: o camponês-professor e, na escola/ sala de aula: o professor-camponês. Em ambas as atividades,...
O ensino e a experiência nas narrativas de professores de Inglês
Directory of Open Access Journals (Sweden)
Annallena de Souza Guedes
2016-09-01
Full Text Available Resumo: Este trabalho tem como objetivo analisar três narrativas de professores de Inglês em exercício, através das quais são reveladas experiências que dizem respeito ao processo de ensinar Inglês em contextos de instituições públicas no Brasil. Pautado no conceito de experiência (MICCOLI, 2010, buscamos compreender quais experiências emergem dessas narrativas e como elas influenciam na prática de ensino dos professores. Ademais, intentamos analisar como os professores de Inglês se veem e quais desafios ele enfrentam nos seus contextos de trabalho. Os resultados desse estudo mostraram que, apesar de todas as experiências de dificuldades e indisciplina reveladas nas narrativas, duas delas parecem ainda encontrar motivação e esperança quanto à sua profissão. Além disso, percebemos que o modo como os professores veem sua realidade, seus alunos e seu trabalho são importantes para caracterizar sua prática profissional. Assim, acreditamos que o contexto e as experiências retratados nas narrativas podem ser caminhos que direcionem as ações desses professores em sala de aula e, consequentemente, possibilitem reflexões e mudanças no seu papel como educador.
Why Don't All Professors Use Computers?
Drew, David Eli
1989-01-01
Discusses the adoption of computer technology at universities and examines reasons why some professors don't use computers. Topics discussed include computer applications, including artificial intelligence, social science research, statistical analysis, and cooperative research; appropriateness of the technology for the task; the Computer Aptitude…
LIFE JOURNEY: MEDICAL AND SCIENTIFIC WORK OF PROFESSOR V.A. SOKOLOV
Directory of Open Access Journals (Sweden)
P. A. Ivanov
2017-01-01
Full Text Available The article is dedicated to doctor of medicine, professor V.A. Sokolov. In 2017 he celebrates his eightieth birthday. Professor V.A. .Sokolov is one of the founders of polytrauma treatment in USSR and Russia. For a long time he had been heading polytrauma department at the N.V. Sklifosovsky Research Institute for Emergency Medicine. Due to his work, algorithms of life sustaining and recovery of serious patients were developed. Professor V.A. Sokolov is the author of 6 monographies and about 300 periodical papers. Besides, he is the holder of 32 patents. Some of his inventions were popularized and manufactured. He had been leading active scientific work, which resulted in 6 doctoral dissertations and 15 candidate theses. The staff of N.V. Sklifosovsky Research Institute for Emergency Medicine congratulates on the anniversary.
Factors related to successful teaching by outstanding professors: an interpretive study.
Rossetti, Jeanette; Fox, Patricia G
2009-01-01
The purpose of this study was to identify and describe factors associated with successful university teaching within the cultural norms of a public university in the midwestern United States. An interpretive analysis was conducted using the educational philosophy and goal statements of 35 university professors who received Presidential Teaching Awards from the university. The professors' diverse disciplines included nursing, curriculum and instruction, accountancy, music, and political science. The authors offer nursing educators the opportunity to increase their confidence and effectiveness by "learning" from faculty members who have been recognized as exceptionally successful in teaching. Four main relevant themes associated with successful university teaching were identified: Presence, Promotion of Learning, Teachers as Learners, and Enthusiasm. The narratives of the professors helped define the meaning of successful teaching across disciplines and offer nursing faculty additional perspectives and experiences.
Patrice Loïez
2001-01-01
H. E. Professor Wang Liheng, Minister of Aviation, and President, China Aerospace Science & Technology Corporation, People's Republic of China (2nd from left) with (from left to right) Professor Hans Hofer, Professor Roger Cashmore, Research Director for Collider Programmes, Professor Samuel C. C. Ting, CERN and Professor Lei Gang, Secretary to the Minister, September 2001.
Online Student Evaluation of Teaching: Will Professor "Hot and Easy" Win the Day?
Mangan, Michael A.; Fleck, Bethany
2011-01-01
A qualitative content analysis of student comments on RateMyProfessors.com (RMP) identified the characteristics of professors rated as "good," "average," and "poor." Comments contained instructor characteristics consistent with prior research on the qualities of effective and ineffective college teachers. To better understand how students might…
Representações sociais de professores sobre o autismo infantil
Santos,Michele Araújo; Santos,Maria de Fátima de Souza
2012-01-01
Este trabalho teve o objetivo de investigar, a partir da teoria das representações sociais, as ideias de senso comum que circulam entre professores acerca do autismo infantil. Buscamos compreender a lógica interna de tais teorias populares, mapear os saberes que as apoiam e as imagens que as concretizam. Os 16 participantes do estudo compuseram dois grupos: 9 professoras experientes na educação de crianças autistas e 7 professores sem experiência com tais crianças. Os dados obtidos através de...
O papel da instituição para escolher, acolher e acompanhar ao professor universitário
da Silva Marques Ferreira, Maria de Lourdes
2011-01-01
Objective. To analyze the role of the institution in choosing, receiving and chaperone professors. Methodology. Qualitative study, which body analysis was composed of 32 participations in a thematic forum of a group of nine health professionals. Results. After professor hiring it is necessary to receive and chaperone him. Professors with longer time in the institution represent a more important role in the admission of the new professor. Chaperone process is an opportunity to change and redef...
Final Comments from Professors George and Beane.
Beane, James; George, Paul S.
1996-01-01
Concludes this journal focus section on curriculum integration with transcripts of questions asked by conference attendees and answers by Professors Beane and George. Areas addressed included experience levels with children and teachers, studies that point to the failure of curriculum integration, and how teachers can continue curriculum…
An Outstanding Career: Professor Emeritus Iacob Cătoiu
Directory of Open Access Journals (Sweden)
Octavian Oprică
2016-05-01
Full Text Available Through the duration of his commissions of Deputy Dean (1981-1989 and, respectively, Dean (1992-2003, and also by the manner of approaching the managerial problems and his scientific extension, Professor Iacob Cătoiu left and indelible trace on the evolution of the former Department of Commerce in the Bucharest University of Economic Studies (ASE – now the Department of Business and Tourism. He is author or co-author of an important number of books (57 and articles (105 and book presentations. Thus, after he made the personal acquaintance with Philip Kotler, the guru of international marketing, in 1997, Professor Iacob Cătoiu wrote the Forward to the Romanian version of Philip Kotler's volume Managementul marketingului (Marketing Management a fundamental book in its field. (Nicolae Lupu
Directory of Open Access Journals (Sweden)
Kamel Chachoua
2011-04-01
Full Text Available D’islam et d’Ailleurs est un livre collectif dirigé par Mohammed Kerrou autour de l’œuvre et de la pensée de Clifford Geertz (1926-2006. Le livre est publié aux éditions Cérès dans une belle collection « texto », en 2008, à Tunis. Il est, en partie, l’aboutissement imprimé d’une journée d’étude organisée par les enseignants du Master d’Anthropologie sociale et culturelle, qui s’est tenu, le 30 avril 2007, à l’Institut supérieur des sciences humaines (Université de Tunis El-Manar, dans les l...
120 aastat professor Nikolai Maimi sünnist / Väino J. Riismandel
Riismandel, Väino, 1920-2017
2004-01-01
Professor Maim (26. veeb. 1884 Tartus - 10. jaan. 1976 USA) on lõpetanud Moskva ülikooli õigusteaduskonna (1909), Tartu Ülikooli riigiõiguse erialal (1915). Ta on töötanud Vene keisririigi siseministeeriumi teenistuse eriülesandeis ametnikuna, Eesti Vabriigis siseministri abina, välisministeeriumi juriskonsultina. Maimi peamiseks ülesandeks kujunes korraldamisjärgus oleva Tartu Ülikooli õigusteaduskonna organiseerimine. Peale 1944. aastal Eestist põgenemist oli ta õppejõuks Marburgi ülikoolis riigiteaduse ja riigiõiguse alal. LL.M. (George Washingtoni ülikool) Väino J. Riismandel on District of Columbia advokatuuri liige, oli professor Maimi õpilane ja töökaaslane Tartu Ülikoolis. Lisatud: professor Maimi trükis ilmunud tööd lk. 65
Teachers perception about epilepsy Percepção de professores sobre epilepsia
Directory of Open Access Journals (Sweden)
Paula T. Fernandes
2007-06-01
percepção dos professores do ensino fundamental a respeito da epilepsia, antes e depois de um curso específico sobre o tema. MÉTODO: Participaram da pesquisa professores de nove escolas da rede pública do ensino fundamental de Barão Geraldo, distrito de Campinas, SP. Dois pesquisadores reuniram-se com os professores e apresentaram a Campanha Global "Epilepsia fora das sombras", momento também em que os questionários foram aplicados. Vinte professores ficaram motivados para fazer o curso de extensão "Temas transversais: epilepsia e saúde". Após este curso, os questionários foram re-aplicados. RESULTADOS: Foram aplicados 100 questionários em professores das nove escolas, sendo que: noventa e sete professores eram do sexo feminino, idade média de 42 (D.P. 22 a 63 e 64 estavam casados. Quarenta e três professores declararam possuir conhecimento sobre epilepsia abaixo da média e 20, disseram possuir um pobre conhecimento sobre a condição. No que diz respeito à idéias sobre epilepsia, os professores acham que: as crianças com epilepsia tem QI igual (45%, na média (18%, abaixo da média (6% e não sabem opinar (29%; crianças com epilepsia têm maior chance de terem doença mental no futuro (51%; a epilepsia é uma doença (68%; a epilepsia é contagiosa (1%; a epilepsia é tratável (90%. Após o curso, crenças e mitos sobre epilepsia dos professores mostraram diferenças significativas. DISCUSSÃO: Idéias errôneas sobre epilepsia podem ser mudadas através de cursos educacionais sobre epilepsia. Este trabalho, realizado com professores do ensino fundamental, visou a identificação das dificuldades relacionadas à epilepsia para promover a redução do estigma. É importante que professores sejam melhor instruídos sobre a epilepsia para consequentemente, ter atitudes mais positivas em relação às crianças com epilepsia. Acreditamos que professores mais capacitados melhoram a maneira de lidar e de se relacionar com crianças com epilepsia, para a
Owczarski, Mark
2010-01-01
Maury Nussbaum, professor of industrial and systems engineering in the College of Engineering at Virginia Tech, has been reappointed as the Hal G. Prillaman Professor Fellow in Industrial and Systems Engineering by the Virginia Tech Board of Visitors.
Brian M. Kleiner receives Ralph H. Bogle Professor Fellowship in Industrial and Systems Engineering
Owczarski, Mark
2010-01-01
Brian M. Kleiner, professor of industrial and systems engineering in the College of Engineering at Virginia Tech, has been named the Ralph H. Bogle Professor Fellow in Industrial and Systems Engineering by the Virginia Tech Board of Visitors.
Directory of Open Access Journals (Sweden)
zineb Bahji Bahji
2017-11-01
Full Text Available The present review focuses on the temporary exhibition Presence Commune that was held at Museum Mohammed VI for Modern and Contemporary Arts (MMVI of Rabat, Morocco, from 28 March to 31 September 2017. The review contextualizes the exhibition Presence Commune and examines the communicative strategies it used to convey its messages. It also explains how this artistic event adds to the various artistic and cultural programmes and events that the Moroccan National Foundation of Museums organizes in the course of democratizing access to culture and promoting harmony and tolerance through the universal language of art. The review also shows how the exhibition reflected the role of MMVI in initiating dialogues among artists and visitors from different ethnicities, religions, and African countries, and how it supportedMorocco’s new cultural agenda.Morocco has made cultural diplomacy a priority after the uprisings of the Arab Spring and the rise of religious and ethnic conflicts in the region of North Africa and theMiddle East.
Student teachers can be as good as associate professors in teaching clinical skills
DEFF Research Database (Denmark)
Tolsgaard, Martin G; Gustafsson, Amandus; Rasmussen, Maria B
2007-01-01
AIM: The aim of this study is to compare student teachers and clinical associate professors regarding the quality of procedural skills teaching in terms of participants' technical skills, knowledge and satisfaction with the teaching. METHODS: This is an experimental, randomized, controlled study....... CONCLUSION: Trained student teachers can be as good as associate professors in teaching clinical skills. Udgivelsesdato: 2007-Sep...... comparing the teaching of student teachers and associate professors regarding participants' learning outcome and satisfaction with the teaching. Two skills are chosen for the experiment, i.v.-access and bladder catheterization. Learning outcome is assessed by a pre- and post testing of the participants...
Liu, Cheng-yong; Xu, Fu-song
2015-04-01
To analyze the efficacy and medication principles of Professor Xu Fu-songs traditional Chinese medicine (TCM) protocols for male diseases. We reviewed and descriptively analyzed the unpublished complete medical records of 100 male cases treated by Professor Xu Fu-song with his TCM protocols from 1978 to 1992. The 100 cases involved 32 male diseases, most of which were difficult and complicated cases. The drug compliance was 95%. Each prescription was made up of 14 traditional Chinese drugs on average. The cure rate was 32% , and the effective rate was 85%. Professor Xu Fu-song advanced and proved some new theories and therapeutic methods. Professor Xu Fu-song's TCM protocols can be applied to a wide range of male diseases, mostly complicated, and are characterized by accurate differentiation of symptoms and signs, high drug compliance, and excellent therapeutic efficacy.
PROFESSOR I.N. EVIAN-PRECURSOR OF ACCOUNTING SCHOOL FROM CLUJ
Directory of Open Access Journals (Sweden)
Tiron Tudor Adriana
2011-07-01
Full Text Available Our paper is about the history of accountancy in Romania, in Transylvania. We develop this subject because we consider that is very important to know about the history of your own country, and from our point of view about the history of accounting, which is a very important component of nowadays life. This work paper presents the history of the accountancy trought the study of biography. So by describing the work of professor I.N. Evian, who was an important personality for the accounting history in Romania, we want to found historical elements that are not so able to see otherwise. The article wants to highlight the impact that the work of professor Evian had in the history of accounting in Romania. Also, by presenting the work of professor I.N. Evian in the context of the Academy of High Commercial and Industrial Studies from Cluj, we want to prove that this institution was the first form of higher education in Transylvania in the accountancy field.
Interview with Professor Mark Wilcox.
Wilcox, Mark
2016-08-01
Mark Wilcox speaks to Georgia Patey, Commissioning Editor: Professor Mark Wilcox is a Consultant Microbiologist and Head of Microbiology at the Leeds Teaching Hospitals (Leeds, UK), the Professor of Medical Microbiology at the University of Leeds (Leeds, UK), and is the Lead on Clostridium difficile and the Head of the UK C. difficile Reference Laboratory for Public Health England (PHE). He was the Director of Infection Prevention (4 years), Infection Control Doctor (8 years) and Clinical Director of Pathology (6 years) at the Leeds Teaching Hospitals. He is Chair of PHE's Rapid Review Panel (reviews utility of infection prevention and control products for National Health Service), Deputy Chair of the UK Department of Health's Antimicrobial Resistance and Healthcare Associated Infection Committee and a member of PHE's HCAI/AR Programme Board. He is a member of UK/European/US working groups on C. difficile infection. He has provided clinical advice as part of the FDA/EMA submissions for the approval of multiple novel antimicrobial agents. He heads a healthcare-associated infection research team at University of Leeds, comprising approximately 30 doctors, scientists and nurses; projects include multiple aspects of C. difficile infection, diagnostics, antimicrobial resistance and the clinical development of new antimicrobial agents. He has authored more than 400 publications, and is the coeditor of Antimicrobial Chemotherapy (5th/6th/7th Editions, 15 December 2007).
"Putting in Your Time": Faculty Experiences in the Process of Promotion to Professor
Gardner, Susan K.; Blackstone, Amy
2013-01-01
The rank of professor or "full" professor represents the highest status possible for faculty members, and it is generally gained by attaining professional expertise and a national or international reputation. Beyond this, however, little is known about these individuals or the promotion process at this level. In this qualitative study of…
PROFESSORES DO PISA: A ESPERANÇA E A REALIZAÇÃO DA EDUCAÇÃO
Directory of Open Access Journals (Sweden)
Daniel Pettersson
Full Text Available RESUMO: As atividades do Programme for International Student Assessment (PISA e os seus efeitos são diversos, sendo possível dizer que o PISA cria e forma uma fundamentação específica (HACKING, 1992 para discutir, falar e pensar sobre a educação. Neste estudo sobre as atividades do PISA, são analisadas as ideias sobre os professores, as atividades que realizam, e como estas são conceitualizadas no interior de uma narrativa própria ao PISA. Os resultados mostram que os professores são apresentados como sendo importantes e cruciais para a transformação e para o desenvolvimento da educação. Os professores também são representados como sendo essenciais para reduzir as "disparidades no desempenho" dos alunos medidas pelo teste PISA. Ademais, os "bons" professores e o ensino "eficaz" são descritos como os professores e as estratégias que conduzem a tal redução. Consequentemente, os principais relatórios do PISA enfatizam uma imagem dos professores como os atores que desenvolvem a educação e o ensino, e não como executantes de políticas determinadas pelo Estado. Deste modo, os professores são considerados como indicadores da eficácia dos sistemas de educação e importantes para elevar os padrões de desempenho, sendo assim considerados como a esperança e a realização da educação.
In Memoriam: Professor Jan M. Hoem
Directory of Open Access Journals (Sweden)
James W. Vaupel
2017-02-01
Full Text Available Jan Hoem died on Saturday in Stockholm after a long illness. Jan became Director of the Max Planck Institute for Demographic Research (MPIDR in 1999; he and I jointly led the Institute for almost eight years. During this period he served as Editor of Demographic Research; he took on this responsibility shortly after the journal was launched and built the journal into a respected online source of cutting-edge analysis. Jan was a superb colleague, with very good judgment, a delightful sense of humor, and deep devotion to research quality. A pioneer of event history analysis, he understood the subtleties of the subject better than anyone else. Jan was born and educated in Norway and worked in Oslo before becoming Professor in Copenhagen and then Professor in Stockholm, where he established SUDA, a leading demographic research initiative. His dedication to high-quality, statistically sophisticated population research at SUDA and MPIDR as well as in the journal Demographic Research substantially advanced the discipline of demography. Jan was a warm and generous teacher, a loyal colleague, and a caring friend whom many people will long remember with gratitude and respect. James W. Vaupel Publisher, Demographic Research
Desafios à formação de professores alfabetizadores em curso de pedagogia
Directory of Open Access Journals (Sweden)
Benedita de Almeida
2012-08-01
Full Text Available Este artigo discute resultados de pesquisa sobre a formação inicial de professores em um curso de pedagogia e seus desdobramentos na prática docente de ensino de língua materna nos anos iniciais do ensino fundamental. As reflexões, fundamentadas na teoria histórico-cultural do desenvolvimento, identificam e tomam como objeto de análise algumas características, contradições e impasses da prática pedagógica de um grupo de egressos do curso, professores nessa etapa escolar. Evidencia-se que as condições de formação e de trabalho do professor alfabetizador limitam a ancoragem de sua prática em bases científicas de conhecimento e a mobilização de saberes fundamentais veiculados no curso de graduação limitando-se as possibilidades de organização do ensino e de suas fontes de referência para contribuir à aprendizagem das crianças da classe trabalhadora. Identifica-se um descompasso entre as necessidades de formação nos anos iniciais de escolarização e as possibilidades dos professores que a efetuam, apontando a necessidade de redimensionamento na formação do professor e no curso de pedagogia.
O RELACIONAMENTO INTERPESSOAL E AS TRANSIÇÕES DE PROFESSORES UNIVERSITÁRIOS
Directory of Open Access Journals (Sweden)
Fabiula Meneguete Vides da Silva
2013-08-01
Full Text Available Busca-se, neste trabalho, compreender o significado das relações interpessoais estabelecidas nos processos de transição do contribuidor individual (professor para líder (reitor ou pró-reitor e de líder para contribuidor individual em universidades. A abordagem fenomenológico-hermenêutica foi utilizada a fim de retomar os principais temas desta experiência. Seis ex-gestores universitários emprestaram suas experiências vivenciadas em universidades pertencentes à Associação Catarinense das Fundações Educacionais, através das entrevistas em três tempos, realizadas entre maio de 2009 e março de 2010. Somente fazendo parte da gestão universitária os professores perceberam a complexidade dessa prática. O relacionamento interpessoal foi um fator importante na prática gerencial desses professores, fato este corroborado pela literatura (MINTZBERG, 1990. Recorrendo às entrevistas transcritas, foi possível resgatar três grandes temas centrais: as relações profissionais, o relacionamento com os alunos e as relações familiares. Nas relações profissionais estabelecidas, eles perceberam a necessidade do gerenciamento do trabalho em equipe. O relacionamento frequente com os alunos fez parte do dia a dia do gestor universitário, configurando-se como um dos seus grandes desafios. A família esteve ao lado dos professores, apoiando-os e cobrando deles mais tempo de convívio familiar. Palavras-chave: Relações interpessoais. Professor universitário. Líder. Transição.
Biography of Professor Cornel Tiberiu Opriş. Professional maturity.
Rotaru, Alexandru; Rotaru, Horatiu
2017-01-01
Professor Cornel Tiberiu Opris was the founder and Chair of the Clinic and University Department of Oral and Maxillofacial Surgery in Cluj, after the Education Reform of 1948. The article illustrates how the founder of these institutions led a valiant struggle for obtaining and arranging a location for the newly established Faculty of Dentistry, within the Institute of Medicine and Pharmacy. Professor Cornel Tiberiu Opriş established himself as the most prodigious researcher at the Faculty for over a quarter-century, until his retirement, introducing his original conception in the therapeutic and surgical field. He created in Cluj-Napoca a specialist medical school by imposing national prestige for the institution that he led.
Maximilien Brice
2009-01-01
visit of Members of the ETH Foundation, accompanied by Professor Heidi Wunderli-Allenspach, Rektorin, ETH Zürich and Professor Roman Boutellier, Vizepräsident Personal und Ressourcen, Switzerland, on Tuesday, 24th February 2009.
Use of RateMyProfessors.com Data as a Supplemental Tool for the
Bergin, Adam; Sharp, Kevan; Gatlin, Todd A.; Villalta-Cerdas, Adrian; Gower, Austin; Sandi-Urena, Santiago
2013-01-01
Commercial online instructor evaluations have gained traction in influencing students' decisions on professor and course selections at universities. RateMyProfessors.com (RMP) is the most popular of such evaluation tools and houses a wealth of information from the students' viewpoint. The purpose of this study was to determine whether RMP data…
Inter-relação entre professores da sala de atendimento educacional especializado e do ensino regular
Directory of Open Access Journals (Sweden)
Valéria de Oliveira
2017-11-01
Full Text Available O presente estudo teve por objetivo principal: mapear e analisar o nível e a forma de articulação entre os professores e as atividades desenvolvidas em Salas de Recursos Multifuncionais (SRMs e salas comuns, em uma proposta inclusiva. Com o intuito de contribuir para o processo da educação inclusiva no ambiente escolar, estabeleceu-se aqui a abordagem quanti-qualitativa do tipo transversal. Utilizou-se um questionário para os professores de sala comum e professores de SRM. Participaram deste estudo dezesseis professores de sala comum que tinham alunos com deficiência e nove de SRM da rede pública de ensino de dois municípios da Região Metropolitana de Campinas. Para a análise de conteúdo dos questionários, tomou-se como referência a obra de Bardin, que aponta três fases fundamentais no processo: pré-análise, exploração do material e tratamento dos resultados. Por meio deste estudo, foi possível concluir que: (a os professores estão cientes da importância da SRM e das atribuições dos professores que atuam nesse espaço - todavia, não parece estar claro o trabalho do professor da sala comum -, (b há uma inter-relação entre professores de sala comum e SEM - todavia falta maior tempo destinado às trocas necessárias -, e (c em alguns casos, há falta de entendimento do professor de sala comum sobre a sua função quanto ao aluno Público-Alvo da Educação Especial (PAEE.
[Homage to Professor Dr. Nicasio Etchepareborda].
1998-11-01
During a solemn academic act, de Main Classroom of the Facultad de Odontologia de Buenos Aires was named after Prof. Dr. Nicasio Etchepareborda. He has been the first professor at the Escuela de Odontologia and its organizer, after having obtained his Dentistry degree at the Dental School of Paris, in 1882. The new school was founded in 1891, and its activities began the following year.
31 July 2014 - Professor M. Kastner
Egli, Laurent
2014-01-01
MIT Faculty Member Donner Professor of Physics Massachusetts Institute of Technology United States of America, Prof. M. Kastner visiting the LHC tunnel at Point 5 with Beams Department M. Solfaroli Camillocci, LHC superconducting magnet assembly hall visit with L. Rossi and R. Principe, LHC Computing Grid Project presentation and computer centre visit with I. Bird and signing the guest book with CERN Director-General R. Heuer.
Leisure and the Retired Professor: Occupation Matters
Dorfman, Lorraine; Kolarik, Douglas
2005-01-01
Little attention has been given to the leisure activities of retired professors, whose activity patterns in retirement may be different from those of other occupational groups because of their lifetime commitment to work. This interview study uses both quantitative and qualitative data to investigate: (a) the leisure and professional activities of…
[Professor V.V. Shmeleva--an army doctor, scientist, and teacher].
Emel'yanova, N A
2015-01-01
This article is dedicated to the life and work (research, medical, educational) of V.V. Shmeleva, professor and Great Patriotic War participant. She was the head of ophthalmology department at the City Clinical Hospital No 67 and promoted the implementation of cataract cryoextraction into clinical practice. As a professor at the Order of Lenin Central Institute of Advanced Medical Training she was engaged in postgraduate training of ophthalmologists. V.V. Shmeleva is the author of Cataract monograph and many scientific articles. She was also the senior secretary of the Vestnik oftal'mologii journal for more than 25 years.
Sorg, Heiko; Knobloch, Karsten
2012-01-01
First quantitative evaluation of the requirements for the promotion as associate professor (AP) at German medical faculties. Analysis of the AP-regulations of German medical faculties according to a validated scoring system, which has been adapted to this study. The overall scoring for the AP-requirements at 35 German medical faculties was 13.5±0.6 of 20 possible scoring points (95% confidence interval 12.2-14.7). More than 88% of the AP-regulations demand sufficient performance in teaching and research with adequate scientific publication. Furthermore, 83% of the faculties expect an expert review of the candidate's performance. Conference presentations required as an assistant professor as well as the reduction of the minimum time as an assistant professor do only play minor roles. The requirements for assistant professors to get nominated as an associate professor at German medical faculties are high with an only small range. In detail, however, it can be seen that there still exists large heterogeneity, which hinders equal opportunities and career possibilities. These data might be used for the ongoing objective discussion.
[Professor GAO Yuchun's experience of acupuncture for headache].
Cui, Linhua; Xing, Xiao; Xue, Weihua; Wang, Yanjun; Xu, Cejun; Xuc, Jun; Gao, Yuchun; Kang, Suobin
2015-12-01
As one of the important founders of GAO's acupuncture academic school in YanZhao area, Professor GAO Yuchun 's experience of acupuncture for headache is summarized in this paper. In the opinion of Professor GAO, the treatment of headache should focus on eliminating evil and relieving pain, and the syndrome differentiation should be based on meridian differentiation, especially on three yang meridians of foot as well as liver meridian and kidney meridian. In the acupoint prescription, attention should be placed on strengthening the spleen and stomach. The midnight-midday ebb flow acupuncture is advocated. The combination between acupuncture order and movement of qi is emphasized. In the manipulation, the role of pressing hand, the stimulation during reinforcing and reducing methods, and needle-retention time are important. The breathing reinforcing and reducing method of acupuncture are also advocated.
The University Professor View from the Communitarian Perspective
Directory of Open Access Journals (Sweden)
Angela Del Valle López
2014-04-01
Full Text Available The task of the university professor is a mission and not simply a profession and that is why higher education should be impregnated with values. Nowadays education is articulated into three areas: the State, the Market and the Volunteering, but no one of these three sectors by themselves has covered the needs of all the citizens, there have always been losers, therefore the conjunction of the three sectors became necessary. Communitarianism promotes an ethical-social pact that favors the progress of society without nullifying the individual dimension. It believes that the university is the space where a communitarian consciousness should be promoted to generate a social capital by means of education and it is a privilege place to substantiate the moral identity of the person beginning with the commitment of the professor with the university student.
Barreiras à criatividade pessoal entre professores de distintos níveis de ensino
Directory of Open Access Journals (Sweden)
Alencar Eunice M.L. Soriano de
2003-01-01
Full Text Available Este estudo investigou distintas modalidades de barreiras à expressão da criatividade pessoal em uma amostra de 544 professores, que atuavam desde o ensino fundamental até o ensino superior. O Inventário de Barreiras à Criatividade Pessoal, construído e validado pela primeira autora, foi utilizado para coleta de dados. Este instrumento inclui itens relativos a quatro modalidades de barreiras: Inibição/Timidez, Falta de Tempo/Oportunidade, Repressão Social e Falta de Motivação. Diferenças significativas foram observadas entre professores do sexo masculino e feminino em Repressão Social, e, entre professores de diferentes níveis de ensino, nas barreiras denominadas Inibição/Timidez e Repressão Social. Os resultados apontam distintas barreiras que se referem direta ou indiretamente aos motivos, meios e oportunidades para a expressão da criatividade pessoal, sinalizando a necessidade de estratégias que ampliem as possibilidades de expressão criativa em professores.
Criatividade no trabalho docente segundo professores de história: limites e possibilidades
Directory of Open Access Journals (Sweden)
Maria de Fátima Magalhães Mariani
Full Text Available Foi objetivo do presente estudo investigar componentes da organização do trabalho pedagógico e elementos de caráter pessoal/individual que agem como inibidores e facilitadores da expressão da criatividade do professor de História. Participaram do estudo 16 professores de História de 5ª a 8ª séries do Ensino Fundamental de cinco escolas públicas e cinco escolas particulares de Brasília, Distrito Federal. Utilizou-se a entrevista semiestruturada na coleta dos dados. Realizou-se análise de conteúdo, elaborando-se categorias que abrangeram o conteúdo das respostas obtidas. Vários aspectos foram identificados como estímulos e limites à criatividade no trabalho docente. Liberdade e a paixão pelo trabalho foram os facilitadores mais enfatizados. Problemas no relacionamento professor-aluno foi um dos limites mais destacado. Este estudo contribui para desvelar aspectos que impedem a expressão criativa do professor e outros relativos a um ambiente pedagógico favorável à criatividade docente.
IDENTIFICANDO OS MODELOS DIDÁTICOS DE UM GRUPO DE PROFESSORES DE QUÍMICA
Directory of Open Access Journals (Sweden)
João Batista Santos Junior
Full Text Available Esta investigação visa a identificar os modelos didáticos de um grupo de professores de Química de escolas públicas e propõe uma meto dologia para a sua utilização como instrumento de reflexão do docente em relação às suas concepções acerca do processo de ensino e aprendiza gem. Para tal, foi solicitado aos professores que respondessem a um ques tionário baseado nas ideias de Garcia Pérez (2000. Os resultados obtidos apontam que os professores combinam características diferentes dos modelos didáticos para formar um modelo didático eclético (GUIMARÃES, ECHEVERRÍA & MORAES, 2006. Esses modelos ecléticos encerram características antagônicas e podem indicar a necessi dade de aprofundamento da reflexão dos docentes sobre as suas concep ções. É proposta uma metodologia para a utilização do instrumento de investigação do pensamento do professor.
Professor Brand Advocacy: Do Brand Relationships Matter?
Jillapalli, Ravi K.; Wilcox, James B.
2010-01-01
The trend among students to advocate their professors online continues to generate interest within marketing academia. Brand advocacy in products and services has played a vital role in marketing. However, no known research to date has embraced the idea of brand advocacy in marketing education. This research builds on the recent human brand…
Directory of Open Access Journals (Sweden)
Michele Xavier dos Reis
2010-04-01
Full Text Available Apesar de existirem políticas que garantem aos alunos com necessidades educacionais especiais o acesso ao ensino regular, inúmeras barreiras são encontradas para que esse processo se efetive, sendo uma delas a formação do professor. A presente pesquisa teve como objetivo analisar a formação de professores universitários formados em Ciências Biológicas/licenciatura para o atendimento de pessoas com deficiência visual no sistema universitário. Buscando entender a formação docente como fenômeno singular e diverso, a metodologia adotada foi qualitativa, sendo selecionados cinco professores que atuavam no curso de Ciências Biológicas/licenciatura de uma universidade pública localizada no sul de Minas Gerais. Foram realizadas entrevistas semiestruturadas com os sujeitos de pesquisa, buscando averiguar a formação e a experiência docente dos sujeitos com alunos com deficiência visual. Os resultados evidenciaram que ainda são grandes as dificuldades encontradas no processo de inclusão, tanto devido a lacunas na formação docente quanto devido à postura adotada pelo professor em sala de aula.In spite of the existence of countless policies assuring impaired students access to the regular educational process, barriers are found preventing the consolidation of the mentioned process. The professor educational background is pointed out as an expressive cause to the failure of the student in the educational process. So far, the objective of the present research was to analyze the professor educational background concerning visually impaired people within the university system. The present theme is relevant considering that few studies have been dedicated to the inclusion process at advanced education. In order to understand the teaching process as a unique and diverse phenomenon, the methodology applied was qualitative and five professors, teaching Biological Sciences - graduated from a public university in the southern of Minas Gerais
Sensibilizar professores para o desenvolvimento de carreira dos alunos: relato de uma experiência
Directory of Open Access Journals (Sweden)
Íris M. Oliveira
Full Text Available A literatura destaca a importância de realizar sessões de sensibilização dos professores para promover a sua influência positiva e intencional, enquanto docentes, nas trajetórias de carreira dos alunos. Este artigo relata uma experiência de realização de uma sessão de sensibilização junto a professores da educação básica de um agrupamento de escolas no noroeste de Portugal. Procurou-se esclarecer o conceito de desenvolvimento de carreira junto dos professores, conscientizá-los para o papel da escola no desenvolvimento de carreira dos alunos e estimular a dinamização de atividades promotoras desse processo. Apresenta-se a estrutura da sessão, as estratégias adotadas para alcançar os objetivos propostos e as reflexões partilhadas e debatidas pelos professores. As apreciações dos intervenientes quanto à sessão de sensibilização mostraram-se favoráveis. Esta experiência ilustra a importância de realizar sessões de sensibilização dos professores nesse domínio, as quais podem sustentar a promoção do desenvolvimento de carreira dos alunos, ao longo da escolaridade.
Moskwa, Bozena; Siński, Edward; Kazubski, Stanisław L
2005-01-01
The conference was organized for celebrating the memory of professor Konstanty Janicki, one of the most important Polish zoologist, protistologist and parasitologist. Professors Joanna Pijanowska, Edward Siński and Maria Doligalska were the hosts of the meeting at the Warsaw University. Four lectures were given during the conference. Professor Leszek Kuźnicki presented professor Janicki's life and followers who continued his research. Professor Stanisław Kazubski reminded the main topics of the parasitological studies conducted by professor Janicki. That lecture was illustrated by coloured diagrams taken from original papers published by Janicki. In the next lecture, professor Teresa Pojmańska reminded "the theory of the cercomer". She viewed some polemics and discussions made by the opponents of the theory. Professor Alicja Guttowa presented a paper on the history of the exploration of the D. latum life cycle and the main scientific researches carried out on each life stages of the broad tapeworm. Afterwards the lectures, professor Kazubski showed several pictures taken inside and outside of the Main School of the Warsaw University at the time when professor Janicki had been working there. The professor's students were also seen in these pictures. Next, associate professor Bozena Moskwa, the President of the Polish Parasitological Society presented the Konstanty Janicki Medal, awarded for outstanding activities for the benefit of parasitology. Up to data, 17 scientists and one school: the Warsaw Uniwersity was honored with this Medal. After the conference, participants visited the Powazki Cementary, where the renovated sepulchral monument of professor Konstanty Janicki was uncovered.
Wade, Carol; Sonnert, Gerhard; Sadler, Philip M.; Hazari, Zahra; Watson, Charity
2016-01-01
This article compares the views of teachers and professors about the transition from secondary mathematics to tertiary calculus. Quantitative analysis revealed five categories where teachers and professors differed significantly in the relative frequency of addressing them. Using the rite of passage theory, the separation and incorporation phases…
Promotion beyond Tenure: Unpacking Racism and Sexism in the Experiences of Black Womyn Professors
Croom, Natasha N.
2017-01-01
This study examined seven Black womyn full professors' experiences of promotion beyond tenure. Using a critical race feminist theoretical framework, findings suggest that a meritocratic ideology undergirds a dominant narrative about the Professor rank. However, racism and sexism mediated the participants' opportunities to access the status and…
[Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].
Liu, Jian; Fan, Xiao-Nong; Wang, Shu
2014-01-01
Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.
String theorist takes over as Lucasian Professor
Banks, Michael
2009-11-01
String theorist Michael Green will be the next Lucasian Professor of Mathematics at Cambridge University. Green, 63, will succeed Stephen Hawking, who held the chair from 1980 before retiring last month at the age of 67 and taking up a distinguished research chair at the Perimeter Institute for Theoretical Physics in Canada (see above).
Russel Nye: The Professor in Public Life.
Hungiville, Maurice
1995-01-01
A discussion of the influence of Russel Nye, a college English professor at Michigan State University and journalist, focuses on the values that shaped his teaching, scholarship, and writing and his defense of democratic values, especially in education. It is concluded that Nye's experience suggests that public service can be a source of personal…
Homage to Professor Hans-Åke Gustafsson
2010-01-01
It was with deep sadness that we learned of the death of Professor Hans-Åke Gustafsson, an internationally recognized scientist, beloved colleague and friend. He passed away on Wednesday January 13th at the Lund University Hospital, surrounded by his loved ones, after a short battle against cancer. This is a great loss for all of us in ALICE and the whole heavy ion community. Hans-Åke, Professor at Lund University, was one of the pioneers of heavy ion physics with relativistic beams since its very beginning. He started his research at CERN, as a fellow at the ISOLDE ion beam facility, and immediately after, in the early 1980 joined the Plastic Ball collaboration at the Bevalac. One of the seminal papers of the field on the discovery of collective flow in relativistic nuclear collisions, co-authored by Hans-Åke, Hans Gutbrod and colleagues, stems from this period. From that point on he was always at the forefront of research with relativistic nuclear beams, being for three de...
Representações sociais de professores sobre o autismo infantil
Directory of Open Access Journals (Sweden)
Michele Araújo Santos
2012-08-01
Full Text Available Este trabalho teve o objetivo de investigar, a partir da teoria das representações sociais, as ideias de senso comum que circulam entre professores acerca do autismo infantil. Buscamos compreender a lógica interna de tais teorias populares, mapear os saberes que as apoiam e as imagens que as concretizam. Os 16 participantes do estudo compuseram dois grupos: 9 professoras experientes na educação de crianças autistas e 7 professores sem experiência com tais crianças. Os dados obtidos através de entrevistas semi-estruturadas permitem concluir que paradoxalmente, a aproximação com o objeto não parece conduzir a uma maior familiarização. De maneira geral, há incertezas e fluidez quanto a considerar o autismo uma desordem orgânica ou o resultado de complicações relacionais precoces; em acreditar que essas crianças apresentam inteligência acima da média ou deficiência intelectual. Os professores constroem, assim, autismos diversos, num processo de conhecimento ancorado em variados repertórios, dentre eles, a psicanálise e neurociências.
Riedel, Derek
2012-01-01
The purpose of this qualitative study was to discover how communication professors at four-year private universities help students who exhibit public speaking apprehension (PSA) learn to cope with their anxiety. The research was framed in the narrative inquiry paradigm, interviewing eight college communication professors about their experiences…
As representações como processo de significação do (futuro professor de Língua Portuguesa
Directory of Open Access Journals (Sweden)
Pollyanne Bicalho Ribeiro
2011-07-01
Full Text Available Propomos, neste artigo, uma discussão acerca da reconstituição identitária do professor de LP, visando analisar representações sobre o grupo professor e o trabalho que lhe é atribuído, bem como as consequências dessas representações para o processo de ensino/aprendizagem. A partir dos pressupostos do Interacionismo Sociodiscursivo (ISD, conjugados com a Teoria das Representações Sociais (TRS, discutiremos os efeitos dessas representações para a (reformulação do agir do professor de LP em sala de aula sob a avaliação do estagiário/futuro professor. O corpus é constituído de excertos retirados de relatórios produzidos por estagiários ao observarem aulas de professores da rede privada e pública do município de Fortaleza.Palavras-chave: Representações sociais. Identidade do professor de LP. Prática formativa.
[Experience of professor FANG Jianqiao treating trigeminal neuralgia at different stages].
Sun, Jing; Fang, Jianqiao; Shao, Xiaomei; Chen, Lifang
2016-02-01
Trigerninal neuralgia is a common refractory disease in clinic. Professor FANG Jianqiao has rich experience through diagnosing and treating the disease for many years. In the first diagnosis, professor FANG underlines the position of damaged neuron and syndrome differentiation. He considers acupuncture should be implemented by stages,namely according to whether the patients are in the period of pain attack, different acupuocture prescriptions are made. Acupuncture manipulation and needle-retention time should be adjusted according to the condition of disease. And the appropriate application of electroacupuncture and transcutaneous electrical acupoint stimulation can strengthen the effect.
'Supermentoring' of assistant professors' teaching
DEFF Research Database (Denmark)
Lauridsen, Ole
Aarhus University offers a mandatory pedagogical training program for assistant professors, required in order to obtain tenure at a Danish university. At Business and Social Sciences, this program is supplemented by voluntary observation and (first of all formative) supervision of the assistant...... professors’ teaching practice. This offer is given is (i) because many young university teachers face problems putting pedagogical theory into practice – even though the program mentioned is practice-oriented, and (ii) because many of them (partly due to (i)) lack self-confidence as to teaching...
Entrevista com professor Bertrand Badie
Mere Marques Aveiro, Thais
2015-01-01
Bertrand Badie é cientista político, professor na Sciences Po, Paris, pesquisador do CERI (Centro de Estudos e Pesquisas Internacionais), codiretor da coleção L’etat du monde, publicada anualmente desde 2010 e coeditor da Enciclopédia Internacional de Ciência Política. Entre 2002 e 2005, foi Diretor do Centro de Estudos Internacionais sobre a paz e resoluções de conflitos. Por dez anos (1994 –2003), foi Diretor das publicações da Sciences Po.Desde 2000, ministra o Curso Espaço Mundial que, a ...
CFA or CFP: A Guide for Professors
Moy, Ronald L.
2011-01-01
The CFA Institute and the CFP Board of Standards provide professional certifications in the field of finance. In this paper, I provide my experience with the CFA and CFP programs in order to give other professors some insight into the process of attaining the designations. I hope to provide answers to some of the questions that other faculty…
Ghapanchi, Zargham; Talebi, Farima
2012-01-01
This study aims to examine the metaphors selected by two hundred and forty Iranian B.A and eighty eight M.A students about their professors' roles. The participants were asked to select their preferred metaphors among twenty one metaphors of the checklist about their professors. The metaphors were then categorized based on Goffman's Footing…
The rotor theories by Professor Joukowsky: Vortex theories
DEFF Research Database (Denmark)
Okulov, Valery L.; Sørensen, Jens Nørkær; Wood, David H.
2015-01-01
This is the second of two articles with the main, and largely self-explanatory, title "Rotor theories by Professor Joukowsky". This article considers rotors with finite number of blades and is subtitled "Vortex theories". The first article with subtitle "Momentum theories", assessed the starring...
Identities of Special Needs Education in the Discourse of Finnish Professors of the Field
Vehkakoski, Tanja; Sume, Helena; Puro, Erika
2011-01-01
This article examines both the discourses upon which Finnish special needs education professors draw when speaking about their field, and the consequent identities for it. The research material consists of theme interviews with 10 professors of special needs education and is analysed from a socio-constructionist, discourse analytical perspective.…
Fatores que tornam o professor de Ensino Superior bem-sucedido: analisando um caso
Directory of Open Access Journals (Sweden)
Ana Luiza de Quadros
2014-03-01
Full Text Available Este trabalho faz parte de uma investigação sobre as práticas pedagógicas bem-sucedidas usadas por professores universitários. Com o objetivo de investigar as estratégias usadas por um professor bem avaliado pelos estudantes, registramos, em vídeo, um conjunto de aulas e fizemos a análise das mesmas. Esta análise permitiu um entendimento inicial de como o professor organiza o seu próprio trabalho, como navega entre diferentes tipos de discursos e como dá suporte ao processo de significação. Ao mesmo tempo, a análise revelou como as interações são produzidas no espaço/tempo da sala de aula, e como as diferentes estratégias usadas auxiliam no engajamento dos estudantes. Por meio de entrevista semiestruturada, buscamos, no professor, indícios que nos permitissem entender como este construiu as estratégias usadas nas aulas. Observamos a presença de um processo reflexivo sobre as experiências vividas e identificamos algumas pistas que nos permitiram argumentar sobre a construção dessas estratégias.
Representações sociais de professores do ensino fundamental sobre violência intrafamiliar
Directory of Open Access Journals (Sweden)
Sandra Francesca Conte de Almeida
Full Text Available Este estudo focaliza as representações sociais de professores do ensino fundamental acerca da violência intrafamiliar. A amostra foi de 94 professores de escolas públicas e privadas (Distrito Federal e Goiás, graduandos em Pedagogia. Na coleta de dados, aplicou-se um questionário visando apreender as representações sobre violência intrafamiliar, nas dimensões informação, campo das representações sociais e atitudes dos sujeitos diante de casos comprovados ou suspeitos de alunos vitimados pela violência intrafamiliar. Os resultados apontam contradições e ambivalências entre os sentimentos e as atitudes dos professores em relação ao fenômeno. Indicam, ainda, que a representação social da violência intrafamiliar, para grande parte dos sujeitos, ainda passa pela consideração do poder da autoridade paterna/familiar, que dá direito aos pais de educar seus filhos como melhor lhes convier, indicando a necessidade da capacitação de professores, no âmbito da formação inicial e continuada, para lidar adequadamente com a problemática da violência intrafamiliar, no cotidiano escolar.
Estilos de liderança de professores: aplicando o modelo de estilos parentais
Directory of Open Access Journals (Sweden)
Ana Priscila Batista
Full Text Available Professores orientam os comportamentos das crianças estabelecendo diferentes climas emocionais no uso das estratégias educativas em sala de aula. Esse trabalho busca delinear uma análise dos estilos de liderança de professores aplicando o modelo de estilos parentais. Inicialmente, foi feita uma análise de literatura realizando uma busca nas bases de dados: Scielo, Science Direct e Scopus, utilizando os descritores: teachers' leadership styles, teachers' teaching styles e school leadership. Com essa busca constatou-se que existem diversas definições, formas de análise e variáveis estudadas, conforme a teoria adotada. Posteriormente, foi realizada a análise da relação professor-aluno aplicando o modelo de estilos parentais, que apresenta uma análise do sistema das relações a partir de duas dimensões: responsividade e exigência. Assim, foram categorizados quatro estilos de liderança: autoritário, permissivo, negligente e participativo. Conclui-se que o modelo de estilo parental fornece uma boa base teórica para pautar a análise dos estilos de liderança de professores.
REPRESENTAÇÃO SOCIAL DO PROFESSOR SOBRE AS DIFICULDADE DE APRENDIZAGEM DO ALUNO
Directory of Open Access Journals (Sweden)
Joana Jesus Silva
2016-11-01
Full Text Available O presente trabalho analisa os processos e conteúdos representacionais dos professores de 9 instituições de ensino públicas rurais de um município do Vale do Paraíba Paulista com relação às dificuldades de aprendizagem do aluno. Para este fim, foram realizadas 15 entrevistas com professores do ensino fundamental. Uma análise de conteúdo informatizada de tais entrevistas com o software ALCESTE® revelou 7 classes de discursos, uma delas especificamente ligada ao tema “dificuldade de aprendizagem”. A representação social da dificuldade de aprendizagem para esse grupo de professores revela que os sujeitos atribuem ao próprio aluno e ao seu contexto sócio-econômico-cultural a responsabilidade pelo insucesso, conferindo aos fatores externos a principal causa destas dificuldades. Os professores culpabilizam especialmente as condições de vida do educando e a ausência da família na vida escolar do estudante. Foi possível ainda identificar os processos de objetivação e ancoragem que estão na gênese da representação social da dificuldade de aprendizagem do aluno.
In memory of Professor Jan Mazurkiewicz in the 70th anniversary of his death
Directory of Open Access Journals (Sweden)
Perzyńska-Starkiewicz Aneta
2017-12-01
Full Text Available This article reminisces about the life and career of Jan Mazurkiewicz, one of the most outstanding Polish psychiatrists – the author of Psychophysiological Theory, an original conception of mental disease based on the theory of evolution and dissolution of the nervous system developed by the Englishneurologist John Hughlings Jackson. Professor Jan Mazurkiewicz was an active organizer of psychiatric care. He was co-founder and director of hospitals in Kochanówka and Kobierzyn. He held the rank of Associate Professor at the John Casimir University in Lviv and the position of Professor at the Jagiellonian University in Cracow. From 1919 until his death in 1947, Professor Jan Mazurkiewicz was the head of the Department of Psychiatry at the University of Warsaw. For twenty three years, starting from 1924, he was the president of the Polish Psychiatric Association. The Mazurkiewicz's Psychopathological Theory provides a natural model of development of the highest psychic functions. Damage to a higher evolutionary level of the nervous system leads to the activation of the previously suppressed lower levels, transformed by the pathogen into psychopathological symptoms. Mazurkiewicz's scientific thought was adopted and developed by his student andthen, collaborator, Professor Mieczysław Kaczyński, who was later to become the head of the Department of Psychiatry in Lublin. This work discusses the research conducted at Lublin's Department of Psychiatry which expands on Mazurkiewicz's theory
PSYCHOLOGICAL WELL-BEING AND PSYCHOLOGICAL DISTRESS FOR PROFESSORS IN BRAZIL AND CANADA
BOAS,ANA ALICE VILAS; MORIN,ESTELLE M.
2014-01-01
Mental health, an important object of research in psychology as well as social psychology, can be determined by the relationship between psychological well-being and psychological distress. In this context, we search to understand: “How do compare mental health of professors working in public universities in an emerging country like Brazil with the one of professors working in a developed country like Canada?” and “What are the main differences in the indicators of mental he...
[Professor Andelko Wolf, MD, PhD. (1922-2007), eminent epidemiologist and dermatovenerologist].
Gruber, Franjo; Peris, Zdravko
2009-01-01
Professor Andelko Wolf graduated medicine from the University of Zagreb School of Medicine in 1947. First he specialised in epidemiology and became head of the Brucellosis Centre in Rijeka for the Istria region. Later he also specialised in dermatovenerology at the Department for Skin and Venereal diseases in Rijeka. He passed the specialty board exam in dermatovenerology in 1958 and became teaching assistant. In 1973, he became assistant professor and in 1981 full professor. At the Department he founded the Laboratory for Mycology and allergology. Later he focused on occupational skin diseases and photodermatology. His doctoral thesis was on the action of light on the skin. He chaired the Clinic and was a member of various Hospital and Medical School committees. He was an excellent clinician undergraduate and graduate student teacher in Rijeka and Zagreb. He published around eighty papers on dermatology, but also on the necessity to reform medical studies.
Three Decades Investigating Humor and Laughter: An Interview With Professor Rod Martin.
Martin, Rod; Kuiper, Nicholas A
2016-08-01
Since the start of the 21st century, the investigation of various psychological aspects of humor and laughter has become an increasingly prominent topic of research. This growth can be attributed, in no small part, to the pioneering and creative work on humor and laughter conducted by Professor Rod Martin. Dr. Martin's research interests in humor and laughter began in the early 1980s and continued throughout his 32 year long career as a professor of clinical psychology at the University of Western Ontario. During this time, Dr. Martin published numerous scholarly articles, chapters, and books on psychological aspects of humor and laughter. Professor Martin has just retired in July 2016, and in the present interview he recounts a number of research highlights of his illustrious career. Dr. Martin's earliest influential work, conducted while he was still in graduate school, stemmed from an individual difference perspective that focused on the beneficial effects of sense of humor on psychological well-being. This research focus remained evident in many of Professor Martin's subsequent investigations, but became increasingly refined as he developed several measures of different components of sense of humor, including both adaptive and maladaptive humor styles. In this interview, Dr. Martin describes the conceptualization, development and use of the Humor Styles Questionnaire, along with suggestions for future research and development. In doing so, he also discusses the three main components of humor (i.e., cognitive, emotional and interpersonal), as well as the distinctions and similarities between humor and laughter. Further highlights of this interview include Professor Martin's comments on such diverse issues as the genetic versus environmental loadings for sense of humor, the multifaceted nature of the construct of humor, and the possible limitations of teaching individuals to use humor in a beneficial manner to cope with stress and enhance their social and
Jorgensen, Mary; Havel, Alice; Fichten, Catherine; King, Laura; Marcil, Evelyne; Lussier, Alex; Budd, Jillian; Vitouchanskaia, Cristina
2018-01-01
Our goal was to explore the technology related pedagogical practices of college professors deemed by their students to be excellent in using technology in their teaching. We explored the views of 114 community/junior college professors who were nominated by their students as excellent in using technology in their teaching using both questionnaires…
Formador de leitores, formador de professores: a trajetória de Max Butlen
Directory of Open Access Journals (Sweden)
Belmira Oliveira Bueno
2015-06-01
Full Text Available Nesta entrevista, Max Butlen, amplamente conhecido por seu trabalho no campo da leitura, da formação de leitores e de professores, traça um percurso de sua trajetória e desenvolve uma discussão rica a partir das contribuições teóricas assentadas em uma longa vivência na escola pública, que o tornaram referência em dois temas dentre os mais desafiadores para a escola nos dias de hoje: o ensino da cultura da escrita e a profissionalização dos professores. Na França, foi sucessivamente professor em diferentes instituições de formação de professores, junto ao Ministério da Educação e o da Cultura, onde, em funções e cargos múltiplos, fez sobressair seu trabalho em prol da atualização das práticas escolares de leitura e da configuração e uso das bibliotecas públicas e escolares. Sua tese de doutorado em ciências da educação, Les politiques de lecture et leurs acteurs, 1980-2000, defendida na Universidade de Paris 5, reúne esses dois campos de saberes universitários e da ação profissional e mostra a centralidade que as questões da leitura assumem na França nos finais do século XX. No Brasil, ele trabalhou junto ao Ministério da Educação, de 1994 a 1998, ampliando, desde então, sua colaboração com grupos de pesquisadores de vários estados, para tratar seja das temáticas da leitura seja daquelas referidas à universitarização dos professores. Desenvolve também, a partir de suas experiências em ambos os países, comparações profícuas no que se refere a procedimentos de formação de professores e ao comportamento intelectual dos jovens diante das novas tecnologias e das mudanças sociais.
Directory of Open Access Journals (Sweden)
Ari Widyanti
2016-06-01
Full Text Available Pemanfaatan teknologi informasi dan komunikasi (TIK di usaha kecil dan menengah (UKM di Indonesia masih pada tingkat yang belum sesuai harapan. Mempertimbangkan bahwa UKM di Indonesia banyak menyerap tenaga kerja dan menyumbang pendapatan nasional yang cukup besar, serta melihat bahwa pemanfaatan TIK di banyak industri besar telah membawa peningkatan performansi yang cukup signifikan, peningkatan pemanfaatan TIK di UKM merupakan hal yang penting untuk dilakukan. Penelitian ini dilakukan dengan tujuan untuk memetakan tingkat pemanfaatan TIK di UKM dan mengaplikasikan intervensi kognitif dan pendekatan rantai nilai dalam meningkatkan pemanfaatan TIK di UKM. Pemetaan pemanfaatan TIK dilakukan melalui survey dengan menggunakan kuesioner terstruktur dan wawancara yang melibatkan 61 UKM di berbagai bidang di Bandung. Hasil pemetaan pemanfaatan TIK di UKM menunjukkan bahwa pemanfaatan TIK di UKM sebatas pada tujuan pemasaran produk dan sebatas pada penggunaan website. Kendala utama pemanfaatan TIK di UKM adalah faktor SDM terutama berkaitan dengan keterbatasan pengetahuan dan informasi. Berdasarkan hasil pemetaan, selanjutnya, intervensi dilakukan melalui edukasi/kampanye dengan materi mengenai rantai nilai pada 30 UKM yang bergerak di bidang fashion. Hasil intervensi menunjukkan bahwa level pengetahuan dan intensi/kemauan untuk menerapkan TIK di UKM selain untuk kepentingan pemasaran (misalnya untuk perancangan produk dan hubungan dengan pemasok semakin meningkat. Implikasi dari hasil penelitian ini dibahas lebih lanjut. Abstract The use of information and communication technology (ICT in small and medium enterprise (SME in Indonesia is at low level. Considering that SME in Indonesia employ a lot of people and contribute to Gross Domestic Product (GDP as well as improve performance of industries, coupled with low level of ICT use in Indonesian SME, ICT’ used in SME must be increased. Therefore, this study aims to map the use of ICT in
Maximilien Brice
2004-01-01
Summer students and professor from the United Arab Emirates - from left to right : Alya Ali Binghurair, Shaikha Al Kalbani, Professor Chafia Hejase de Trad, Mariam Al Hassani, Aminah Al Abdouli.
Síndrome de Burnout: estudo comparativo entre professores do ensino especial e do ensino regular
Directory of Open Access Journals (Sweden)
Ana Claudia Braun
Full Text Available O objetivo deste estudo foi verificar se existem diferenças nos índices das dimensões de SB, Perfil 1 e 2 entre professores de ensino especial e regular. A amostra constituiu-se de 160 professores, 80 de ensino especial e 80 de ensino regular. Os instrumentos utilizados foram um questionário elaborado para levantamento de dados demográficos e laborais e o Cuestionario para la Evaluacióndel Síndrome de Quemarse por elTrabajo - CESQT. Os resultados encontrados, por meio do teste t de student, evidenciaram que professores de ensino especial possuem média mais elevada na dimensão de Ilusão pelo Trabalho e professores de ensino regular, maiores índices médios de Perfil 1 e Perfil 2 de Burnout. Resultados apontam a necessidade de intervenções diferenciadas que considerem as peculiaridades funcionais dos grupos investigados.
[Professor SONG Nanchang's experience for treatment of peripheral facial paralysis].
He, Yong; Pan, Hao; Xu, Hanbin
2015-06-01
Professor SONG Nanchang's clinical experience and characteristics for treatment of peripheral facial paralysis are introduced. In clinical treatment, professor SONG has adopted staging treatment strategy, and performed acupuncture stimulation with different levels. He attaches great importance to the acupoint selection on distal limbs. For the treatment on the face, he takes temperature as necessity; he inherits from famous Chinese doctor ZONG Ruilin's acupuncture technique of slow-twisting and gentle-pressing. Meanwhile, he excels in combination, of different therapies, using acupuncture, moxibustion, electroacupuncture, auricular point sticking, Chinese herbal medicine, etc. according to individual condition and disease stages. He also emphasizes on psychological counseling and daily life care to achieve rehabilitation within the shortest time.
PSYCHOLOGICAL WELL-BEING AND PSYCHOLOGICAL DISTRESS FOR PROFESSORS IN BRAZIL AND CANADA
BOAS, ANA ALICE VILAS; MORIN, ESTELLE M.
2014-01-01
Mental health, an important object of research in psychology as well as social psychology, can be determined by the relationship between psychological well-being and psychological distress. In this context, we search to understand: “How do compare mental health of professors working in public universities in an emerging country like Brazil with the one of professors working in a developed country like Canada?” and “What are the main differences in the indicators of mental health in work domai...
Directory of Open Access Journals (Sweden)
Ana Hirsch Adler
2010-08-01
Full Text Available The purpose of the article is to present the results obtained with a sample of 704 professors of the forty graduate programs in UNAM, with the open question: Do you consider that a subject about professional ethics should be included for all students?, with which contents? This question is part of an instrument applied in 2006 and 2007. The majority expressed that it should exist a special subject about professional ethics. All the answers were codified in four categories. We introduced two other sources of information: the answers to the same question asked in 2004 to 11 professors from different universities in Spain, and three training proposals given by the professors interviewed.
Análise de um processo de reforma curricular vivenciado por professores formadores de nutricionistas
Directory of Open Access Journals (Sweden)
Ester de Queirós Costa
2012-01-01
Full Text Available Apresenta-se a análise de um processo de reforma curricular vivenciado por professores formadores de nutricionistas, iniciado em 2007. Objetiva-se contribuir para a discussão desse tema, ainda pouco explorado na literatura sobre formação de nutricionistas. Utilizou-se questionário, enviado, em 2009, por meio eletrônico. As questões seguiram orientação do Projeto Pedagógico do Curso. Participaram 23 professores responsáveis por 21 das 37 disciplinas do período avaliado. Revelou-se dificuldade docente para implantar metodologias ativas de ensino-aprendizagem e avaliar competências e habilidades; necessidade de reuniões periódicas dos gestores com professores para os ajustes necessários; professores empenhados em integrar conteúdos de diferentes disciplinas, teoria e prática na apresentação dos conteúdos e atividades de ensino com atividades de pesquisa. Debateram-se os resultados em reunião entre professores e estudantes da instituição pesquisada. O instrumento utilizado para a pesquisa se mostrou eficiente em apontar alguns dos obstáculos à reforma em curso e possíveis caminhos para transpô-los.
Ten Things Every Professor Should Know about Assessment
Wolf, Kenneth; Dunlap, Joanna; Stevens, Ellen
2012-01-01
This article describes ten key assessment practices for advancing student learning that all professors should be familiar with and strategically incorporate in their classrooms and programs. Each practice or concept is explained with examples and guidance for putting it into practice. The ten are: learning outcomes, performance assessments,…
University Professors and Teaching Ethics: Conceptualizations and Expectations
Dean, Kathy Lund; Beggs, Jeri Mullins
2006-01-01
After the spectacular ethical breaches in corporate America emerged, business school professors were singled out as having been negligent in teaching ethical standards. This exploratory study asked business school faculty about teaching ethics, including conceptualizations of ethics in a teaching context and opinions of the extent to which…
Directory of Open Access Journals (Sweden)
Glenda Cristina Valim de Melo
2012-01-01
Full Text Available Este artigo apresenta as representações sobre o tipo de trabalho que docentes universitários de Língua Inglesa consideram realizar com as Tecnologias de Informação e Comunicação (TIC em sala de aula. Os aportes teórico-metodológicos estão embasados no Interacionismo Sociodiscursivo de Bronckart (2007; 2008, nas concepções de trabalho desenvolvidas pela Clínica da Atividade e Ergonomia e nas características de trabalho de Machado (2010. Participaram do estudo seis docentes universitários de Língua Inglesa que utilizam as TIC no trabalho. Os dados foram gerados via internet, via e-mails e Moodle. Cada participante produziu um texto em que relatou os usos que faria dessas ferramentas. Os resultados indicam que os docentes fazem usos semelhantes das ferramentas e que há impedimentos no uso das TIC para os docentes da universidade pública.This article presents representations about the kind of work that university professors hope to achieve when using Information & Communications Technology (ICT in the classroom. The theoretical background is based on Socio-discursive Interactionism, theories about work as developed in Clinical Activity and Ergonomics and in the characteristics of work proposed by Machado (2010. Six English language professors that use ICT at work participated in the research project. Data were collected via internet, through e-mail or Moodle. Each participant provided a text on their experiences and the use of ICT. The results indicate that university professors use the ICT in the same way, butsome restrictions to this matter are appointed by public university professors.
Häbi, professor, teil on Gefilus kapis / Eve Kruuse
Kruuse, Eve,d1959-
2008-01-01
Tartu Ülikooli professor Marika Mikelsaar võitis läinud kuul koos kolleegidega (Tiiu Kullisaar, Epp Songisepp, Hedi Annuk ja Mihkel Zilmer) Soulis ülemaailmse naisleiutajate konkursil ME-3 bakteri avastamise ja probiootikuks arendamise eest kuldmedali
CRENÇAS DE ALUNOS-PROFESSORES DE LÍNGUA INGLESA: UM OLHAR PARA A EDUCAÇÃO DOCENTE INICIAL
Directory of Open Access Journals (Sweden)
Josimayre Novelli
2017-12-01
Full Text Available Este estudo analisou crenças de alunos-professores de língua inglesa de uma universidade pública no que diz respeito o processo de ensinar e aprender inglês no contexto de escola pública, bem como as implicações dessas crenças nas ações desses futuros professores. O referencial teórico apoiou-se em estudos sobre crenças e aprendizagem de línguas (BARCELOS, 2001, 2004. Esperamos que esse artigo contribua com estudos voltados às crenças de alunos-professores de inglês, bem como com uma educação docente inicial mais crítica e reflexiva, na qual alunos-professores sejam capazes de refletir sobre suas crenças, práticas pedagógicas e seu papel enquanto futuros professores de línguas.
Directory of Open Access Journals (Sweden)
Jacqueline Oliveira Moreira
2014-10-01
Full Text Available Neste artigo destacamos o tema da velhice bem-sucedida dentro da pesquisa “Aposentadoria e Velhice bem-sucedida: estudo de caso com professores universitários da Pontifícia Universidade Católica de Minas Gerais”. Interessa-nos saber como os professores universitários com mais de 60 anos pensam uma velhice saudável. Esta pesquisa é um estudo de caso que visou a desvelar os imaginários de 40 professores universitários com mais de 60 anos, sobre velhice, trabalho e aposentadoria, através da aplicação de questionário e análise estatística usando o SPSS. Concluímos que os professores consideram a Capacidade Psíquica para lidar com as novas situações o elemento mais importante na construção de uma velhice bem-sucedida, seguido do engajamento em atividades diversas.
[Learning experience of acupuncture technique from professor ZHANG Jin].
Xue, Hongsheng; Zhang, Jin
2017-08-12
As a famous acupuncturist in the world, professor ZHANG Jin believes the key of acupuncture technique is the use of force, and the understanding of the "concentrating the force into needle body" is essential to understand the essence of acupuncture technique. With deep study of Huangdi Neijing ( The Inner Canon of Huangdi ) and Zhenjiu Dacheng ( Compendium of Acupuncture and Moxibustion ), the author further learned professor ZHANG Jin 's theory and operation specification of "concentrating force into needle body, so the force arriving before and together with needle". The whole-body force should be subtly focused on the tip of needle, and gentle force at tip of needle could get significant reinforcing and reducing effect. In addition, proper timing at tip of needle could start reinforcing and reducing effect, lead qi to disease location, and achieve superior clinical efficacy.
Professor håber på åbenhed om CRISPR/Cas9
DEFF Research Database (Denmark)
Hokland, Peter
2016-01-01
CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor.......CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor....
Factors Affecting the Choice of Professors as a Role Model from the Viewpoint of Medical Students
Directory of Open Access Journals (Sweden)
Masome Rahimi
2018-01-01
Full Text Available The role of professors as a model can have a beneficial impact on the mental, psychological and educational conditions of medical students. This also plays an important role in improving professionalism and academic achievements among medical students. Therefore, the present study was aimed at evaluating the standpoint of students on factors influencing the selection of professors as a role model. This descriptive cross-sectional study was conducted on the students of different disciplines studying in Jahrom University of Medical Sciences in 2016. A randomized sampling method was conducted on 217 students. Their viewpoints were collected using a 30- question researcher-made questionnaire. The questionnaire consisted of three parts, each containing ten items. In addition, this questionnaire was distributed among 20 people (as a pilot survey, the alpha coefficient of which was equal to 0.88; and its measurement was based on Likert scale "from very low to very high". Data were analyzed using SPSS 18 and descriptive statistics. Most respondents were nursing students and the highest influence of professors as a role model was associated with their role as a research leader (future specialized courses in the clinical choices and selection of future specialized fields. The factors influencing the selection of professors as a role model included their respectful attitude toward students, and the high level of their knowledge and skills. On the other hand, the most important factors that caused professors not to be regarded as a role model included their inappropriate relationship with the students and refusing to listen to them. Role model professors can have a beneficial impact on the future of students and scientific communities, as far as the science and education is concerned. Therefore, it is necessary for professors to pay particular attention to strengthening their role as a model at universities.
Podcasts: características nas produções de professores em formação continuada
Directory of Open Access Journals (Sweden)
Vera Lúcia Lopes Cristovão
2014-03-01
Full Text Available A globalização proporcionou uma extensa variedade de ferramentas tecnológicas que podem ser parte do processo de ensino / aprendizagem de uma língua estrangeira, entre elas, a mídia em foco neste trabalho, os podcasts. Pesquisas recentes têm celebrado essa mídia como um excelente recurso para professores com o objetivo supracitado (MEDEIROS, 2006; SOUZA; MARTINS,2007; UCHOA, 2010. Neste trabalho, que faz parte de um projeto maior intitulado “O uso de podcasts na educação continuada de professores de línguainglesa”, apresentamos a análise dos podcasts produzidos por professores em formação continuada durante um curso projetado para dar suporte aos professores com algumas ferramentas tecnológicas digitais emergentes. Em primeiro lugar, apresentamos nosso referencial teórico-metodológico, baseado principalmente no Interacionismo Sociodiscursivo (ISD. Em seguida, trazemos a discussão dos resultados, que aponta que o ensino com base em gêneros textuais proposto pelo ISD alcançou seu objetivo, o de preparar os professores para que possam utilizar a ferramenta podcast com propriedade e destreza. Os resultados também apontam que alguns dos professores ainda precisam melhorar suas habilidades de produção oral para trabalhar com mídias e gêneros textuais orais. Além disso, chegamos à conclusão de que o uso de tecnologias emergentes ainda precisa vencer algumas barreiras.
Stowers, Robert H.; Barker, Randolph T.
2010-01-01
This article explores the uses of coaching and mentoring as they apply to organizational communication professors. The authors contend that these professors already are proficient at coaching and mentoring and the coaching and mentoring processes are routinely undertaken as part of their standard university teaching responsibilities. As coaches,…
[Needling technique of Professor Li Yan-Fang].
Li, Li-Jun
2014-01-01
Experiences of needling techniques of Professor LI Ya- fang is introduced in this article. Gentle and superficial insertion is adopted by Professor LI in clinic. Emphases are put on the qi regulation function, needling sensation to the affected region and insertion with both hands, especially the function of the left hand as pressing hand. The gentle and superficial insertion should be done as the follows: hold the needle with the right hand, press gently along the running course of meridians with the left hand to promote qi circulation, hard pressing should be applied at acupoints to disperse the local qi and blood, insert the needle gently and quickly into the subcutaneous region with the right hand, and stop the insertion when patient has the needling sensation. While the fast needling is characterized with shallow insertion and swift manipulation: the left hand of the manipulator should press first along the running course of the meridian, and fix the local skin, hold the needle with the right hand and insert the needle quickly into the acupoint. Withdrawal of the needle should be done immediately after the reinforcing and reducing manipulations. Professor LI is accomplished in qi regulation. It is held by him that regulating qi circulation is essence of acupuncture, letting the patient get the needling sensation is the most important task of needling. Lifting, thrusting and rotation manipulations should be applied to do reinforcing or reducing. The tissue around the tip of the needle should not be too contracted or too relaxed, and the resistance should not be too strong or too weak. The feeling of the insertion hand of the practitioner should not be too smooth or too hesitant. Needle should be inserted into the skin quickly at the moment of hard pressing by the left hand. And then, slow rotation and gentle lifting and thrusting can be applied to promote the needling sensation like electric current pass through and to reach the affected region along the
"Women in Science" with Professor Jocelyn Bell Burnell
Indian Academy of Sciences (India)
Prof. Dame Jocelyn Bell Burnell is currently a visiting Professor at the. University of Oxford UK and a Fellow of Mansfield College. In a career spanning over four decades, she has made outstanding contributions to Astronomy and the public understanding of Science. As a Ph.D student in Cambridge. University she was ...
Burnout Syndrome and Self-Efficacy Beliefs in Professors
García Padilla, Arlington Antonio; Escorcia Bonivento, Carla Vanessa; Perez Suarez, Blinis Sat
2017-01-01
The presence of the Burnout syndrome in professors may be regarded as a deterioration of their mental health with negative impacts on their job performance. It is known that teachers develop different activities in the areas of teaching, outreach and research. This study aims to analyze the relationship between the Burnout syndrome and…
Síndrome de burn-out e identidade do professor universitário
Rosângela Aparecida Cassiolato
2010-01-01
Resumo: Esta pesquisa teve por objetivo conhecer o processo de desenvolvimento da identidade do professor submetido a condições objetivas que favorecem o desencadeamento da síndrome de burn-out. Procuramos identificar os componentes da síndrome e estabelecer a relação entre o desenvolvimento da síndrome e o exercício profissional, analisar o significado atribuído pelo professor ao seu desempenho como parte constituinte de sua identidade e os efeitos do burn-out no trabalho acadêmico. Particip...
[Professor LIN Guohua's experience of gold implantation at acupoint for rheumatoid arthritis].
Li, Jingjing; Pei, Wenya
2015-12-01
Based on the pathogenesis and symptom of rheumatoid arthritis (RA), professor LIN Guohua's unique opinion and method for RA in clinical treatment are summarized and analyzed. In the opinion of Professor Lin, RA is considered as "Jinbi" and "Gubi" in TCM, which is caused by deficient root with superficial excess. Based on the symptoms of RA, attention should be focused on lung-kidney diagnosis and treatment, and gold and catgut implantation at acupoint can be mutually combined, which is aimed to provide a special and effective method for clinical treatment of RA.
Servilha, Emilse Aparecida Merlin; Delatti, Marina de Almeida
2012-01-01
To investigate the correlation between noise in the work environment and auditory and extra-auditory symptoms referred by university professors. Eighty five professors answered a questionnaire about identification, functional status, and health. The relationship between occupational noise and auditory and extra-auditory symptoms was investigated. Statistical analysis considered the significance level of 5%. None of the professors indicated absence of noise. Responses were grouped in Always (A) (n=21) and Not Always (NA) (n=63). Significant sources of noise were both the yard and another class, which were classified as high intensity; poor acoustic and echo. There was no association between referred noise and health complaints, such as digestive, hormonal, osteoarticular, dental, circulatory, respiratory and emotional complaints. There was also no association between referred noise and hearing complaints, and the group A showed higher occurrence of responses regarding noise nuisance, hearing difficulty and dizziness/vertigo, tinnitus, and earache. There was association between referred noise and voice alterations, and the group NA presented higher percentage of cases with voice alterations than the group A. The university environment was considered noisy; however, there was no association with auditory and extra-auditory symptoms. The hearing complaints were more evident among professors in the group A. Professors' health is a multi-dimensional product and, therefore, noise cannot be considered the only aggravation factor.
Mammas, Ioannis N; Spandidos, Demetrios A
2017-10-01
According to Professor Anne Greenough, Professor of Neonatology and Clinical Respiratory Physiology at the King's College London (London, UK), Paediatric Virology is indeed a rapidly increasing educational challenge. Professor Greenough, who in 1992 wrote her book on congenital, perinatal and neonatal infections, believes that during the past 3 decades, paediatric health professionals are becoming increasingly involved in specialised care and follow-up of paediatric patients with viral diseases, who require advanced medical care and innovative technological services. Moreover, she highlights the expected role of new vaccines and antiviral agents that are currently under investigation, as well as the impact of emerging viral diseases that require novel prevention strategies and therapeutic protocols. However, she notes that the number of Paediatric Virologists in any one country is likely to be small; hence, a separate paediatric subspecialty needs to be considered carefully. In the context of the 3rd Workshop on Paediatric Virology, which will be held in Athens, Greece, on October 7th, 2017, Professor Greenough will give her plenary lecture on the impact of viral infections on the long term outcomes of prematurely born infants.
[Data mining analysis of professor Li Fa-zhi AIDS itchy skin medical record].
Wang, Dan-Ni; Li, Zhen; Xu, Li-Ran; Guo, Hui-Jun
2013-08-01
Analysis of professor Li Fa-zhi in the treatment of AIDS drug laws of itchy skin, provide the corresponding drug reference basis for Chinese medicine treatment of AIDS, skin itching. By using the method of analyzing the complex network of Weishi county, Henan in 2007 October to 2011 July during an interview with professor Li Fa-zhi treatment of AIDS patients with skin pruritus, etiology and pathogenesis analysis, skin itching AIDS syndrome differentiation of old Chinese medicine treatment and medication rule. The use of multi-dimensional query analysis, core drug skin itching AIDS treatment in this study as a windbreak, cicada slough, bupleurum, Qufeng solution table drug, licorice detoxification efficacy of drugs, Radix Scutellariae, Kochia scoparia, clearing away heat and promoting diuresis medicine; core prescription for Jingfang San streak virus. Professor Li Fa-zhi treatment of AIDS in the skin itching Qufeng solution table dehumidification antipruritic treatment.
[Professor GAO Yuchun's experience on "sequential acupuncture leads to smooth movement of qi"].
Wang, Yanjun; Xing, Xiao; Cui, Linhua
2016-01-01
Professor GAO Yuchun is considered as the key successor of GAO's academic school of acupuncture and moxibustion in Yanzhao region. Professor GAO's clinical experience of, "sequential acupuncture" is introduced in details in this article. In Professor GAO's opinions, appropriate acupuncture sequence is the key to satisfactory clinical effects during treatment. Based on different acupoints, sequential acupuncture can achieve the aim of qi following needles and needles leading qi; based on different symptoms, sequential acupuncture can regulate qi movement; based on different body positions, sequential acupuncture can harmonize qi-blood and reinforcing deficiency and reducing excess. In all, according to the differences of disease condition and constitution, based on the accurate acupoint selection and appropriate manipulation, it is essential to capture the nature of diseases and make the order of acupuncture, which can achieve the aim of regulating qi movement and reinforcing deficiency and reducing excess.
Formação Continuada para Professores de Inglês
Directory of Open Access Journals (Sweden)
Maria da Conceição Aparecida Pereira Zolnier
2016-07-01
Full Text Available O objetivo deste trabalho é apresentar experiências de aprendizagem, reflexão e transformações vivenciadas por uma participante no Projeto de Educação Continuada para Professores de Língua Inglesa (PECPLI. A coleta de dados, que teve a duração de um semestre, foi realizada por meio de gravações em vídeo, entrevistas e anotações de campo, em contexto de observação participante. Os resultados evidenciam que experiências recorrentes de interação acolhedora, aprendizagem significativa, reflexão sobre a prática e disposição para mudanças levam a transformações na identidade profissional (maior prazer e segurança para lecionar, nas crenças sobre o ensino de gramática e nas práticas de sala de aula, que se tornam mais abertas à habilidade de produção oral. Como contribuição para a área de Linguística Aplicada, o estudo traz implicações para os projetos de educação continuada de professores de línguas, ampliando a compreensão desse contexto no qual os professores se inserem para aprenderem e melhorarem o ensino em suas escolas.
An Interview with Professor Roy Caldwell
Chowdhary, Kuntal; Bhat, Prashant; Rosen, Jared; Naughton, Ida; Wang, Jingyan
2013-01-01
Envision the underwater world: vibrant coral, swaying seaweed, and lively creatures abound. However, the postcards and National Geographic covers that try to capture the beauty of this picturesque habitat can only represent it at one moment in time -- in reality, the landscape is hardly static, since many of its animals are capable of body modifications to change their shape and color. To understand the coloration and color vision of sea creatures, UC Berkeley Professor Roy L. Caldwell resear...
Stress e esgotamento em professores: importância dos processos de avaliação cognitiva
Reis, Silvi Borges
2016-01-01
Dissertação de mestrado integrado em Psicologia Este estudo analisou a experiência de stress e esgotamento em professores e o papel da avaliação cognitiva na relação estabelecida entre stress e esgotamento. Participaram no estudo 551 professores, sendo 129 do sexo masculino e 317 do sexo feminino. As idades variaram entre 28 e 67 anos (M = 46.88; DP = 7.80). O protocolo de avaliação incluiu um questionário demográfico, a Escala de Avaliação Cognitiva, o Questionário de Stress em Professore...
Professor Anne Khademian named National Academy of Public Administration Fellow
Chadwick, Heather Riley
2009-01-01
Anne Khademian, professor with Virginia Tech's Center for Public Administration and Policy, School of Public and International Affairs, at the Alexandria, Va., campus has been elected a National Academy of Public Administration (NAPA) Fellow.
Os saberes dos professores-referência no ensino de contabilidade
Directory of Open Access Journals (Sweden)
Gilberto José Miranda
2012-08-01
Full Text Available O presente estudo tem como propósito avaliar os saberes predominantes nos docentes percebidos como professores-referência pelos alunos de um curso de Graduação em Ciências Contábeis de uma universidade pública brasileira. O estudo justifica-se pelas recentes e significativas mudanças no contexto da Contabilidade no Brasil. Para alcance desse propósito, estruturou-se uma pesquisa qualitativa, em que foram utilizadas as seguintes estratégias de pesquisa e técnicas de coleta de dados: (i pesquisa bibliográfica em obras relevantes que tratam do tema; (ii pesquisa documental nas avaliações dos professores feitas pela instituição; (iii questionários aplicados aos alunos do último ano; (iv grupo focal com parte do grupo de alunos respondentes dos questionários; e (v entrevista semiestruturada com professores apontados pelos alunos como docentes de referência. Amparados pelas discussões tecidas acerca de saberes, competências e conhecimentos necessários à docência (Shulman, 1986; Garcia, 1992; Freire, 2000; Pimenta, 1998; Pimenta & Anastasiou, 2002; Gauthier, Martineau, Desbiens, Malo, & Simard, 1998; Tardif, 2003; Cunha, 2004; Masetto, 1998; Braslavsky, 1999; Perrenoud, 2000; Zabalza, 2006 e aqueles necessários ao ensino de contabilidade (Antonelli, Colauto, & Cunha, 2012; Miranda, 2011; Catapan, Colauto, & Sillas, 2011; Vasconcelos, 2010; Slomsky, 2009; Araujo & Santana, 2008; Celerino & Pereira, 2008; Andere & Araújo, 2008; Laffin, 2005, bem como pesquisas sobre professores exemplares (Young & Shaw, 1999; Lowman, 2007, verificaram-se os seguintes resultados: as disciplinas responsáveis pelas experiências mais significativas de aprendizagem, durante o curso, eram as percebidas como base do curso (Contabilidade Básica, Intermediária e Avançada e que apresentavam maior aplicação prática. As razões principais para escolha dos docentes de referência foram: didática ou metodologia de ensino, atitudes e qualidades
Guraya, Salman Yousuf; Khoshhal, Khalid Ibrahim; Yusoff, Muhamad Saiful Bahri; Khan, Maroof Aziz
2018-05-07
Research has shown a fall of research productivity of faculty after their promotion to professor rank. This study explores the factors that lead to this decline in research productivity of professors in medical discipline. A 20-item questionnaire was distributed online to medical professors of a Saudi, Malaysian and a Pakistani medical school. The participants were instructed to select their responses on a 5-point Likert's scale and the collected data was analyzed for quantitative and qualitative results. Of 161, 110 responded; response rate of 68.3%. About 35% professors spent 1-4 hours and 2% spent 19-25 hours per week for research. As many as 7% did not publish a single article and 29% had published 10 or more articles after attaining professor rank. During the last two years, 44% professors had published 5 or more research articles. Majority pointed out a lack of research support and funds, administrative burden and difficulty in data collection as the main obstacles to their research. This research has identified time constraints and insufficient support for research as key barriers to medical professors' research productivity. Financial and technical support and lesser administrative work load are some suggested remedies to foster the professors' research output.
PHYSICAL ACTIVITY AND EATING HABITS IN UNIVERSITY PROFESSORS: LITERATURE REVIEW
Directory of Open Access Journals (Sweden)
Hector Luiz Rodrigues Munaro
2015-01-01
Full Text Available Increasingly, university professors engage in academic tasks often stressful and sedentary behaviors, making the practice of physical activity and healthier eating habits. The aim of this study was to review the literature Brazilian studies on physical activity and eating habits of university professors .The search was conducted between March and May 2013, in electronic databases. For the delimitation of the study, was used as descriptors: Physical Activity, University Teachers and Eating Habits. At the end of the article selection process, remaining 06 studies that have been described and discussed in the text. And all of a descriptive nature, with small samples with some robust and consistent methodology. The selected studies, regardless of their qualities, point to the need of this population to engage in more physical activity and healthy eating habits programs
PHYSICAL ACTIVITY AND EATING HABITS IN UNIVERSITY PROFESSORS: LITERATURE REVIEW
Directory of Open Access Journals (Sweden)
Hector Luiz Rodrigues Munaro
2015-03-01
Full Text Available Increasingly, university professors engage in academic tasks often stressful and sedentary behaviors, making the practice of physical activity and healthier eating habits. The aim of this study was to review the literature Brazilian studies on physical activity and eating habits of university professors .The search was conducted between March and May 2013, in electronic databases. For the delimitation of the study, was used as descriptors: Physical Activity, University Teachers and Eating Habits. At the end of the article selection process, remaining 06 studies that have been described and discussed in the text. And all of a descriptive nature, with small samples with some robust and consistent methodology. The selected studies, regardless of their qualities, point to the need of this population to engage in more physical activity and healthy eating habits programs.
Tomlinson, Jon C.; Winston, Bruce E.
2011-01-01
This study builds on earlier work by DellaVecchio and Winston (2004) and McPherson (2008). They addressed the seven motivational gifts Paul wrote about in Romans 12:3-8 as a means for addressing job satisfaction and person-job fit among college professors. Using a snowball sampling method, 89 college professors completed the online survey…
Interview: Interview with Professor Malcolm Rowland.
Rowland, Malcolm
2010-03-01
Malcolm Rowland is Professor Emeritus and former Dean of the School of Pharmacy and Pharmaceutical Sciences and a member and former director (1996-2000), of the Centre for Applied Pharmacokinetic Research, University of Manchester. He holds the positions of Adjunct Professor, School of Pharmacy, University of California, San Francisco; Member, Governing Board, EU Network of Excellence in Biosimulation; Founder member of NDA Partners; academic advisor to a Pharmaceutical initiative in prediction of human pharmacokinetics and Scientific Advisor to the EU Microdose AMS Partnership Program. He was President of the EU Federation for Pharmaceutical Sciences (1996-2000); Vice-President of the International Pharmaceutical Federation (2001-2009) and a Board Member of the National Centre for the Replacement, Refinement and Reduction of Animals in Research (NC3Rs, 2004-2008). He received his degree in Pharmacy and PhD at the University of London and was on faculty (School of Pharmacy, University of California San Francisco [1967-1975]) before taking up a professorship at Manchester. His main research interest is physiologically based pharmacokinetics and its application to drug discovery, development and use. He is author of over 300 scientific articles and co-author, with TN Tozer, of the textbooks Clinical Pharmacokinetics and Pharmacodynamics: Concepts and Applications and Introduction to Pharmacokinetics and Pharmacodynamics. He was editor of the Journal of Pharmacokinetics and Pharmacodynamics (formerly Journal of Pharmacokinetics and Biopharmaceutics, 1973-2007) and, since 1977, has organized regular residential workshops in pharmacokinetics.
Energy Technology Data Exchange (ETDEWEB)
Beheng, K.D. [ed.
1998-01-01
This report was compiled in honor of Professor Dr. Franz Fiedler on the occasion of his 60th birthday on 7 January 1998. Its contributions deal with mesoscale modelling, the propagation of air pollutants, measurements of precipitation using radar, and prediction models. (orig./KW) [Deutsch] Dieser Bericht wurde aus Anlass des 60. Geburtstags von Herrn Prof. Dr. Franz Fiedler am 7. Januar 1998 zusammengestellt. Die Beitraege behandeln mesoskalige Modellierung, Ausbreitung von Luftschadstoffen, Niederschlagsmessung mit Radar und Vorhersagemodelle. (orig.)
Professor Glyn O. Phillip's legacy within the IAEA programme on radiation and tissue banking.
Morales Pedraza, Jorge
2017-08-19
Professor Phillips began his involvement in the implementation of this important IAEA programme, insisting that there were advantages to be gained by using the ionizing radiation technique to sterilize human and animal tissues, based on the IAEA experience gained in the sterilization of medical products. The outcome of the implementation of the IAEA programme on radiation and tissue banking demonstrated that Professor Phillips was right in his opinion.
Directory of Open Access Journals (Sweden)
Rosane Michelli de Castro
2011-12-01
Full Text Available A fim de contribuir com a formação de professores da Educação Infantil para a Educação Inclusiva, neste artigo, tivemos como objetivo central descrever o modo como foi abordada a questão das dificuldades de aprendizagem e o impacto de um diagnóstico equivocado atribuído a uma criança em fase inicial de aprendizagem formal da escrita, em um dos encontros teórico-reflexivos empreendidosjunto a 43 professores de classes de Pré II, de dez escolas municipais de Educação Infantil, de um município do interior do Estado de São Paulo. Tal descrição foi norteada pelas etapas da abordagem colaborativa consideradas no subprojeto “Compreensão acerca do diagnóstico clínico da Dislexia e seu impacto no futuro escolar da criança matriculada em classes de Pré II da Educação Infantil”, desenvolvido como uma das etapas do projeto maior denominado “Despatologização da aprendizagem da escrita e Educação Inclusiva: reflexões e ações do professor de Educação Infantil”. Ao final, foi possível a identificação,mediante os relatos dos professores mencionados, da necessidade de ressignificação de suas vivências e experiências didáticas para a sistematização de novas ações direcionadas ao enfrentamento das dificuldades de aprendizagem que perpassam o processo de apropriação da escrita de parte dos alunos, o que poderá contribuir para a despatologização do ambiente escolar, na medida em que os professores poderão auxiliar seus alunos na construção deuma relação mais positiva com a escrita, em detrimento da adoção de procedimentos rígidos e restritos que não consideram a relação de cada sujeito com a escrita e as singularidades presentes em tal relação. Palavras-chave: Educação; Formação de professores; Educação Inclusiva.
Carmo Menegaz, Jouhanna do; Schubert Backes, Vânia Marli
2015-12-01
to analyze the educational practices for the Unified Health System performed by good professors, from the perspective of nursing, medical and odontology students, based on the Shulman's concepts of knowledge of educational ends, purposes, values and their historical and philosophical grounds, at a university in southern Brazil. A qualitative study with an exploratory and analytical approach in which the participants were graduating students, interviewed with the aid of vignettes, between October of 2011 and January of 2012. Data were analyzed based on thematic analysis. it was observed that good professors educate for the Unified Health System through the promotion of teamwork, interdisciplinary practices, good communication, leadership exercises, and promotion of a student's desire to be an agent of change for the sake of improvement and guaranteeing the right to health. the students attribute to professors the responsibility for the performance of these practices. Despite their consistency with the Brazilian curriculum guidelines, the professors that perform them are seen as a minority.
Directory of Open Access Journals (Sweden)
Larissa Guadagnini
2016-01-01
Full Text Available O presente estudo analisa o relato dos professores da sala regular e da educação especial, em relação à adaptação curricular para os alunos com deficiência intelectual. A pesquisa, realizada por meio de questionários, teve como participantes 18 professores de uma diretoria de ensino do interior do estado de São Paulo, divididos entre: 8 professores da sala regular que ministraram aula no ensino fundamental para alunos com deficiência intelectual, 8 professores que ministraram aula no ensino médio para alunos com deficiência intelectual e 2 professores da educação especial. Os resultados indicaram que os professores reconhecem a importância da adaptação curricular no ensino dos alunos com deficiência intelectual, mas não tem clareza da definição do conceito e da utilização de recursos e estratégias adaptadas para favorecer a aprendizagem dos conteúdos propostos no currículo. Todavia, os dados revelaram a necessidade de as professoras compartilharem de uma visão mais ampla do como fazer adaptação dos conteúdos escolares. Tais dados indicaram a necessidade de programas direcionados à formação dos professores para atuarem na elaboração de adaptação curricular junto aos alunos com deficiência intelectual. Palavras-Chave: Educação Especial. Currículo. Deficiência intelectual. Inclusão escolar.
[Professor YANG Zhao-min's contribution to the education of modern acupuncture and moxibustion].
Dong, Qin; Mu, Yan-Yun; Xia, You-Bing; Zhang, Jian-Bin
2012-05-01
It was completely collected and summarized the teaching history and the relevant historical materials of Professor YANG Zhao-min via consulting the literatures, investigation, interview, etc. in this paper. The summaries indicated that from the beginning of running a school, Professor YANG Zhao-min adhered to the CHENG's moral, worked hard and successfully explored and practiced the training pattern of teaching tour for the personnel training of acupuncture and moxibustion. He established the specialty of acupuncture and moxibustion, formatted courses and inherited the feature of practice teaching. He was in charge of the compilation of textbook and engaged in scientific innovation. He inherited the past and forged ahead into the future and had made the decision to cultivate the personnel of acupuncture and moxibustion. Professor YANG Zhao-min had practiced and developed the modern educational thought from the CHENG Dan-an and had made the important contribution to the training of acupuncture and moxibustion professionals.
Mariette, Xavier
2017-09-01
Professor Xavier Mariette, MD, PhD, has served as the Head of the Rheumatology Department of Bicêtre Hospital, Paris-Sud University since 1999, a role he took following 10 years of practice of clinical immunology. Professor Mariette has initiated a number of clinical research studies on biotherapies in autoimmune diseases. He is the head of the French RATIO (Research Axed on Tolerance of Biotherapy) observatory, collecting specific rare serious adverse events in patients treated with anti-TNF. He initiated the French AIR (Autoimmunity and Rituximab) and ORA (Orencia and Rheumatoid arthritis) registries of patients with autoimmune diseases treated with rituximab and abatacept. He initiated clinical trials in Sjögren's syndrome with infliximab, hydroxychloroquine and belimumab. Professor Mariette is involved in basic research, leading a group working on pathogeny of Sjögren's syndrome, relationships between innate immunity and B-cell activation in autoimmunity and the relationships between autoimmunity and lymphoma. Professor Mariette is also very interested in new ways of teaching. In 2007, he participated with other European Experts in the creation of the EULAR Web Course of Rheumatology in 2007. Professor Mariette has been the President of the Scientific Committee of the EULAR meeting, which took place in Berlin in 2012 and is in 2016 the elect Chair of the EULAR standing committee on investigative rheumatology. Professor Mariette is co-author of more than 430 publications referenced in PubMed with an H-index of 61.
The Effect of Professor's Attractiveness on Distance Learning Students
Liu, Jeanny; Tomasi, Stella D.
2015-01-01
Technology enabled learning is becoming more popular and pervasive in education. While the effectiveness of distance learning versus traditional classroom education is strongly debated, human factors such as students' perception of their professors can influence their desire to learn. This research examines the perceptual effect of attractive…
University Pedagogy for Assistant Professors at Aalborg University (Part 1)
DEFF Research Database (Denmark)
Kolmos, Anette; Krogh, Lone
2003-01-01
The article describes a course for assistant professors within the University Teacher Education at Aalborg University. The course focus is to develop knowledge, skills and methods from within the didactic, pedagogical, and learning theory-based fields....
“Cientistas não esperam pelo conhecimento”: entrevista com o professor Gilson Volpato
Directory of Open Access Journals (Sweden)
Revista Agrogeoambiental
2013-04-01
Full Text Available Desde agosto de 2011, a Revista Agrogeoambiental publica notas biográficas de avaliadores como um reconhecimento à colaboração imprescindível desses profissionais. Pensamos em inovar um pouco nessa edição e optamos por publicar trechos de uma conversa que tivemos com Gilson Volpato, professor da Universidade Estadual Paulista “Júlio de Mesquita Filho” em Botucatu (UNESP/Botucatu. No início desse ano, a equipe da Revista Agrogeoambiental e da Pró-Reitoria de Pesquisa, Pós-Graduação e Inovação viabilizou a vinda do professor Gilson Volpato para que ministrasse um curso de redação científica no câmpus Muzambinho do IFSULDEMINAS. Finalmente, na manhã da segunda-feira 4 de março, quase cem pesquisadores se reuniram para as 8 horas de um proveitoso curso durante o qual o professor Gilson Volpato explicou a lógica da redação científica e quais as precauções para quem pretende publicar em revistas internacionais de alto impacto. Após o curso, o editor chefe da Revista Agrogeoambiental e Pró-Reitor de Pesquisa, Pós-Graduação e Inovação, professor Marcelo Bregagnoli, encontrou-se com o professor Gilson para um bate papo sobre ciência, ensino de ciência e publicação. Abaixo estão trechos condensados da conversa. O vídeo com a versão integral pode ser conferido em http://www.ifsuldeminas.edu.br/~pppi
Pós-modernidade e novas tecnologias no discurso do professor de língua
Directory of Open Access Journals (Sweden)
Maria José R. Faria Coracini
2006-01-01
Full Text Available
Este texto pretende apresentar algumas reflexões em torno da identidade do professor, atravessada pelo discurso da pós modernidade na vertente que se apóia nas novas tecnologias como resultado do chamado progresso científico. Para este estudo, baseamo-nos nas teorias do discurso, na psicanálise e na filosofia derrideana, cuja tarefa é desconstruir o edifício logocêntrico da cultura ocidental. Depois de analisar 50 redações de professores, foi possível observar que coabitam crenças que remetem ao professor missionário e idealista e a mitificação das novas tecnologias como a solução para os problemas de método e de motivação. Chocam-se, assim, resistências ao passado e resistências às novas tecnologias, que perturbam a garantia do saber e, portanto, do poder do professor, enfatizando o saber do aluno. O desejo da tranqüilidade e do conforto da verdade e da totalidade, garantido pela Torre de Marfim, se fragiliza na insegurança e nas incertezas da Torre de Babel (reconstruída pela (pós-modernidade, em que vigoram a complexidade, a heterogeneidade e a impossibilidade de completude.
A relação professor-aluno na construção do conhecimento
Directory of Open Access Journals (Sweden)
Maiby Gisele Wagner
2011-07-01
Full Text Available A presente pesquisa aborda o tema Relação Professor-Aluno, analisando as diferentes situações e comportamentos destes, frente às diversas problemáticas existentes no contexto escolar. Neste sentido, contextualizando a realidade dos alunos e dos professores de uma turma de terceiro ano de uma Escola Pública do Município de Sinop - MT, trazendo como abordagens teóricas fundamentadas em Henry Wallon, Vygotsky, Mirian Goldenberg, Valéria Amorim Arantes, Nelson Piletti, Maximiliano Menegolla, Pedro Morales, Paulo Freire, Ana Rita Silva Almeida. Foram observados a relação destes sujeitos, com a afetividade, as metodologias, as práticas docentes, a expressividade, a dedicação do profissional, o comportamento dos alunos e as avaliações e opiniões destes e de sua professora. Como escolha metodológica optamos pela pesquisa qualitativa, o estudo de caso. Para obtenção dos dados foram desenvolvidas entrevistas semi-estruturadas e observações in loco. Durante as observações constatou-se que a relação harmoniosa entre os sujeitos (professores-alunos é fundamental para a melhor aprendizagem.Palavras-chave: educação; relação de professores e alunos; afetividade; aprendizagem.
Performance Test of Openflow Agent on Openflow Software-Based Mikrotik RB750 Switch
Directory of Open Access Journals (Sweden)
Rikie Kartadie
2016-11-01
Full Text Available A network is usually developed by several devices such as router, switch etc. Every device forwards data package manipulation with complicated protocol planted in its hardware. An operator is responsible for running configuration either to manage rules or application applied in the network. Human error may occur when device configuration run manually by operator. Some famous vendors, one of them is MikroTik, has also been implementing this OpenFlow on its operation. It provides the implementation of SDN/OpenFlow architecture with affordable cost. The second phase research result showed that switch OF software-based MikroTik resulted higher latency value than both mininet and switch OF software-based OpenWRT. The average gap value of switch OF software-based MikroTik is 2012 kbps lower than the value of switch OF software-based OpenWRT. The average gap value of throughput bandwidth protocol UDP switch OF software-based MikroTik is 3.6176 kBps lower than switch OF software-based OpenWRT and it is 8.68 kBps lower than mininet. The average gap throughput jitter protokol UDP of switch OF software-based MiktoTik is 0.0103ms lower than switch OF software-based OpenWRT and 0.0093ms lower than mininet.
Liu, Baohu; Zheng, Jiatai; Guo, Yongming
2015-06-01
Professor ZHENG Kuishan has been engaged in the education and clinical practice of acupuncture and moxibustion for over 60 years. Professor ZHENG is strict in scholarly research and exquisite in medical techniques and he is good at treatment of bi syndrome induced by invasion of wind, cold and damp with warming and, promoting therapy. He emphasizes on syndrome differentiation and acupoint combination and selects the accurate manipulations. Not only are the symptoms relieved apparently, but also the body state is improved. As a result, the primary and secondary are treated simultaneously. In the paper, professor ZHENG's experience is introduced in the treatment of bi syndrome in the aspects of theory, method, formula, acupoint and technique. And his clinical therapeutic approaches have been deeply analyzed.
In memoriam of Professor Theodore L. Munsat (1930-2013): his outstanding legacy with the WFN.
Medina, Marco T
2014-04-15
The World Federation of Neurology (WFN) lost an outstanding leader on November 22, 2013 with the death of Professor Theodore Leon Munsat ("Ted"), in Waltham, Massachusetts, USA. Professor Munsat was Emeritus professor of Neurology at Tufts University School of Medicine and served the WFN in several capacities as trustee, chairman of the WFN Education and research committees, chairman of the WFN ALS Research group and founding director of the WFN Seminars in Clinical Neurology. He was president of the American Academy of Neurology (AAN), 1989-1991, chairman of the Continuing Educational Committee of the AAN and founding director of AAN's premier continuing medical education journal Continuum: Lifelong Learning in Neurology. He left an outstanding legacy with the WFN. Copyright © 2014. Published by Elsevier B.V.
Professor om brexit-åbning: Det bliver sværere i næste fase
DEFF Research Database (Denmark)
Wind, Marlene
2017-01-01
Professor og centerleder, Marlene Wind, var den 8. december i Vejle Amts Folkeblad, hvor hun kommenterede på udviklingen i Brexit-forhandlingerne i forlængelse af udmeldingen om, at forhandlingerne er klar til den næste fase. Professor Wind kalder dette for et gennembrud, men pointerer også at de...... videre forhandlinger vil være på EU’s præmisser. De videre forhandlinger vil blandt andet handle om en kommende handelsaftale mellem de to parter, til hvilket professor Wind påpeger, at det kan tage mange år, før man har en sådan i hus. Samtidig vurderer Wind også, at nogle leave-vælgere måske vil blive...
Seo, Ga-eun; Hedayati Mehdiabadi, Amir; Huang, Wenhao
2017-01-01
This exploratory study aims to identify the core competencies necessary to successfully advance the careers of female associate professors in higher education. To ascertain these core career competencies, a critical incident interview technique was employed. One-to-one semi-structured interviews with six female full professors at a major research…
YouTube Professors: Scholars as Online Video Stars
Young, Jeffrey R.
2008-01-01
This article takes a look at the rising popularity of professors as the latest YouTube stars. The popularity of their appearances on YouTube and other video-sharing sites is making it possible for classrooms to be opened up and making teaching--which once took place behind closed doors--a more public art. Web video has generated a new form of…
YouTube Professors Scholars as Online Video Stars
Young, Jeffrey R.
2008-01-01
This article takes a look at how professors are becoming the latest YouTube stars. The popularity of their appearances on YouTube and other video-sharing sites end up opening the classroom and making teaching--which once took place behind closed doors--a more public art. Web videos open a new form of public intellectualism to scholars looking to…
An Examination of Assistant Professors' Project Management Practices
Alpert, Shannon Atkinson; Hartshorne, Richard
2013-01-01
Purpose: The purpose of this research was to identify factors that influence the use of project management in higher education research projects by investigating the project management practices of assistant professors. Design/methodology/approach: Using a grounded theory approach that included in-depth, semi-structured interviews with 22…
O YouTube e o Cyberbullying de alunos contra professores around the world
Directory of Open Access Journals (Sweden)
Antonio Alvaro Soares Zuin
2017-08-01
Full Text Available The teacher, in one way or another, has always been identified as a pedagogical authority. But if there were a society whose technological development determined radical transformations in the production and dissemination of knowledge, to the point of decisively changing the relations between teachers and students? Would the teacher continue to represent a model of identity for the student who could access information online in any time and space? In view of the context of the digital culture society, the objective of this article is to investigate how students practice cyberbullying in relation to their teachers through images recorded by mobile phones, which are posted on the site YouTube. It will be analyzed three videos posted by students from three different countries (Brazil, Portugal and England, whose images refer to situations experienced with their respective teachers. It is also intended to argue that such attitudes are signs of radical transformations that are occurring in relation to the way students identify the teacher as a pedagogical authority. O professor, de uma forma ou de outra, sempre foi identificado como autoridade pedagógica. Mas, e se houvesse uma sociedade cujo desenvolvimento tecnológico determinasse transformações radicais na produção e disseminação do conhecimento, a ponto de se alterar, de forma decisiva, as relações entre professores e alunos? O professor continuaria a representar um modelo de identidade para o aluno que pudesse acessar informações de forma online em quaisquer tempos e espaços? Diante do contexto da sociedade da cultura digital, destaca-se o objetivo deste artigo: investigar o modo como alunos praticam cyberbullying em relação a seus professores por meio de imagens gravadas por telefones celulares, as quais são postadas no sítio de compartilhamentos de imagens e comentários chamado YouTube. Serão analisados três vídeos postados por alunos de três diferentes países (Brasil
PIBID – PRIMORDIAL PARA A FORMAÇÃO DE PROFESSORES
Directory of Open Access Journals (Sweden)
Rafael Dias Rios de Souza
2016-12-01
Full Text Available Resumo - Realizamos nesse artigo, reflexões necessárias para as compreensões e os significados relativos ao Programa de Bolsa de Iniciação à Docência (PIBID, cujo objetivo é o de contribuir de maneira significativa para a formação inicial de professores de História. Constatamos que esse programa é compreendido como um espaço que possibilita a integração entre universidade-escola, oportunizando aos futuros professores, o entendimento e a análise sobre a profissão docente e a realidade escolar. Isso ocorre por meio do desenvolvimento de temáticas que priorizam a inserção de diferentes materiais e abordagens didáticas no ensino de história, visando a renovação nesse campo do conhecimento.
Poewe, Werner
2017-10-01
Werner Poewe speaks to Laura Dormer, Editorial Director: Professor Werner Poewe is Professor of Neurology and Director of the Department of Neurology at Innsbruck Medical University in Innsbruck, Austria. He held a Residency in Clinical Neurology and Psychiatry at the University of Innsbruck, Austria, from 1977 to 1984. From 1984 to 1985 he teamed up with Gerald Stern and Andrew Lees as a British Council Research Fellow at University College and Middlesex Hospital's Medical School in London to perform clinical studies into levodopa-induced dystonia and pharmacokinetics of levodopa in naive versus L-Dopa treated Parkinson's disease. Following his return to Austria, he held a position as Senior Lecturer in the Department of Neurology at the University of Innsbruck (1986-1989) after which he took over as Professor of Neurology and Acting Director of the Department of Neurology at Virchow Hospital of the Free University of Berlin (1990-1994). Professor Poewe's main research interests in the field of movement disorders are focused on differential and early diagnosis of Parkinson's disease, its natural history and pharmacological treatment. He has been involved in the steering committees of numerous drug trials in different stages of Parkinson's disease for the past 20 years and has authored and coauthored more than 500 original articles and reviews in the field of movement disorders. Professor Poewe served as President of the Austrian Society of Neurology from 2002 to 2004 as well as President of the Austrian Parkinson's Disease Society from 1996 to 2009. He has been awarded honorary membership of the German Society of Neurology as well as the Japanese Society of Neurology. His awards include the Walther-Birkmayer-Prize of the Austrian PD Society, the Dingebauer-Prize of the German Neurological Society as well as the Research Excellence Award of Innsbruck Medical University. Professor Poewe served as President of the International Movement Disorder Society (MDS) from
Publication pressure and burn out among Dutch medical professors: a nationwide survey.
Directory of Open Access Journals (Sweden)
Joeri K Tijdink
Full Text Available BACKGROUND: Publication of scientific research papers is important for professionals working in academic medical centres. Quantitative measures of scientific output determine status and prestige, and serve to rank universities as well as individuals. The pressure to generate maximum scientific output is high, and quantitative aspects may tend to dominate over qualitative ones. How this pressure influences professionals' perception of science and their personal well-being is unknown. METHODS AND FINDINGS: We performed an online survey inviting all medical professors (n = 1206 of the 8 academic medical centres in The Netherlands to participate. They were asked to fill out 2 questionnaires; a validated Publication Pressure Questionnaire and the Maslach Burnout Inventory. In total, 437 professors completed the questionnaires. among them, 54% judge that publication pressure 'has become excessive', 39% believe that publication pressure 'affects the credibility of medical research' and 26% judge that publication pressure has a 'sickening effect on medical science'. The burn out questionnaire indicates that 24% of medical professors have signs of burn out. The number of years of professorship was significantly related with experiencing less publication pressure. Significant and strong associations between burn out symptoms and the level of perceived publication pressure were found. The main limitation is the possibility of response bias. CONCLUSION: A substantial proportion of medical professors believe that publication pressure has become excessive, and have a cynical view on the validity of medical science. These perceptions are statistically correlated to burn out symptoms. Further research should address the effects of publication pressure in more detail and identify alternative ways to stimulate the quality of medical science.
The Education of an English Professor: The Biographical Narrative
González Valencia, Heriberto; Enríquez, Jakeline Amparo Villota; Ramos Acosta, Lizeth
2018-01-01
This article is the result of a qualitative research following the characteristics of hermeneutical research aims to understand the training process of the English university professor, taking into account factors that affect and surround the social, economic, and cultural environment; in which the experience and the story of life, shape the…
Professor Age and Gender Affect Student Perceptions and Grades
Joye, Shauna W.; Wilson, Janie H.
2015-01-01
Student evaluations provide rich information about teaching performance, but a number of factors beyond teacher effectiveness influence student evaluations. In this study we examined the effects of professor gender and perceived age on ratings of effectiveness and rapport as well as academic performance. We also asked students to rate professor…
Professor Adler-Nissen om TED-Talks i Kristeligt Dagblad
DEFF Research Database (Denmark)
Adler-Nissen, Rebecca
2017-01-01
Professor Rebecca Adler-Nissen var den 10. juni 2017 i Kristeligt Dagblad i forbindelse med hendes TED Talk på TED konferencen i Danmark. Her talte Adler-Nissen om international diplomati. Adler-Nissen ser TED formatet som en måde at øge kendskabet til emnet international diplomati, da formatet...
"Friending" Professors, Parents and Bosses: A Facebook Connection Conundrum
Karl, Katherine A.; Peluchette, Joy V.
2011-01-01
The ever-growing popularity of Facebook has led some educators to ponder what role social networking might have in education. The authors examined student reactions to friend requests from people outside their regular network of friends including professors, parents, and employers. We found students have the most positive reactions to friend…
Burnout Syndrome and Self-Efficacy Beliefs in Professors
Directory of Open Access Journals (Sweden)
Arlington Antonio García Padilla
2017-10-01
Full Text Available The presence of the Burnout syndrome in professors may be regarded as a deterioration of their mental health with negative impacts on their job performance. It is known that teachers develop different activities in the areas of teaching, outreach and research. This study aims to analyze the relationship between the Burnout syndrome and self-efficacy beliefs and the academic performance in professors of the psychology and dentistry programs at a private university in the city of Barranquilla. This study is empirical and analytical with a descriptive-correlational design. The study population consisted of 93 teachers of the psychology and dentistry programs. To choose the sample, a non-probabilistic sample was used according to the inclusion and exclusion criteria that allowed selecting a total of 36 teachers who met the criteria for the study. The instruments that were used in this study was the Maslach Burnout Inventory (MBI, 1981 adapted by Seisdedos (1997, and the Teachers’ Self-Efficacy Beliefs of Tschannen-Moran and Woolfolk (2001 adapted by Covarrubias and Mendoza (2016. According to the results, it was observed that there is no significant relationship between Burnout, Self-efficacy Belief and the academic performance.
Saberes docentes na prática do professor de música do Projeto SESC Cidadão
Araújo, José Magnaldo de Moura
2016-01-01
Este trabalho apresenta, discute e analisa como se constituem e de que forma se articulam os saberes docentes de um professor de música atuante no projeto social SESC Cidadão. Para alcançar tal objetivo foi realizada uma pesquisa que teve os seguintes objetivos específicos: verificar aspectos gerais acerca da formação cultural-profissional do professor atuante no SESC Cidadão; compreender de que forma os saberes adquiridos na formação “formal” do professor têm subsidiado sua ação pedagógica n...
Zacher, Hannes; Bal, P. Matthijs
2012-01-01
Recent research has shown that, in general, older professors are rated to have more passive-avoidant leadership styles than younger professors by their research assistants. The current study investigated professors' age-related work concerns and research assistants' favorable age stereotypes as
Rotaru, Alexandru; Rotaru, Horatiu
2015-01-01
Founder of the Surgical Clinic in Cluj-Napoca and of Medical Education in Romanian, Rector of Dacia Superior University, Professor Iacob Iacobovici was one of the outstanding medical personalities in the first half of the twentieth century, in Romania. His scientific contributions have been recognized by the European great personalities of his time. A remarkable bright mind, with an overarching comprehension of things, Professor Iacob Iacobovici contributed, in an essential way, to the diversification of surgical education, stimulating the emergence of new specialties. This paper illustrates the contribution of Professor Iacob Iacobovici to the development of Education of Dentistry and Oral and Maxillofacial Surgery in Romania as well as his support for the Romanian Society of Dentistry.
How Not to Lose Face on Facebook, for Professors
Young, Jeffrey R.
2009-01-01
For years college administrators have warned students to watch their step in online social realms, noting that sharing too much could hurt them later on if future employees saw their drunken party pictures or boorish writings. Now that professors and administrators are catching Facebook fever, they should heed their own advice. The author…
The Professor as Intern: Approaches to Teaching Advertising Creativity.
Schamber, Linda
Drawing upon the experiences of a participant in the Visiting Professor Program sponsored by the Advertising Education Foundation of the American Advertising Federation and the American Academy of Advertising, this paper discusses the advantages such programs can have for both the host company and the participant. The first section of the paper…
Directory of Open Access Journals (Sweden)
Benjamin J Sparks
2016-01-01
Full Text Available The colonial endeavor as argued by Aimé Césaire in his Discourse on Colonialism is neither an evangelization, nor a philanthropic enterprise, nor an aid system to combat systems of ignorance, sickness, and tyranny (32. It is a system of power relations based on exploitation and violence without concern for the Other. To borrow Césaire’s term, colonialism is nothing other than chosification ; it makes objects of people, tearing them from their land, home, and families, depriving them of essential, life-providing commodities. Colonization’s social and economic policies disrupted traditional society and the Algerian way of life more so than the physical military conquests had done. Albert Camus, as a Pied-Noir author, provides an outsider’s perspective on the suffering of the Algerian population, declaring, “Pour aujourd’hui, j’arrête ici cette promenade à travers la souffrance et la faim d’un peuple. On aura senti du moins que la misère ici n’est pas une formule ni un thème de méditation. Elle est. Elle crie et elle désespère. Encore une fois, qu’avons-nous fait pour elle et avons-nous le droit de nous détourner d’elle ?” (Camus 40 ‘For now, I must end this survey of the suffering and hunger of an entire population. The reader will have seen, at least, that misery here is not just a word or a theme for meditation. It exists. It cries out in desperation. What have we done about it, and do we have the right to avert our eyes.’ Mohammed Dib’s Algerian trilogy gives flesh to Camus’s statement; misery in these novels shouts and despairs, it shows itself through the characters and narration. This literature shows, as only literature can, the Algerians’ misery, and their desperation; it creates a collective trauma to be shared and understood by many through the act of storytelling. This collective trauma brings out the emotions of the characters and allows the reader to feel empathy toward the plight of the
Looking to the future of organs-on-chips: interview with Professor John Wikswo.
Wikswo, John P
2017-06-01
John Wikswo talks to Francesca Lake, Managing Editor: John is the founding Director of the Vanderbilt Institute for Integrative Biosystems Research and Education (VIIBRE). He is also the Gordon A Cain University Professor; a B learned Professor of Living State Physics; and a Professor of Biomedical Engineering, Molecular Physiology and Biophysics, and Physics. John earned his PhD in physics at Stanford University (CA, USA). After serving as a Research Fellow in Cardiology at Stanford, he joined the Department of Physics and Astronomy at Vanderbilt University (TN, USA), where he went on to make the first measurement of the magnetic field of an isolated nerve. He founded VIIBRE at Vanderbilt in 2001 in order to foster and enhance interdisciplinary research in the biophysical sciences, bioengineering and medicine. VIIBRE efforts have led to the development of devices integral to organ-on-chip research. He is focusing on the neurovascular unit-on-a-chip, heart-on-a-chip, a missing organ microformulator, and microfluidic pumps and valves to control and analyze organs-on-chips.
[Data mining analysis of professor Li Fa-zhi AIDS herpes zoster medical record].
Wang, Dan-Ni; Li, Zhen; Xu, Li-Ran; Guo, Hui-Jun
2013-08-01
Analysis of professor Li Fa-zhi in the treatment of AIDS drug laws of herpes zoster and postherpetic neuralgia, provide reference for the use of Chinese medicine treatment of AIDS, herpes zoster and postherpetic neuralgia. By using the method of analyzing the complex network of Weishi county, Henan in 2007 October to 2011 July during an interview with professor Li Fa-zhi treatment of AIDS of herpes zoster and postherpetic neuralgia patients, patients are input structured clinical information collection system, into the analysis of the data, carries on the research analysis theory of traditional Chinese medicine compatibility system algorithm and complex network analysis the use of complex networks. The use of multi-dimensional query analysis of AIDS drugs, the core of herpes zoster and postherpetic neuralgia treated in this study are Scutellariae Radix, Glucyrrhizae Radix, Carthame Flos, Plantaginis Semen, Trichosamthis Fructus, Angelicae Sinensis Radix, Gentianae Radix; core prescription for Longdan Xiegan decoction and Trichosanthes red liquorice decoction. Professor Li Fa-zhi treatment of AIDS, herpes zoster and postherpetic neuralgia by clearing heat and removing dampness and activating blood circulation to.
Career satisfaction among medical school professors: a case study in Brazil
Directory of Open Access Journals (Sweden)
Nilce Maria da Silva Campos Costa
Full Text Available OBJECTIVE: To investigate the career satisfaction of medical school professors in relation to initial motivation, satisfaction factors, and the desire to remain in the profession. METHODOLOGY: A qualitative methodology was used, based on questionnaires and semi-structured interviews with faculty members at a federal institution of higher education in Brazil. RESULTS: For 42.86% of the sample, teaching began while they were medical students; 80% had chosen teaching either as a vocation or due to influence from families or professors; 20% chose teaching as a professional opportunity. The majority, 57.14%, stated they were happy with teaching, and 51.42% did not plan to leave the career. Factors involved in satisfaction with teaching were: the possibility of remaining up-to-date in the medical profession, the feeling of doing their duty, their contribution to training future doctors, and contact with young people and the university setting. Factors leading to dissatisfaction were pedagogical (33.33%, economic (30.95%, institutional (14.28%, and relational (14.28%. CONCLUSIONS: Subjects expressed a positive attitude towards teaching, and because of their great personal satisfaction with the career, they did not plan to leave it. These findings should shed light on factors that interfere with career satisfaction and help increase those that promote satisfaction, thus improving the productivity and well-being of medical professors.
Irradiation damage in graphite. The works of Professor B.T. Kelly
International Nuclear Information System (INIS)
Marsden, B.J.
1996-01-01
The irradiation damage produced in graphite by energetic neutrons (>100eV) has been extensively studied because of the use of graphite as a moderator in thermal nuclear reactors. In recent times, graphite has been adopted as the protective tiling of the inner wall of experimental fusion systems and property changes due to fusion neutrons have become important. The late Professor B.T. Kelly reviewed the work carried out on the irradiation behaviour of graphite since the 1940s. This work is particularly timely as the scale of research into the effects of fission neutrons has been greatly reduced and many of the active researchers have retired. In recent years, new programmes of work are being formulated for the use of graphite in both the field of high temperature reactor systems and fusion systems. It is therefore important that the knowledge gained by Professor Kelly and other workers is not lost but passed on to future generations of nuclear scientists and engineers. This paper reviews Professor Kelly's last work, it also draws on the experience gained during many long discussions with Brian during the years he worked closely with the present graphite team at AEA Technology. It is hoped to publish his work in full in the near future. (author). 13 refs, 14 figs, 3 tabs
The Life of the Mind: A Tribute to Three Professors.
Yamamoto, Kaoru
2000-01-01
This speech by a distinguished scholar in educational psychology recounts, with appreciation, his educational experiences under three distinguished professors: Toshio Maki, his undergraduate thesis supervisor in Japan; E. Paul Torrance, the prominent educational psychologist; and C. Gilbert Wrenn, his doctoral advisor. (DB)
Péterffy, Arpád
2009-10-04
In the early 1960s, cardiac surgery was founded in Debrecen in the department of thoracic surgery, on Professor József Schnitzler's initiative with the cooperation of the head surgeon Arpád Eisert from Nyíregyháza. During the first 5 years, between 1963-1968, 44 closed cardiac surgical procedures were performed (closure of patent ductus arteriosus, pulmonal and mitral stenosis, pericardectomy). The first open heart surgery was performed by Gábor Kovács visiting professor from Szeged in 1968, after the Pemco heart-lung machine, a donation by Béla Köteles and the Presbyterian Church in Cleveland had arrived. The cardiac surgical activity was led by Professor András Gömöry (1972-1983). During the first 20 years 310 open, 220 closed cardiac surgical, and 612 pacemaker operations were performed. After Professor Schnitzler's retirement in 1983, Arpád Péterffy was appointed the head of the entire department (general and cardio-thoracic surgery). In the last 25 years, 18,000 open, 1500 closed and 8500 pacemaker procedures altogether 32,000 were performed. In 2008 associate professor Tamás Szerafin became the head of the department of cardiac surgery.
Formação continuada de professores da educação básica e o ensino das ciências naturais
Directory of Open Access Journals (Sweden)
Silmara Sartoreto de Oliveira
2007-12-01
Full Text Available Este estudo busca identificar o perfil educacional dos professores do ensino fundamental das séries iniciais. Seu objetivo é fornecer situações reflexivas onde os professores possam discutir sobre sua própria formação. Os dados foram obtidos a partir das respostas de onze professores de escola pública à um questionário. Também foram realizados encontros quinzenais com esses professores que formaram um Grupo de Trabalho, onde estes encontros foram filmados, transcritos e analisados. Durante a pesquisa verificou-se haver problemas pedagógicos no processo de ensino aprendizagem, no método de ensino adotado, no estabelecimento e valorização da relação professor-aluno e na interação entre os alunos quando da construção do conhecimento científico. No final do estudo, entendeu-se que os profissionais pesquisados apresentam falhas em sua formação como professores; não participam de cursos de atualização; e quando enfrentam dificuldades de entendimento em como lidar com algum conteúdo científico com os alunos, os professores pesquisam em livros escolares para sanar suas dúvidas. Os professores também apontaram que os cursos de atualização promovidos pela Diretoria de Ensino são considerados muito teóricos e pouco práticos, e não apresentam nenhuma ligação com o contexto em que os professores estão inseridos.
[Summary of professor YANG Jun's experience for intractable facial paralysis].
Wang, Tao; Li, Zaiyuan; Ge, Tingqiu; Zhang, Man; Yuan, Aihong; Yang, Jun
2017-06-12
Professor YANG Jun 's experience of diagnosis and treatment for intractable facial paralysis is introduced. Professor YANG focuses on the thinking model that combines TCM, western medicine and acupuncture, and adopts the differentiation system that combines disease differentiation, syndrome differentiation and meridian differentiation; he adopts the treatment integrates etiological treatment, overall regulation, symptomatic treatment as well as acupuncture, moxibustion, medication and flash cupping. The acupoints of yangming meridians are mostly selected, and acupoints of governor vessel such as Dazhui (GV 14) and Jinsuo (GV 8) are highly valued. The multiple-needles shallow-penetration-insertion twirling lifting and thrusting technique are mostly adopted to achieve slow and mild acupuncture sensation; in addition, the facial muscles are pulled up with mechanics action. The intensive stimulation with electroacupuncture is recommended at Qianzheng (Extra), Yifeng (TE 17) and Yangbai (GB 14), which is given two or three treatments per week.
The university professor: integration between the personal and professional dimension
Directory of Open Access Journals (Sweden)
José Javier BERMÚDEZ-APONTE
2017-12-01
Full Text Available In the first part of this article, the authors explain how the teaching role is affected by certain social and cultural changes, like the knowledge society emergence, the universities orientation towards marketing, the constant demand and pressure exerted on teachers to publish, the loss of the ethical sense in the academic activity and the disparity of tasks that are being assigned to the university professors. In view of the above, a comprehensive model, compound by two concepts –personal and professional– of a university professor is proposed; in fact, this model incorporates and summarises different contributions regarding this theme. Finally, this article aims to defend the need to understand the teaching role as a vocation, in the broadest sense of the word, a vocation carries the inclination to pursue an aim: the education of those students that teachers have in charge.
Life Stories of Mathematics Teacher Histórias de Vida de Professores de Matemática
Directory of Open Access Journals (Sweden)
Emerson Rolkouski
2008-10-01
Full Text Available The objective of this work is to understand how a Mathematics teacher becomes the teacher of Mathematics that he is. In other words, to understand how the individual becomes, through his life, his relationship with other individuals, this teacher of Mathematics, with these ideas, practices, and resistances. Four Mathematics teachers, with different degree levels, were interviewed according to the methodological parameters of the Oral History. Their testimonies allowed the composition of a scenary wich made it possible to extend the comprehension concerning becoming “the” Mathematics teacher. Their life stories were read with differentiated lenses. Under a sociological focus, based on Norbert Elias and Pierre Bourdieu’s works, under the perspective of psychology, based on Jerome Bruner’s works and finally a last reading denominated scientific-literary, in which the testimony is read through the analogy of literary texts. These readings presented, considerations were made on their possibilities and impossibilities facing the understanding of “how a teacher of Mathematics becomes ‘the’ teacher of Mathematics that he is”. Key Words: Mathematic Education. Oral History. Teachers Formation.O objetivo deste trabalho é compreender como um professor de Matemática torna-se o professor de Matemática que é. Ou seja, compreender como o indivíduo vai se tornando, ao longo de sua vida, de sua relação com outros indivíduos, este professor de Matemática: com estas idéias, práticas, resistências. Quatro professores de Matemática, com diferentes níveis de titulação, foram entrevistados segundo os parâmetros metodológicos da História Oral. Seus depoimentos permitiram a composição de um cenário que possibilitou ampliar as compreensões acerca do tornar-se “o” professor de Matemática. As histórias de vida dos depoentes foram lidas com lentes diferenciadas: sob um enfoque sociológico, fundamentado nos trabalhos de Norbert
Kant as a Professor: Some Lessons for Today's Intellectuals ...
African Journals Online (AJOL)
The thoughts of every great philosopher is measured and represented by the history of his social background. It is indeed, more appropriate particularly in the case of a great philosopher like Immanuel Kant to single out for special recognition the outstanding characteristics of his early life on his career as a professor of ...
Kim, Sang Hyun
2013-12-01
The purpose of this study was to examine the concordance between a checklist's categories of professor recommendation letters and characteristics of the self-introduction letter. Checklists of professor recommendation letters were analyzed and classified into cognitive, social, and affective domains. Simple correlation was performed to determine whether the characteristics of the checklists were concordant with those of the self-introduction letter. The difference in ratings of the checklists by pass or fail grades was analyzed by independent sample t-test. Logistic regression analysis was performed to determine whether a pass or fail grade was influenced by ratings on the checklists. The Cronbach alpha value of the checklists was 0.854. Initiative, as an affective domain, in the professor's recommendation letter was highly ranked among the six checklist categories. Self-directed learning in the self-introduction letter was influenced by a pass or fail grade by logistic regression analysis (pprofessor recommendation letters and the sum of all characteristics in the self-introduction letter.
Professor Dorothy A.E. Garrod: "Small, Dark, and Alive!"
Directory of Open Access Journals (Sweden)
Pamela Jane Smith
1997-05-01
Full Text Available In 1939, Dorothy Garrod became the first woman Professor in either Cambridge or Oxford. Garrod at the time was Director of Studies at Newnham College, Cambridge University and had been in charge of excavations in Gibraltar, Western Judaea, Southern Kurdistan and Mount Carmel for which she is now renowned. Trained by Marett at Oxford and Abbe Henri Breuil in France, she was one of our finest archaeologists. By 1939, Garrod had unearthed the well-preserved skull of 'Abel', a Neanderthal child, in Gibraltar, discovered and named the Natufian culture while excavating Shukba near Jerusalem, directed the long term, large scale excavations at Mount Carmel and traveled with Bruce Howe as her assistant to explore Bacho Kiro in Bulgaria. Once elected Professor, she became instrumental in establishing Archaeology and Anthropology as a full degree course and influential in Cambridge's decision to admit women to full membership in 1948. After retirement, she continued excavating in Lebanon and France. Here, with her close friend Suzanen Cassou de Saint Mathurin, she discovered the superb Magdalenian sculptured frieze at Angles-sur-l'Anglin.
2015-01-01
Cet article retracte l'article "Aspergillose broncho-pulmonaire allergique lors d'un asthme réfractaire: à propos d'un cas clinique. Khalid Lahmadi, Hind El Youssi, Jawad Rochdi, BoughrineNawal, Er-Rami Mohammed. The Pan African Medical Journal. 2015;20:350. (doi:10.11604/pamj.2015.20.350.6572)" PMID:26401219
[Professor LAI Xinsheng's experience of acupuncture combined with medication for epilepsy].
Fang, Yajing; Wu, Peilong; Wang, Yumei; He, Kejie; Zhang, Sujuan; Lai, Xinsheng
2018-04-12
Professor LAI Xinsheng 's experience of acupuncture combined with medication for epilepsy is summarized, which is explained from epilepsy's etiology and pathogenesis, diagnosis and treatment of acupuncture and medication, respectively. Besides, the theoretical foundation and use instruction of acupuncture technique " tong - yuan " for epilepsy are introduced. Professor LAI highly values the adherence to etiology and pathogenesis, pays attention to syndrome differentiation and searches for the primary disease cause. He proposes the wind, phlegm, stasis and deficiency are the pathogenesis of epilepsy, and points out acupuncture could be applied during attack stage and remittent stage, but electroacupuncture should be used with caution. Regulating spirit is the key for treating epilepsy. The combination of acupuncture and medication could regulate the governor vessel and guide qi to the origin, which have significant curative effect.
Professor Dragutin M. Drazic - On the occasion of his 70th birthday
Directory of Open Access Journals (Sweden)
Aleksandar Despic
2001-12-01
Full Text Available Professor Dragutin Drazic was born on May 5, 1930, in Belgrade. His father, Milan Drazic, was a professor at the Faculty of Civil Engineering of the University of Belgrade, while his mother, Zorka, was also a civil engineer working for the City of Belgrade. These facts, as well as the entire intellectual entourage in the Professors Colony in Belgrade, predetermined his orientation to natural sciences and engineering. Thus, after finishing elementary school before WWII and secondary school by 1949, he entered the Faculty of Science and Mathematics (Department of Chemistry of the University of Belgrade. After his first year of study, he changed the school, enlisting in the faculty of Chemical Engineering (Faculty of Technology of the same University. He graduated from the Department of Chemical Technology with the highest grade in 1956. After graduation, he joined the teaching staff of the same school, in the Department of Physical Chemistry and Electrochemistry, in which he spent his entire career, commencing as an assistant lecturer and becoming a full professor. His affinity for science was supported by his wife Vera (b. Kuharic who was in the same profession and also became a university professor in physical chemistry. The family tradition continued with their two sons, Milan and Dusan, who also joined the academic world, becoming capable mathematician and computer scientists. Profesor Drazic taught very successfully a variety of subjects, such as Electrode Kinetics, Corrosion, Electrochemical Double Layer and Adsorption (postgraduate and finally, Physical Chemistry a General Course. At the height of his professional career he was the Head of the Chair and Department of Physical Chemistry and Electrochemistry for several years. In July 1959 he went to the USA, to join the Electrochemistry Laboratory of the University of Pennsylvania in Philadelphia, led by Professor John OMara Bockris, which at the time was the leading
White, Richard T
2014-08-01
To chronicle the creation of the Chair of Psychiatry at the University of Sydney, and the career and legacy, in New South Wales, of the first incumbent, Professor Sir John Macpherson CB MD FRCPE. The creation of the Chair, Macpherson's appointment, and his contributions to psychiatry in Sydney during the 52 months of his tenure, are well documented in contemporaneous sources and demonstrate that he was a very worthy Foundation Professor of Psychiatry at the University of Sydney. There are several possible reasons why Macpherson has been overlooked, including an erroneous statement in The World History of Psychiatry (1975) that William Siegfried Dawson, his successor from 1927 to 1952, was the first Professor of Psychiatry. © The Royal Australian and New Zealand College of Psychiatrists 2014.
Towards an understanding of career progression for female professors of nursing: a small scale study
Joyce, Maria
2012-01-01
The aim of this study was to generate knowledge of career progression for women professors of nursing, an under researched topic, in order to understand how their professional and personal experiences may have influenced their aspirations and opportunities for career success. This qualitative study gave voice to a small group of women professors of nursing through individual narrative semi-structured interviews, a relatively under-used methodology. The findings are anticipated to have currenc...
Professor Oberth and Dr. von Braun at ARS Banquet
1961-01-01
Dr. Wernher von Braun holds the coveted Hermarn Oberth award presented to him by Professor Oberth during the banquet hosted by the Alabama Section of the American Rocket Society (ARS), on October 19, 1961. The Oberth award was given for outstanding technical contributions to the field of astronautics or for the promotion and advancement of astronautical sciences.
Zacher, Hannes; Bal, P. Matthijs
2012-01-01
Recent research has shown that, in general, older professors are rated to have more passive-avoidant leadership styles than younger professors by their research assistants. The current study investigated professors' age-related work concerns and research assistants' favorable age stereotypes as possible explanations for this finding. Data came…
Tabus sexuais entre professores e alunos Sexual taboos among teachers and students
Directory of Open Access Journals (Sweden)
Antônio Zuin
2008-08-01
Full Text Available O poder da sexualidade nas relações entre professores e alunos é tão intenso quanto o esforço feito pelos agentes educacionais em negá-lo. O termo tabu representa a exata designação do que tal terminologia suscita: algo misterioso e, principalmente, proibido. De fato, a questão sexual entre professores e alunos concerne a uma esfera tão proibitiva que sequer é mencionada, haja vista a escassez de pesquisas que versam a esse respeito. Daí o objetivo deste artigo, ou seja, analisar a ambivalência dos sentimentos de amor e de ódio que se objetivam na sexualidade existente entre professores e alunos.The power of sexuality in teacher-student relationships is as intense as the effort made by educational institutions to deny it. The term "taboo"represents the exact designation of what such terminology means: something mysterious and mainly forbidden. In fact, the sexual issue among teachers and students concerns such a forbidding sphere that it is hardly mentioned, which explains the little research that has been carried out in this field. Thus, this paper is aimed at analyzing the ambivalence of feelings of love and hate found in the teacher-student sexuality.
[Professor ZHAO Jiping's meridian diagnosis and treatment for primary dysmenorrhea].
Tan, Cheng; Zhang, Chang; Zhang, Jiajia; Wang, Jun
2016-03-01
For the treatment of primary dysmenorrhea, professor ZHAO Jiping focuses on meridian diagnosis and inspection, and uses pressing methods to locate the response points along the meridian, including acupoints and aishi points. During the stage of attack, it is essential to press along the spleen meridian, mainly Sanyinjiao (SP 6), Diji (SP 8) and Yinlingquan (SP 9); during the stage of remission, it is essential to press along the bladder meridian and stomach meridian, mainly Ganshu (BL 18), Pishu (BL 20), Weishu (BL 21), Shenshu (BL 23) and Zusanli (ST 36). The differences between deficiency syndrome and excess syndrome lead to the different feelings of doctors and patients. Combined with the results of meridian diagnosis and inspection, the aim of treatment can be achieved by different acupuncture methods. Professor ZHAO pays attention to the treatment of accompanied symptoms and timing of treatment, since the relief of accompanied syndromes and selection of timing are keys to relieving patient's pain.
Fernanda de Assis Oliveira
2005-01-01
Esta pesquisa teve como objetivo investigar as concepções que fundamentam o uso de materiais didáticos pelos professores de música em suas práticas pedagógico-musicais. Mais especificamente buscou identificar o que os professores consideram materiais didáticos, mapear os tipos de materiais didáticos utilizados pelos professores de música, identificar os critérios que fundamentam a seleção dos materiais didáticos, mapear o acesso aos materiais didáticos, analisar a opinião dos professores sobr...
Directory of Open Access Journals (Sweden)
Osvaldo Costa Moreira
2011-09-01
Full Text Available A hipertensão arterial é uma das mais importantes causas modificáveis de morbi-mortalidade cardiovascular precoce na população adulta mundial, além de ser fator de risco independente para doenças cardiovasculares. Assim objetivou-se verificar a associação entre indicadores de risco cardiovascular e hipertensão arterial em professores universitários. Foram avaliados 145 professores da Universidade Federal de Viçosa (UFV, no ano de 2009, analisando-se as variáveis: sexo, idade, índice de massa corporal (IMC, relação cintura/quadril (RCQ, circunferência abdominal (CA, percentual de gordura (%G, colesterol total (CT, triacilglicerol (TG, glicose, pressão arterial sistólica (PAS e diastólica (PAD de repouso e consumo máximo de oxigênio (VO2máx. Utilizou-se o teste ANOVA one way para comparação entre indivíduos normotensos e pré-hipertensos e hipertensos. Calculou-se a razão de chances de desenvolvimento de quadros de PA elevada entre os indivíduos que apresentavam níveis indicativos de risco cardiovascular. Todos os tratamentos possuíram nível de significância de p Hypertension is one of the most important modifiable causes of precocious cardiovascular morbid-mortality in the adult population worldwide, and it's an independent risk factor for cardiovascular disease. Thus we aimed to investigate the association between cardiovascular risk and blood pressure on universities professors. 145 professors from Universidade Federal de Viçosa (UFV were evaluated, in 2009, analyzing the variables: gender, age, body mass index (BMI, waist / hip ratio (WHR, abdominal circumference (AC, percent body fat (% BF, total cholesterol (TC, triglyceride (TG, glucose, systolic blood pressure (SBP and diastolic (DBP at rest and maximal oxygen uptake (VO2max. We used ANOVA one way test for comparison between normotensive and prehypertensive and hypertensive individuals. It was calculated the odds ratio of high BP expansion among individuals
Directory of Open Access Journals (Sweden)
Giovanna Badia
2014-03-01
Full Text Available Objective – The research project examined university faculty’s publications in order to find professors with previous data experiences. The professors could then be approached with an offer of the library’s data services. Design – Bibliographic study. Setting – Department of Crop Sciences in the College of Agricultural, Consumer, and Environmental Sciences at the University of Illinois at Urbana-Champaign. Subjects – A total of 62 assistant, associate, and full professors. Methods – The author searched Web of Science and faculty web pages to find each of the subjects’ two most recent research or review articles. Altogether, 124 articles were read to check whether data sources were used and shared. Data sources were defined as sources other than traditional citations to literature for information or ideas, such as data repositories, supplementary files, and weather stations. Data sharing was defined as publicly sharing data beyond that published in the journal article, such as providing supplementary files with the article or submitting data sets to a disciplinary repository (p. 205. Main Results – Thirty of the 124 articles, which were written by 20 different professors, referred to additional data that was made openly accessible. The analysis of the articles uncovered a variety of data experiences, such as faculty who utilized repository data, published supplementary files, submitted their own data to repositories, or posted data on their university’s website. These 20 faculty members were contacted and asked for a meeting “to discuss their data sharing thoughts and experiences and to ask whether they [saw] a role for the library in facilitating data sharing” (p. 206. The author received a positive response from seven of the faculty members and had a successful meeting with each of them. Conclusion – A bibliographic study can be employed to select which professors to target for data services. While this method is time
What Works Clearinghouse, 2014
2014-01-01
The study reviewed here examined whether taking a course with a tenure track professor versus a non-tenure track professor for first-term freshman-level courses (e.g., introductory economics) had an impact on students' future enrollment and performance in classes in the same subject. Data from 15,662 students who entered Northwestern University,…
Directory of Open Access Journals (Sweden)
Rae Seong Hong
2017-02-01
Full Text Available Humanities and social sciences studies in Korea have remarkably low rates of co-authorship between professors and students. We chose a bibliometrics-based approach to characterize changes in the ratio of joint authorship between professors and students. Articles classified in the humanities and social sciences sectors that were published in journals registered in the Korean Citation Index during 2 phases over a 10-year period—2004 to 2006 (phase 1 and 2011 to 2013 (phase 2—were used as the main source for the analysis. The study results can be summarized as follows: first, the overall number of co-authored articles drastically increased from phase 1 to phase 2; the percentage of co-authorship articles increased from 34.8% to 47.7%, and the percentage of co-authorship between students and professors rose from 9.9% to 20.7%. This trend was particularly noticeable in the social sciences, such as accounting, social welfare, and economics/business administration. Second, papers written by scholars from Seoul National University, Yonsei University, and Korea University were often published in high-impact factor journals. Among those articles, the rate of professor-student co-authorship increased by 21.6% for 7 years. Third, the increase in professor-student co-authored articles published in high- impact factor journals was even sharper. These findings indicate that perceptions of professor-student co-authorship have changed in the humanities and social sciences. In the near future, positive perceptions toward joint research and joint authorship between professors and students are expected to become more widespread.
Percepção e conhecimento de futuros professores sobre seus processos de aprendizagem
Cunha, Neide de Brito; Boruchovitch, Evely
2016-01-01
Resumo Este trabalho objetivou levantar os conhecimentos que os futuros professores tinham a respeito de suas estratégias de aprendizagem. Participaram 62 estudantes, de cursos de Pedagogia e Matemática, de uma universidade pública e outra particular de dois estados brasileiros. Os dados foram coletados por meio do Protocolo de Ativação da Metacognição e da Autorreflexão sobre a Aprendizagem do Futuro Professor e examinados pela análise de conteúdo. Os resultados mostram não só que os estudan...
O papel do psicólogo escolar: Concepções de professores e gestores
Pereira-Silva, Nara Liana; Andrade, Jaqueline Ferreira Condé de Melo; Crolman, Sarah Rezende; Mejía, Cristina Fuentes
2017-01-01
Resumo Historicamente, a atuação do psicólogo no contexto escolar tem sido mais caracterizada pelo modelo clínico do que por modelos mais sistêmicos e institucionais. O presente estudo objetivou descrever as concepções de professores e gestores sobre o papel do psicólogo escolar. Participaram desta investigação 38 membros da equipe administrativo-pedagógica e professores de uma escola particular, os quais foram entrevistados na própria escola, tendo sido construídas categorias de análise. Os ...
Estilos intelectuais e estratégias de aprendizagem: percepção de professores do ensino fundamental
Directory of Open Access Journals (Sweden)
Francislaine Flâmia Inácio
Full Text Available Resumo Os estilos intelectuais e as estratégias de aprendizagem podem ser eficazes na melhora do desempenho de alunos que apresentam dificuldades para aprender. O objetivo da pesquisa foi averiguar a percepção dos professores acerca dos estilos intelectuais e das estratégias de aprendizagem em alunos do Ensino Fundamental com diagnóstico de Dislexia e TDAH e sem dificuldade escolar. Participaram 23 professores de escolas públicas e foi utilizado um questionário para a coleta de dados. Os resultados indicaram que os professores relataram benefícios em conhecer os estilos e identificaram o uso de estratégias por parte dos alunos. A maioria dos professores não conhecia termos como estratégias de aprendizagem e estilos intelectuais, por isso as respostas foram dadas de acordo com a sua prática de ensino. O estudo buscou entender e discutir alguns aspectos que envolvem a aprendizagem e levar contribuições para o sistema educacional na condição de melhorias para a qualidade de ensino.
Labrude, Pierre
2002-01-01
At the beginning of the XXth century, professor Brunotte, of the school of pharmacy of Nancy, and the section vosgienne de Nancy du Club alpin français, undertook the creation of an alpine garden, in the Vosges, near the col de la Schlucht and le Hohneck, near also with the frontier with Germany. After the death of professor Brunotte, in 1910, the garden was given to the University of Nancy and completed until 1914, but the 1st World War destroyed it completely and it was impossible to recreate it. 1966 was the year of the creation of a new garden, not far from Monthabey, along the route des Crêtes, with a monument devoted to Monthabey garden and its promoter. The paper describes the creation of the first garden, the personality and career of professor Brunotte, its garden after his death and after the war, the precursors in botany of the Vosges Kirschleger and Bleicher, the new garden at Haut-Chietlet, finally the memories of professor Brunotte.
Professor V. Weisskopf, CERN Director General (1961-1965)
1962-01-01
Well known theoretical physicist Victor Weisskopf has died aged 93. Born in Austria, he later worked with Schrodinger in Berlin before emigrating to the US in 1937, where he joined the Manhattan project in 1944, and was witness to the Trinity Test in July 1945. In 1946 he became professor of physics at MIT. He took leave of absence to be Director General of CERN, the European Organization for Nuclear Physics, from 1961-1965.
Inglês instrumental e as estratégias de leitura: o papel do professor mediador
Directory of Open Access Journals (Sweden)
Jane Pinto Bandeira de Melo Lima
2013-06-01
Full Text Available No mundo globalizado no qual se vive, a aprendizagem da língua inglesa tornou-se compulsória para aqueles que almejam um lugar no mercado de trabalho ultracapita-lista do século XXI. O que se verifica, portanto, é que a língua inglesa vem despertando, cada vez mais, o interesse das pessoas que desejam manter-se atualizadas com o que está acontecendo no mundo, com as questões culturalmente relevantes da sociedade atual. Sendo assim, a língua inglesa, reconhecida como língua da globalização, é pré-requisito para cada cidadão brasileiro desenvolver-se intelectual e socialmente, contribuindo, em consequência, para o desenvolvimento da sociedade. O professor de ESP (Inglês para Propósitos Específicos assume funções que vão além da sala de aula. Ele tem, então, cinco papéis principais: professor, criador de cursos e provedor de materiais, colaborador, pesquisador e avaliador. A hipótese que orientou esta pesquisa foi que todo professor universitário, utilizando as estratégias de leitura, está apto a capacitar seu aluno a ler, compreender e interpretar um texto acadêmico em língua inglesa em um curto espaço de tempo. O objetivo desta pesquisa é analisar o papel do professor como mediador nesse contexto. Os autores que nortearam a pesquisa são Dudley-Evans e St. John (1998, Solé (2008, Holmes (1981, dentre outros. Com base nas afirmações dos autores destacados e nos resultados obtidos, constatou-se que a principal ferramenta é o professor quando este age como mediador no processo ensino/aprendizagem.
Understanding the Motivation and Transformation of White Culturally Responsive Professors
Jenkins, China; Alfred, Mary
2018-01-01
The purpose of this study was to examine the motivation for White professors in higher education to become culturally inclusive in their teaching practices and the transformational experiences that created this motivation and shaped their development. The findings revealed personal convictions that centred on moral obligations towards teaching was…
Adoecimento mental em professores brasileiros: revisão sistemática da literatura
Directory of Open Access Journals (Sweden)
Liciane Diehl
2016-10-01
Full Text Available A saúde do professor é um tema que adquire crescente relevância científica, pois tal profissão é considerada como uma das mais estressantes. A presente revisão sistemática da literatura analisou produções científicas nacionais publicadas entre 2010 e 2015, com vista a identificar principais sintomas e/ou adoecimentos psíquicos entre professores brasileiros. Recorreu-se às bases LILACS, SciELO, Index Psicologia, Educ@ e PePSIC. Os critérios de elegibilidade e análise seguiram as diretrizes do PRISMA. Dos 97 artigos encontrados, 15 foram analisados, os quais indicaram interesse multidisciplinar pela temática, predominância de estudos descritivos e correlacionais e recorrência de investigações em escolas públicas e de Ensino Fundamental. O principal adoecimento mental investigado é a síndrome de burnout e os sintomas prevalentes foram o estresse e a ansiedade. Espera-se que esses resultados direcionem novas pesquisas e estimulem o planejamento de intervenções eficazes voltadas para a saúde mental de professores.
Fatores de risco e emocionais na voz de professores com e sem queixas vocais
Directory of Open Access Journals (Sweden)
Denise Batista da Costa
2013-08-01
Full Text Available OBJETIVO: analisar a interferência dos fatores de riscos e emocionais na voz de professores com e sem queixa. MÉTODO: a amostra foi composta de 44 professores. Utilizou-se uma ficha com dados pessoais e profissionais, três questionários referentes aos aspectos vocais e dois questionários para dados relacionados à emoção, sobretudo ansiedade, além da coleta de voz para análise perceptivo-auditiva. Os grupos foram divididos a partir do número de sintomas relatados, estabelecendo um número de 22 voluntários no grupo de Professores Sem Queixa (PSQ e 22 no grupo Professores Com Queixas (PCQ, sendo deste grupo, os indivíduos que relataram mais de três sintomas vocais. Os dados foram analisados estatisticamente. RESULTADOS: a média do número de sintomas descritos no QSSV foi de 5,7 (±2,8 para os PCQ e de 0,8 (±0,9 para os PSQ. Os PSQ referiram uma melhor autoavaliação vocal (p= 0,01 e os PCQ afirmaram possuir um maior comprometimento em sua voz (p= 0,001. O grupo PSQ obteve os maiores valores nos escores do QVV-Físico (p=0,0007 e QVV-Total (p= 0,0006. Os PCQ obtiveram maiores valores no IDV-Total (p=0,0003 e IDV-Orgânico (p=0,0006, e um maior comprometimento emocional, com SRQ de 5,7 (±3,9 e IDATE 42,5 (±12,7. A partir da avaliação perceptivo-auditiva, os PCQ apresentaram um desvio vocal moderado com presença de rugosidade, soprosidade e tensão na voz, enquanto os PSQ evidenciam um desvio leve em todos os parâmetros. CONCLUSÃO: os professores com queixas vocais estão expostos a mais fatores de riscos, além de relatarem mais sintomas e comprometimento vocais, bem como emocionais.
Ingrid Isis Del Grego Herrmann
2012-01-01
O ensino de Português como Língua Estrangeira (PLE), em nosso país, é, atualmente, uma atividade de natureza acidental, com esparsas oportunidades de formação específica e, em geral, realizada por professores de outras línguas estrangeiras, nativos de português. Propomo-nos, neste estudo, observar essa conjuntura, tomando como hipótese o fato de que o professor ensinar outras línguas e ser nativo não se constitui como uma garantia de conforto para o ensino de português para estrangeiros. A pa...
O fracasso escolar no discurso do professor
Piccirilli, Manoela de Souza Silva
2014-01-01
O fracasso escolar tem sido repetidamente abordado em pesquisas de diversas naturezas que buscam diferentes razões para sua ocorrência. Essa dissertação não pretende elaborar mais uma suposição do que venha a ser o fracasso escolar, mas analisar os sentidos deste no discurso de alguns professores de educação básica. Trata-se de um estudo qualitativo realizado sob a ótica da teoria-metodológica da Análise de Discurso de linha francesa a partir de Michel Pêcheux. O procedimento ...
Lew, Kristen; Fukawa-Connelly, Timothy Patrick; Mejía-Ramos , Juan Pablo; Weber, Keith
2016-01-01
We describe a case study in which we investigate the effectiveness of a lecture in advanced mathematics. We first videorecorded a lecture delivered by an experienced professor who had a reputation for being an outstanding instructor. Using video recall, we then interviewed the professor to determine the ideas that he intended to convey and how he…
Virginia Tech Wildlife Professor Helping To Save Florida Panther
Davis, Lynn
2003-01-01
With few Florida panthers now in existence, Mike Vaughan, Virginia Tech professor of wildlife and sciences in the College of Natural Resources, has been appointed to serve on the Florida Panther Scientific Review Team (SRT). Vaughan and other SRT members have made several trips to Naples, Fla., to interview state and federal biologists directly involved with the recovery of the Florida panther.
(RE)PENSANDO A FORMAÇÃO DE PROFESSORES EM EDUCAÇÃO AMBIENTAL
Oliveira, Maria Aparecida Nunes de
2015-01-01
A formação de professores em Educação Ambiental numa perspectiva crítica é um dos instrumentos imprescindíveis para a efetivação da dimensão ambiental na escola. Foi realizada uma investigação tendo como base uma abordagem metodológica qualitativa, procurando analisar a formação dos professores em Educação Ambiental e como se dá a sua atuação na sala de aula no que se refere ao tratamento com as questões ambientais. A pesquisa teve como objetivo identificar as dificuldades enfrentadas por um ...
Dedication to Professor Hazel Prichard BSc, PhD, MBA (1954-2017)
Hall, Ian; Maier, Wolfgang; Barnes, Stephen J.
2017-11-01
The final section of this special issue of GCA on highly siderophile elements is dedicated to Professor Hazel Prichard (see Fig. 1) who sadly passed away in Cardiff on 1st January, 2017, after a brave battle with cancer.
Directory of Open Access Journals (Sweden)
Nilce Maria da Silva Campos Costa
2009-02-01
Full Text Available Apesar dos novos papéis preconizados pelas Diretrizes Curriculares Nacionais aos profissionais de Nutrição, pouca atenção tem sido dada ao desenvolvimento docente para atuação nos novos cenários. O objetivo deste ensaio é o de discutir um dos desafios à formação do nutricionista, a prática docente e a formação pedagógica do professor da área da saúde, para pensar formas de oportunizar um ensino de melhor qualidade, com base em autores que discutem a docência universitária. Identificam-se como causas da resistência docente às mudanças, a desvalorização das atividades de ensino e a supremacia das atividades de pesquisa nas universidades. O estudo permitiu sugerir a necessidade de reflexão por parte dos professores de Nutrição sobre as questões da docência universitária e sobre o desenvolvimento docente em uma perspectiva crítica e reflexiva, que possa ancorar mudanças pedagógicas necessárias à formação de nutricionistas.Despite the new roles called in for the National Curricular Guidelines for teachers in nutrition courses, little attention has been paid to the professional development of the nutrition professional acting as a teacher. Based on the work of authors who discuss university teaching, this essay discusses some of the challenges involved in training nutritionists, such as teaching practice and teacher training for the professor in the health field, with the goal of providing higher-quality teaching. The devaluation of teaching and the supremacy of research at universities have been identified as the causes of teachers' resistance to change. This study reveals the need for professors of nutrition to reflect on the questions of university teaching and teacher development from a critical and reflective perspective which can anchor the pedagogical changes needed to train the nutritionist.
Professor da escola básica representado na escrita reflexiva acadêmica do aluno mestre
Directory of Open Access Journals (Sweden)
Wagner Rodrigues SILVA
2016-04-01
Full Text Available RESUMO Neste artigo, investigamos algumas representações de professores brasileiros da escola básica na escrita reflexiva profissional, aqui identificada como uma escrita acadêmica diferenciada, produzida por alunos-mestre como trabalho escrito final durante o estágio supervisionado obrigatório da Licenciatura Plena em Língua Portuguesa. São focalizadas nesta pesquisa as orações em que os professores da escola básica são construídos como sujeito gramatical da ação expressa. O referencial metodológico assumido nesta pesquisa é informado pela abordagem transdisciplinar da Linguística Aplicada, caracterizada pelo uso de categorias teórico-metodológicas originárias de diferentes campos do conhecimento científico em função da construção do objeto de investigação. Os professores da escola básica são representados como principais atores sociais responsáveis pelos processos identificados, o que pode demandar uma complexificação do ponto de vista do aluno-mestre sobre o espaço do estágio obrigatório. Os resultados apontam para uma demanda de usos mais produtivos da escrita reflexiva profissional na formação inicial do professor.
Hospitality and tourism management professor receives Fulbright to teach in India
Ho, Sookhan
2009-01-01
Mahmood A. Khan, professor of hospitality and tourism management at Virginia Tech's Pamplin College of Business, has been awarded a Fulbright-Nehru Scholar grant to teach at the Indian Institute of Technology in New Delhi during the 2009-10 academic year.
"Dear Professor: This Is What I Want You to Know."
Workman, Brooke
1986-01-01
Describes high school students' letters written to help their teacher interpret youth culture to college professors at an upcoming seminar. Essays reflected four themes: (1) a search for family, (2) identity problems and loneliness, (3) living with rapid change, and (4) fear of failure, especially in college. (2 references) (MLH)
The benefits of being economics professor A (and not Z)
van Praag, C.M.; van Praag, B.M.S.
2007-01-01
Alphabetic name ordering on multi-authored academic papers, which is the convention in the economics discipline and various other disciplines, is to the advantage of people whose last name initials are placed early in the alphabet. As it turns out, Professor A, who has been a first author more often
Instal·lació i configuració d'aules d'informàtica a un institut
González Canet, Alicia
2013-01-01
Instal·lació i configuració d'aules d'informàtica a un institut amb Ubuntu 12.04 i gestió de la xarxa amb MikroTik. Instalación y configuración de aulas de informática en un instituto con Ubuntu 12.04 y gestión de la red con MikroTik.
[Surgical intervention against overpopulation: Professor Weinhold's foreskin infibulation].
Mörgeli, C
1993-01-01
One of the most bizarre and forgotten suggestions to have developed from the discussion of pauperism in the 19th century was the infibulation of the impoverished men. A communication in 1827 from the Halle professor of surgery, Carl August Weinhold (1782-1829), raised indignation and caused ironic as well as angry reactions. Despite such a heated response, Weinhold's proposed method of population control soon fell into oblivion, a fate considered by this contemporaries as "highly desirable".
Chen, Dan; Xie, Qiange; Huang, Bing-Lin
2014-01-01
Professor XIE Qiang's Tihu Guanding needling method, a kind of acupuncture method which takes acupoints of the Conception Vessel as the primary and acupoints of the Governor Vessel as the secondary. Acupoints Lianquan (CV 23), Tiantu (CV 22), Qihai (CV 6), Zhongwan (CV 12), Baihui (GV 20) and Dazhui (GV 14) are adopted as the basic ones. Other points can be added according to various symptoms, for instance, Yingxiang (LI 20) and Yintang (GV 29) for rhinopathy, Tinggong (SI 19) and Yifeng (TE 17) for otopathy, Yan'an (Professor XIE's experience) and Shanglianquan (EX-HN 21) for pharyngopathy and Kaiyin 1 (Professor XIE's experience) and Kaiyin 2 (Professor XIE's experience) for laryngopathy. During the needle retention, rotation manipulation should be done every 5 min at Lianquan (CV 23). And the patient should be told to put the tip of one's tongue at the the palate as well as to do deep breathing to communicate the Conception Vessel and the Governor Vessel. Moxibustion is adopted at Yongquan (KI 1) to induce the up floating fire to mingmen (where the primary yang is stored). The therapeutic effect on treatment of persistent otorhinolaryngologic diseases with the above mentioned method is approve to be good.
Digitaalse arengu eestvedaja Rootsis - digitšempion professor Jan Gulliksen / Tauno Otto
Otto, Tauno, 1967-
2016-01-01
Tallinna tehnikaülikoolis pidas 22. aprillil avaliku loengu Rootsi kuningliku tehnikaülikooli dekaan, professor Jan Gulliksen. Loengu teema oli, kuidas Rootsi edendab digitaliseerimist nii hariduses kui ka tööstuses
Teaching the College "Nones": Christian Privilege and the Religion Professor
Riswold, Caryn D.
2015-01-01
Working with undergraduate students invites teachers into relationship and conversation with young people at a time when they are emerging as adults and forming their identities. Faith is one area of identity formation often attended to by scholars, college professors, and their institutions. But within that, little attention has been paid to…
Visiting students work with professors to research water resources management issues
Davis, Lynn
2009-01-01
Undergraduate students visiting from universities across the continent, as well as one from Virginia Tech, are working with professors at Virginia Tech on individual research projects in a 10-week summer program that addresses issues related to sustainable management of water resources.
Reginald Crundall Punnett: first Arthur Balfour Professor of Genetics, Cambridge, 1912.
Edwards, A W F
2012-09-01
R. C. Punnett, the codiscoverer of linkage with W. Bateson in 1904, had the good fortune to be invited to be the first Arthur Balfour Professor of Genetics at Cambridge University, United Kingdom, in 1912 when Bateson, for whom it had been intended, declined to leave his new appointment as first Director of the John Innes Horticultural Institute. We here celebrate the centenary of the first professorship dedicated to genetics, outlining Punnett's career and his scientific contributions, with special reference to the discovery of "partial coupling" in the sweet pea (later "linkage") and to the diagram known as Punnett's square. His seeming reluctance as coauthor with Bateson to promote the reduplication hypothesis to explain the statistical evidence for linkage is stressed, as is his relationship with his successor as Arthur Balfour Professor, R. A. Fisher. The background to the establishment of the Professorship is also described.
Geometry and analysis on manifolds in memory of professor Shoshichi Kobayashi
Mabuchi, Toshiki; Maeda, Yoshiaki; Noguchi, Junjiro; Weinstein, Alan
2015-01-01
This volume is dedicated to the memory of Shoshichi Kobayashi, and gathers contributions from distinguished researchers working on topics close to his research areas. The book is organized into three parts, with the first part presenting an overview of Professor Shoshichi Kobayashi’s career. This is followed by two expository course lectures (the second part) on recent topics in extremal Kähler metrics and value distribution theory, which will be helpful for graduate students in mathematics interested in new topics in complex geometry and complex analysis. Lastly, the third part of the volume collects authoritative research papers on differential geometry and complex analysis. Professor Shoshichi Kobayashi was a recognized international leader in the areas of differential and complex geometry. He contributed crucial ideas that are still considered fundamental in these fields. The book will be of interest to researchers in the fields of differential geometry, complex geometry, and several complex variables ...
From Nutty Professor to Buddy Love--Personality types in modern science.
Charlton, Bruce G
2007-01-01
People often suggest that scientists should have a specific personality type, usually conscientious and self-critical. But this is a mistake. Science as a social system needs to be conscientious and self-critical, but scientists as people do not necessarily have to conform to that stereotype. Since science works by a process of selection, it makes sense to have a wide range of personalities in science. It takes all types. However, the selection pressures within science have changed over recent decades. In the past, a successful scientist often resembled the white-coated, bespectacled and introverted Nutty Professor in Jerry Lewis's movie of that name. But the modern science superstar is more like the Nutty Professor's alter ego, nightclub singer 'Buddy Love': a sharp-suited, good-looking and charismatic charmer. While Nutty was dull but impartial, Buddy is compelling but self-seeking. Our attitude towards public scientific pronouncements should be adjusted accordingly.
Directory of Open Access Journals (Sweden)
Ribeiro F
2011-10-01
Full Text Available Fabiana Ribeiro1, Carmen S Grubert Campbell1, Gisele Mendes1, Gisela Arsa1,3, Sérgio R Moreira2, Francisco M da Silva1, Jonato Prestes1, Rafael da Costa Sotero1, Herbert Gustavo Simões1 1Graduate Program on Physical Education and Health, Catholic University of Brasilia, Brasilia; 2Federal University of Vale do São Francisco, Petrolina, 3Graduate Program on Physical Education, Nine of July University, São Paulo SP, Brazil Background: University professors are subjected to psychological stress that contributes to blood pressure (BP reactivity and development of hypertension. The purpose of this study was to investigate the effects of exercise on BP in university professors during teaching and sleeping hours. Methods: Twelve normotensive professors (42.2 ± 10.8 years, 74.2 ± 11.2 kg, 172.8 ± 10.4 cm, 20.1% ± 6.7% body fat randomly underwent control (CONT and exercise (EX30 sessions before initiating their daily activities. EX30 consisted of 30 minutes of cycling at 80%–85% of heart rate reserve. Ambulatory BP was monitored for 24 hours following both sessions. Results: BP increased in comparison with pre-session resting values during teaching after CONT (P < 0.05 but not after EX30. Systolic, diastolic, and mean arterial BP showed a more pronounced nocturnal dip following EX30 (approximately -14.7, -12.7, and -9.6 mmHg, respectively when compared with CONT (approximately -6, -5 and -3 mmHg. Conclusion: Exercise induced a BP reduction in university professors, with the main effects being observed during subsequent teaching and sleeping hours. Keywords: post-exercise blood pressure, aerobic exercise, activities of daily living
Ocorrência de disfonia em professores de escolas públicas da rede municipal de ensino de Criciúma-SC
Lemos, Simone; Rumel, Davi
2005-01-01
Este estudo tem por objetivo a caracterização da ocorrência de disfonia em 236 professores da rede municipal de ensino de Criciúma e a determinação dos fatores a ela associados em decorrência do exercício profissional. Os professores responderam a um questionário sobre as características do local de trabalho, os hábitos vocais, a autopercepção da disfonia, a procura por especialista, o uso de medicamentos e os cuidados com a voz. Os professores que mencionaram três ou mais sintomas vocais pas...
Promotion rates for assistant and associate professors in obstetrics and gynecology.
Rayburn, William F; Schrader, Ronald M; Fullilove, Anne M; Rutledge, Teresa L; Phelan, Sharon T; Gener, Yolanda
2012-05-01
To estimate promotion rates of physician faculty members in obstetrics and gynecology during the past 30 years Data were collected annually by the Association of American Medical Colleges from every school between 1980 and 2009 for first-time assistant and associate professors to determine whether and when they were promoted. Data for full-time physician faculty were aggregated by decade (1980-1989, 1990-1999, 2000-2009). Faculty were included if they remained in academia for 10 years after beginning in rank. Data were analyzed by constructing estimated promotion curves and extracting 6-year and 10-year promotion rates. The 10-year promotion rates (adjusted for attrition) declined significantly for assistant professors from 35% in 1980-1989 to 32% in 1990-1999 to 26% in 2000-2009 (P<.001), and for associate professors from 37% to 32% to 26%, respectively (P<.005). These declines most likely resulted from changes in faculty composition. The most recent 15 years saw a steady increase in the proportion of entry-level faculty who were women (now 2:1) and primarily on the nontenure track. The increasing number of faculty in general obstetrics and gynecology had lower promotion probabilities than those in the subspecialties (odds ratio 0.16; P<.001). Female faculty on the nontenure track had lower promotion rates than males on the nontenure track, males on the tenure track, and females on the tenure track (odds ratio 0.8 or less; P<.01). A decline in promotion rates during the past 30 years may be attributable to changes in faculty composition. II.
Remembrance of professor Tadeusz Marciniak - Lviv tradition in Wrocław.
Kacała, Ryszard R; Woźniak, Sławomir; Porwolik, Michał; Dąbrowski, Paweł; Domagała, Zygmunt; Kacała, Arkadiusz; Gworys, Bohdan
2015-01-01
After the seizure of Lviv by the Soviets, in the years 1944-1946, Tadeusz Marciniak worked in the Descriptive Anatomy Department in the State-Medical Institute of Lviv and also performed the function of the dean of the Medical Faculty. On receiving a proposal to assume the Chair of the Anatomy Department in Wrocław, he made the decision to leave Lviv. By July 2nd, 1946, prof. Tadeusz Marciniak had taken over the duties of full professor of the Descriptive Anatomy Department of the Medical Faculty of the University and the Technical College of Wrocław. On taking his job in Wrocław, prof. Marciniak undertook attempts to restore the worn out parts of the Anatomy Department building. Due to the lack of Polish manuals, he also took to the preparation of scripts for medical students. Professor Marciniak was a member of the Wrocław Section of the Polish Anthropological Association and a regular member of the Wroclaw Association of Science. His main scientific interests referred to the morphogenesis of the central nervous system and urinary system. He concentrated on circulatory system and muscular system tetralogies. Professor Marciniak also actively participated in administrative work at the university. In the years 1947-1948, he held the office of associate dean of the Medical Faculty, and till 1950 was a member of the Senate of the University and Technical College of Wrocław. In the years 1959-1962, he was a vice rector of the Medical University of Wrocław.
Crenças de autoeficácia do professor coordenador pedagógico: relevância para formação continuada
VIEIRA, Andréia Maria de Souza
2016-01-01
Esta dissertação estrutura-se em três estudos que consistem na investigação e análise das crenças de autoeficácia percebida do Professor Coordenador Pedagógico em sua atuação na formação continuada de professores na escola. O primeiro estudo objetivou realizar um levantamento bibliográfico sobre o Professor Coordenador Pedagógico no período de 2000 a 2014, a partir da coleta de trabalhos empíricos em base de dados. As publicações compreenderam três temáticas que envolvem o Professor Coordenad...
Observations on Professor Hayek's Plan
Directory of Open Access Journals (Sweden)
Ludwig von Mises
2009-01-01
Full Text Available This memorandum was written at the request of Henry Hazlitt to provide Mises’s comments on and concerns about F.A. Hayek’s initial proposals for what became the Mont Pèlerin Society. Mises stresses that those who favor liberty and freedom and oppose totalitarianism must also oppose interventionism. The memo argues that those who fought and lost against the rising tide of totalitarianism at the turn of the 20th Century lost their battles because they settled for middle-of-the-road policies that conceded considerable ground to the socialists. The weak point in Professor Hayek’s plan is that it relies upon the cooperation of many men who are today’s middle-of-the-roaders. As interventionists, they may not be the hoped-for intellectual pioneers to inspire people to build a freer world.
Professor Camillo Negro's Neuropathological Films.
Chiò, Adriano; Gianetto, Claudia; Dagna, Stella
2016-01-01
Camillo Negro, Professor in Neurology at the University of Torino, was a pioneer of scientific film. From 1906 to 1908, with the help of his assistant Giuseppe Roasenda and in collaboration with Roberto Omegna, one of the most experienced cinematographers in Italy, he filmed some of his patients for scientific and educational purposes. During the war years, he continued his scientific film project at the Military Hospital in Torino, filming shell-shocked soldiers. In autumn 2011, the Museo Nazionale del Cinema, in partnership with the Faculty of Neurosciences of the University of Torino, presented a new critical edition of the neuropathological films directed by Negro. The Museum's collection also includes 16 mm footage probably filmed in 1930 by Doctor Fedele Negro, Camillo's son. One of these films is devoted to celebrating the effects of the so-called "Bulgarian cure" on Parkinson's disease.
Directory of Open Access Journals (Sweden)
Maria Laura Magalhães Gomes
2015-12-01
Full Text Available RESUMO: Apresentamos um estudo a partir de duas investigações sobre o LASEB-FaE-UFMG, curso de especialização que contemplava uma turma de Educação Matemática, no qual analisamos as relações construídas entre professores que ensinam Matemática e professores licenciados em Matemática. As pesquisas, concluídas em 2013, abordam a convivência, por dezoito meses, dos docentes atuantes no primeiro e no segundo segmentos do Ensino Fundamental, explicitando diferenciações e identidades. Entre encontros e desencontros, os docentes mostraram ter aprendido uns com os outros, ampliando sua formação nos conteúdos e no seu ensino, o que foi possibilitado pela abordagem eleita para o curso, pautada no campo da Educação Matemática. Percebemos ter se evidenciado, nos contatos, a afirmação das identidades dos docentes "generalistas" e "especialistas". A experiência se mostrou rica na construção de interações e aprendizagens sobre cada um, bem como sobre os processos formativos do Ensino Fundamental, remetendo-se a reflexões sobre a formação inicial docente.
Dilemmas of a Newly Recruited Academic Qualified Professor: A Case
Agrawal, Anand
2015-01-01
This case describes the situation of a newly recruited academic professor who volunteered to teach a course on Research Methods to first-term MBA students in a practitioner-oriented case method Business School. Research Methods is a unique course due to its relevance not only in business but also across all graduate programs. Instructional and…
Mammas, Ioannis N; Spandidos, Demetrios A
2017-10-01
Professor Anna Kramvis, Research Professor of Molecular Virology at the University of the Witwatersrand in Johannesburg, South Africa, talks about direct-acting antiviral treatments against hepatitis C virus (HCV), as well as the perspective of the development of an effective vaccine against HCV. She emphasises the necessity of vaccination against hepatitis B virus (HBV), highlighting that it is very important that vaccination should be administered at birth in order to prevent mother-to-child transmission (MTCT) of HBV. Professor Kramvis states that vaccination against HBV is safe and that HBV and HCV infections are not contraindications for breastfeeding. Regarding the challenge of Paediatric Virology, she believes that it is a field that during the last years is increasing exponentially, while she concurs that Paediatric Virology subspecialty will be a popular choice for infectious diseases subspecialists. In the context of the 3rd Workshop on Paediatric Virology, which will be held in Athens on October 7th, 2017, Professor Kramvis will give her key lecture on MTCT of HBV and HCV.
O papel do professor junto ao aluno com Altas Habilidades
Directory of Open Access Journals (Sweden)
Andréia Jaqueline Devalle Rech
2012-03-01
Full Text Available .Quando se discute a Educação Especial é comum, num primeiro momento, lembrar do aluno que compõe o especial na Educação como aquele com deficiência mental, auditiva, visual ou física. No entanto, assim como essas crianças, também os alunos com altas habilidades necessitam de um atendimento especializado, pois ele também é um sujeito da Educação Especial. Nesse sentido, este artigo apresenta a definição de altas habilidades, baseada na teoria de um pesquisador norte-americano e, como foco principal algumas questões que envolvem o professor de forma mais direta com o aluno com altas habilidades em sala de aula. Entre elas estão: questões sobre a aprendizagem escolar desses alunos, bem como os fatores que fazem parte desse processo, estratégias de ensino e a importância da identificação dos alunos com altas habilidades.Palavras-chave: Educação Especial. Professor. Aluno com Altas Habilidades
Concept of a landscape map according to Professor Franciszek Uhorczak
Directory of Open Access Journals (Sweden)
Meksuła Mirosław W.
2016-09-01
Full Text Available In the article, the concept of landscape maps by Franciszek Uhorczak (1902–1981, Professor of the Maria Curie-Skłodowska University in Lublin, was discussed. The maps constitute a cartographic illustration of volume III, IV and V of “Universal Geography” edited by Państwowe Wydawnictwo Naukowe (the National Scientific Publishing House (Warsaw 1965–1967 – the first Polish small-scale landscape maps of the world. From the perspective of the 50s, an attempt was undertaken to assess the editorial assumptions, landscape typology and selection of cartographic means used by the author, paying special attention to the selection of colours representing landscapes. Also, issues raising controversies related to the degree of generalization of particular elements of the content, typology of landscapes as well as map details were indicated. The performed analysis leads to the conclusion that landscape maps by Professor F. Uhorczak constituted one of the most significant achievements of Polish thematic cartography of the 20th century, and they are an unequaled model also for the contemporary cartographers.
Professor Jorge Frascara, Departamento de Arte e Design
Stephania Padovani
2004-01-01
Professor do Departamento de Arte e Design da Universidade de Alberta; membro da Sociedade de Designers Gráfico do Canadá; membro do Icograda Past-Presidents Forum; membro do Editorial Boards of Design Issues (Universidade de Carnegie Mellon/MIT), Information Design Journal (John Benjamins) e Tipográfica (Buenos Aires, Argentina); membro internacional da Society for the Science of Design (Japão), membro do Conselho Diretor do Communication Research Institute da Austrália (CRIA); e membro do C...
An Outstanding Career: Professor Emeritus Iacob Cătoiu
Octavian Oprică
2016-01-01
Through the duration of his commissions of Deputy Dean (1981-1989) and, respectively, Dean (1992-2003), and also by the manner of approaching the managerial problems and his scientific extension, Professor Iacob Cătoiu left and indelible trace on the evolution of the former Department of Commerce in the Bucharest University of Economic Studies (ASE) – now the Department of Business and Tourism. He is author or co-author of an important number of books (57) and articles (105) and book presenta...
Tuning Geneva+Pythia 8 Using Professor 2
Gellersen, Leif Erik
2016-01-01
We study the tuning of the Geneva Monte Carlo framework to LHC data. Geneva improves the predictions for Drell-Yan production by including NNLO QCD corrections and extending the resummation accuracy to NNLL$'$ for 0-jettiness and NLL for 1-jettiness. The partonic results provided by Geneva are interfaced to Pythia 8 for showering including its multiple parton interaction (MPI) model. This allows us to obtain sensible predictions for Underlying Event (UE) sensitive observables too. Retuning Geneva + Pythia 8 to LHC data with the Professor 2 package shows an improved agreement for both UE sensitive and more inclusive observables.
Saúde percebida em professores universitários: gênero, religião e condições de trabalho
Directory of Open Access Journals (Sweden)
Kátia Bones Rocha
Full Text Available A presente pesquisa investiga como os professores de uma universidade particular percebem sua saúde. O delineamento é de caráter descritivocorrelacional. Os instrumentos utilizados: Questionário de Saúde de Goldberg (QGS-60 e uma ficha com dados biodemográficos investigaram variáveis individuais e relativas à atividade laboral. A amostra se constituí de 161 professores, escolhidos por estratos através das diferentes área de formação. Os resultados revelam que os professores percebem que sua saúde geral está como de costume, ou seja, nem melhor nem pior e que existe associação entre as variáveis sexo, prática religiosa e variáveis relativas ao ambiente de trabalho (horas de trabalho na universidade e em sala de aula, influenciando a percepção que os professores têm de sua saúde.
QUALIDADE DE VIDA NO TRABALHO (QVT: UM ESTUDO COM PROFESSORES DOS INSTITUTOS FEDERAIS
Directory of Open Access Journals (Sweden)
Rodrigo Ribeiro de Oliveira
2015-12-01
Full Text Available No cenário atual em que há exigências contínuas de evolução do conhecimento e de avanços tecnológicos, a educação tecnológica é um assunto que merece destaque, pois é através dela que uma grande parcela dos trabalhadores é formada para atuar no mercado de trabalho cada vez mais qualificado e competitivo. Um dos projetos estratégicos mais importantes na área de ensino no país é o dos Institutos Federais que contam com 562 campi em todo país. Houve um crescimento significativo do quadro funcional: no ano de 2002 contava com 8.999 professores, atualmente conta com 37.021 (2015. Isso mostra um crescimento de 411,39%. Nesse contexto, o objetivo deste trabalho foi analisar o grau de satisfação dos professores dos Institutos Federais em relação à Qualidade de Vida no Trabalho, diante dos impactos da expansão da rede no Brasil. A pesquisa foi realizada com professores que participaram do II Fórum Mundial de Educação Profissional e Tecnológica, realizado em Florianópolis em 2012. Esta pesquisa caracteriza-se como quantitativa, exploratória, descritiva e avaliação (survey. Com relação ao instrumento, foi utilizado o Protocolo Biopsicossocial e organizacional - BPSO-96, de Limongi-França. Foram respondidos 43 questionários. Entre os cinco domínios avaliados, constatou-se que o domínio social foi o que apresentou o menor índice de satisfação (3,193, enquanto que o domínio psicológico foi o que apresentou maior satisfação (6,819. Destaca-se que a variável que apresentou a maior média na pesquisa foi a relação professor-aluno (8,233. Embora os resultados não possam ser generalizados para o expressivo universo de professores do Ensino Técnico dos Institutos Federais, os achados deste estudo demonstram a necessidade de alinhamento quanto à política de gestão de benefícios e apoio familiar e comunitário no grupo pesquisado, revelando a qualidade da relação ensino-aprendizado neste cenário.
A psicologia educacional e a formação de professores: tendências contemporâneas
Directory of Open Access Journals (Sweden)
José Aloyseo Bzuneck
Full Text Available A Psicologia Educacional é uma das disciplinas da formação acadêmica dos professores, mas é também uma área de pesquisa com implicações para a aprendizagem e o ensino. Ela apresenta um meio para compreensão da complexa tarefa educacional no contexto da sala de aula e sociocultural. Os professores precisam ter uma perspectiva psicológica útil para poderem fazer o melhor em seu trabalho.
Directory of Open Access Journals (Sweden)
Nirma Pérez-Pelipiche
2016-10-01
Full Text Available This work paper shows research results on the contextualized dynamics of the constant shaping of advisor professors in the teaching unit, taking epistemological foundations as a starting point, which substantiate their theoretical construction. A model has been displayed basing on comprehension and interpretation of this process as a whole, in which its subsystems, components, structure, relations and levels among them, prove contradictions that become evident in such process, therefore allowing to structure the dynamics of shaping professors as an instrument, earning, as a result, the transforming capability of advisor professors when practicing their skill, having the teaching unit as a scenary. In that way we used different techniques: questionnaire, interviews, observation, statistical techniques and methods: historical-logical; analysis-synthesis and systemic-structural-functional, all of those ones from the hermeneutic-dialectic focus.
Quando o garrancho é disgrafia: a atuação do professor diante dessa dificuldade de aprendizagem
Directory of Open Access Journals (Sweden)
Felipe Costa Negrão
2014-07-01
Full Text Available Atualmente, estamos vivendo em dias, onde os conceitos são mais importantes que as atitudes, ou o bem estar de nossos educandos. A sede por números positivos nas avaliações do MEC, por muitas vezes impossibilitam que o desenvolvimento de nossos alunos seja equilibrado. O professor é o profissional que está em contato diário com estes sujeitos aprendentes, logo é ele que observará as dificuldades apresentadas pelos mesmos. Perdurou-se por tempos, o rótulo de que os alunos que apresentavam alguma dificuldade de aprendizagem eram desprovidos de inteligência, sendo classificados até como “burros”, entretanto, atualmente podemos ver que este campo da educação, tem ganhado uma atenção especial. O presente artigo tem como propósito apresentar algumas considerações acerca da atuação do professor diante a disgrafia, tendo como objetivo geral compreender como o educador deve posicionar-se ao encontrar em sala de aula um aluno com sinais de disgrafia, objetivando a melhora da aprendizagem deste educando. A metodologia utilizada na pesquisa é de caráter bibliográfico, onde recorremos a autores como Topczewski (2011, Almeida (2010, Fonseca (1995, Vallet (1977, entre outros. Elucidamos a importância da formação continuada, visto que as dificuldades de aprendizagem não são estudadas na graduação, e os educadores precisam estar preparados para lidarem com alunos que possuam disgrafia em sala de aula, na tentativa de evitar rótulos enganosos e desempenhos insatisfatórios. Enfim, compreendemos que a função do professor diante da disgrafia é ser um facilitador e um motivador, e também deve mostrar a este educando as suas habilidades e competências. Espera-se, então que o professor desperte-se, e promova mudanças em sua sala de aula, visando alcançar estes alunos que convivem com esta limitação em seu dia-a-dia. Em conformidade com o que foi apresentado nesta pesquisa, o aluno com disgrafia apresenta suas
Silmara de Oliveira Gomes Papi; Pura Lúcia Oliver Martins
2010-01-01
O presente texto tem como foco as investigações sobre professores iniciantes e faz um balanço do tema a partir de pesquisas realizadas no Brasil, tendo em vista a atual tendência dos estudos sobre essa etapa do desenvolvimento profissional do professor. Para tanto, são analisados os trabalhos apresentados nas reuniões da ANPEd, nos anos de 2005, 2006 e 2007, e as pesquisas disponíveis no banco de teses da CAPES - 2000 a 2007 (mestrado e doutorado). Também é analisada a pesquisa de Brzezinski ...
Jiang, Hailin; Liu, Chengyu; Ha, Lijuan; Li, Tie
2017-11-12
Professor WANG Fuchun 's experience in the acupoint selection of clinical treatment with acupuncture and moxibustion was summarized. The main acupoints are selected by focusing on the chief symptoms of disease, the supplementary points are selected by differentiating the disorders. The acupoints are modified in terms of the changes of sickness. The effective acupoints are selected flexibly in accordance with the specific effects of points. The summary on the acupoint selection reflects professor WANG Fuchun 's academic thoughts and clinical experience and effectively instructs the clinical practice of acupuncture and moxibustion.
Professor Lisa Aranson on JA Green (a pioonier artist photographer ...
African Journals Online (AJOL)
Jonathan Adagogo Green's photographic and artistic contributions working in his countryside, the Niger Delta of Nigeria is reviewed by Professor Lisa Aranson. Aranson in a public lecture presentation on the stand-point of art history thinks of J.A. Green as having operated in two worlds of which he is said to have initiated in ...
Tribute to the legend Mr. Veterinary Public Health, Professor James ...
African Journals Online (AJOL)
The author was also destined during his Sabbatical Leave to have an interactive interview session with Prof James Steele after attending the 20th Annual James Steele lecture/ 99th birthday Dinner of Professor James Steele 4th and 6th April 2012 at the Texas School of Public Health, Houston, Texas, USA. The interview ...
Humor and the Emeritus Professor: An Interview with Gene Roth
Vivona, Brian
2015-01-01
This essay is a compilation of several conversations with Dr. Gene Roth, Distinguished Teaching Professor Emeritus at Northern Illinois University. Dr. Roth is past President of the Academy of Human Resource Development, and although he is well known for his efforts in bringing humor into the field of HRD, he is not the same Gene Roth that played…
Processo Ensino‐Aprendizagem: Características do Professor Eficaz
Directory of Open Access Journals (Sweden)
C. Albuquerque
2016-02-01
Uma análise global sobre o conjunto dos indicadores que, na opinião dos alunos, incorporam cada dimensão associada ao professor eficaz, permite identificar a preocupação e o reconhecimento da importância do “conviver”, do “conhecer”, e “do saber comunicar” como “os três pilares” em que assenta a qualidade do ensino/educação.
Panjaitan, Leonard Tiopan
2012-01-01
Teknologi Informasi dan Komunikasi (TIK) secara langsung dan tidaklangsung berpotensi melahirkan kejahatan-kejahatan siber (Cybercrime)khususnya Carding. UU ITE No.11 tahun 2008 merupakan jaminankepastian hukum yang akan membuat seluruh aktivitas pemanfaatanTIK di dalam negeri terlindungi dengan baik dari potensi kejahatan danpenyalahgunaan teknologi. Kepastian hukum ini juga harus dirasakanoleh pelaku industri kartu kredit termasuk kastemer. Dengan cara inimaka bertransaksi di internet denga...
Directory of Open Access Journals (Sweden)
Maria Romana Friedlander
2006-02-01
Full Text Available Descreve as características do professor que leciona as disciplinas que obtiveram os maiores índices de sucesso na avaliação realizada pelos estudantes. Foi realizado numa escola de ensino superior de enfermagem de Lisboa (Portugal, com 16 professores que responderam um questionário. Concluiu-se que o professor bem avaliado pelos estudantes possui os seguintes atributos: é maduro, bem qualificado para o ensino, com sólida experiência na docência e boa experiência no exercício da profissão. Na opinião dos próprios professores, são capazes de estabelecer um bom relacionamento com seus alunos, acreditam-se eficazes na prática docente e possuem um profundo conhecimento de sua disciplina. Todos utilizam a aula expositiva com interação e diálogo com os alunos, e complementada por experiências e vivências práticas, debates, discussões, dramatizações e simulações. As autoras alertam para a necessidade de outras pesquisas sobre o tema.Describe las características del profesor de las asignaturas que tuvieran mejores índices de resultados en la evaluación realizada por los estudiantes. Fue realizada por una escuela de enseñanza superior de enfermería en Lisboa (Portugal con 16 profesores que respondieron a un cuestionario. Se concluyó que el profesor evaluado altamente por los estudiantes posee las siguientes características : maduro, bien cualificado para enseñar, con sólida experiencia en la enseñanza y buena práctica en la ejecución de la profesión. En la opinión de los profesores, estos son capaces de establecer una buena relación con sus alumnos, son eficaces en la practica de la enseñanza y poseen un profundo conocimiento de su disciplina. Todos utilizan las clases como interacción y dialogo con los alumnos y lo complementan con experiencias y vivencias practicas, debates, discusiones, dramatizaciones y simulaciones. Las autoras alertan de la necesidadede de otras pesquisas sobre el tema.The present report
Uso das TICs na Educação Superior presencial e a distância: a visão dos professores
Directory of Open Access Journals (Sweden)
Mathias, Carmen V.
2011-01-01
Full Text Available As tecnologias possuem um potencial formativo que pode contribui para ampliação dos espaços e dos tempos pedagógicos, para a flexibilização do currículo e para o aumento da interação entre os sujeitos tanto na educação presencial quanto na educação a distância. A partir dessa premissa, objetivamos investigar como ocorre o uso das TICs aplicadas a educação superior presencial e a distância sob o ponto de vista dos professores universitários. O trabalho teve uma abordagem qualitativa, os dados foram coletados por um questionário online aplicado a vinte e dois professores atuantes na educação superior presencial e a distância. As informações foram trabalhadas através da análise de conteúdo. Alguns resultados: todos os professores utilizam TICs, alguns de forma mais freqüente e diversificada; algumas tecnologias são mais utilizadas na educação presencial, outras na educação a distância; a maioria dos professores possui formação para o uso das TICs; foi significativo o indicativo da falta de formação para os professores usarem de maneira adequada as tecnologias; a maioria dos professores reconheceu a existência de diferenças no uso das tecnologias na educação presencial e a distância; os professores apontam muitas vantagens para o uso das tecnologias aplicadas a educação e reconhecem algumas desvantagens
Mammas, Ioannis N; Spandidos, Demetrios A
2017-10-01
Professor Maria Theodoridou, Emeritus Professor of Paediatrics at the University of Athens, is one of the few paediatricians in Greece, who have experienced almost all the infectious diseases of the second half of the 20th century and their severe consequences, prior to the widespread adoption of immunisations. A milestone during her career was the establishment of a specialised National Reference Unit for the care of paediatric patients with acquired immune deficiency syndrome (AIDS) at the 'Aghia Sophia' Children's Hospital in Athens, Greece. According to Professor Theodoridou, training on the prevention, management and treatment of neonatal and paediatric viral infections represents a new educational challenge for both community as well as hospital-based paediatric health professionals. The debate of the potential strategically principal role of Paediatric Virology subspecialists in the primary, secondary and tertiary clinical practice is definitely necessary and needs further discussion and evaluation, she adds. She describes the difficulties that Greece, a country under a long-standing financial crisis, faces for the hospital-based management of paediatric viral infections and refers to the future advances, which are expected in the field of diagnosis and treatment of viral infections in neonates and children. In the context of the 3rd Workshop on Paediatric Virology, which will be held in Athens on October 7th, 2017, Professor Theodoridou will focus on the immigration crisis and vaccination policy.
Sobre a atualidade dos tabus com relação aos professores Taboos against teachers today
Directory of Open Access Journals (Sweden)
Antonio A. S. Zuin
2003-08-01
Full Text Available Este texto tem como objetivo argumentar que as atuais representações aversivas dos alunos com relação aos seus mestres, os chamados tabus, são decorrentes da violência simbólica que o professor exerce sobre o aluno, com ênfase na universidade. E se a atitude violenta causa inicialmente uma sensação de mal-estar, logo é identificada como algo "inerente" ao processo de ensino-aprendizagem. Tal violência torna-se valorizada tanto pelos professores quanto pelos alunos que se identificam com o professor na figura do agressor, sendo que tais alunos procuram encontrar oportunidades para poder se desforrar do ressentimento que foi engendrado nas relações cotidianas com seus mestres.This paper intends to argue that the current averse representations students have of their teachers, the so called taboos, follow from the symbolic violence teachers exert on them, mainly in the university. If this violent attitude initially causes a sensation of discomfort, it is soon identified as something "inherent" to the teaching and learning process. Therefore, it is often highly prized by teachers and by the students who identify themselves with the professor as an aggressor, while these students look for opportunities to let go of the resentment generated by their daily relationships to their masters.
Valencia, Heriberto Gonzalez; Villota Enriquez, Jackeline Amparo; Agredo, Patricia Medina
2017-01-01
This study consisted in characterizing the strategies used by professors; implemented through virtual educational platforms. The context of this research were the classrooms of the Santiago de Cali University and the virtual space of the Chamilo virtual platform, where two professors from the Faculty of Education of the same university…
[Experience summary of professor WANG Fuchun's "Zhenjing Anshen" acupuncture method for insomnia].
Li, Tie; Ha, Lijuan; Cao, Fang; Zhi, Mujun; Wang, Fuchun
2015-11-01
The experience of "Zhenjing Anshen" acupuncture method originally created by professor WANG Fuchun for treatment of insomnia was introduced in this paper. From aspects of insomnia pathogenesis, theoretical foundation, characteristics of acupoint selection, needing methods, needing time, etc., the experience of Professor WANG Fuchun for treatment of insomnia was explained. The "Zhenjing Anshen" acupuncture method proposed, for the first time, "new three layers" method of acupoint selection, including Sishencong (EX-HN 1), Shenmen (HT 7), Sanyinjiao (SP 6). This method presents the principles of acupoint selection along meridian, acupoint selection based on essence-qi-spirit, harmony of yin and yang. The acupuncture manipulation is emphasized, and treating time (the period of the day from 3 pm to 5 pm) is focused on; acupoint selection is simple but essential, and acupoint combination is scientific, which receives notable therapeutic effect in clinic.
Interview with Professor Dr. Daniel Spreng
International Nuclear Information System (INIS)
Nagel, C.; Kilchmann, A.
2004-01-01
This interview with Professor Dr. Daniel Spreng of the Center for Energy Policy and Economics (CEPE) in Zuerich, Switzerland, deals with questions concerning research in the area of energy economics. In particular, the situation in Switzerland, where mains-connected sources of energy such as electricity and gas play an important role in energy supply, is looked at in the light of market liberalisation. Various approaches to the liberalisation of gas and electricity systems are discussed and the costs of liberalised supply systems are compared with those of the present monopolistic situation. Also, energy reserves and the use of the gas distribution system in a future hydrogen-based energy supply scenario are looked at. Projects currently being worked on at the CEPE are reviewed
Aprendizagem baseada em problemas no ensino de ciências: Mudando atitudes de alunos e professores
Directory of Open Access Journals (Sweden)
João Manoel da Silva Malheiro
2008-06-01
Full Text Available O aprendizado baseado em problemas (APB é apontado como ferramenta importante para ensinar os alunos a aprender com autonomia. O objetivo deste trabalho é comparar a forma habitual de ensinar Ciências e Biologia no Ensino Médio da Escola Pública com a metodologia da Aprendizagem Baseada em Problemas (ABP. Para tanto, dois Cursos de Férias frequentados por alunos e professores do ensino médio foram baseados na ABP e dedicados à redescoberta da anatomia do corpo de animais com estilos de vida contrastantes. Foram feitas análises qualitativas e quantitativas a partir de questionários aplicados antes e depois dos cursos a alunos e professores. Os resultados apontaram para maior motivação dos alunos e professores em ciências e biologia após os cursos de férias e para a possibilidade da utilização imediata da metodologia no ensino médio na escola pública a despeito das restrições atuais de infra-estrutura.
Sex Roles on Campus: Does Professor Charles Really Get His Angels?
Rochelle, Larry
1980-01-01
Reveals factors which foster sexual relationships between male professors and female students. Considers the journals commonly read by males and females and their impact on sexual attitudes. Discusses the issues of miscommunication, sexual harassment, and students' perceptions of sex roles on campus. Suggests ways of dealing with sexual…
O pensamento computacional e a formação continuada de professores: uma experiência com as TICs
Directory of Open Access Journals (Sweden)
Louise Alessandra Santos do Carmo Paz
2018-03-01
Full Text Available As novas tecnologias da informação e comunicação (TICs fazem parte do cotidiano dos alunos, mas nem sempre dos professores. Para que haja uma mudança de paradigma no papel do professor, de produtor para mediador do conhecimento é necessário o desenvolvimento de novas competências para ensinar, destacando-se o pensamento computacional. Este artigo relata a experiência de um curso de introdução às novas TICs, que foi ofertado como formação continuada para professores, utilizando uma metodologia baseada no modelo andragônico, colocando-os como colaboradores e criadores do seu saber, corresponsáveis pelos os rumos do seu processo de ensino aprendizagem.
Projeto formação continuada de professores em gênero e sexualidade: relato de experiência
Directory of Open Access Journals (Sweden)
Leonardo Pereira de Lima
2015-12-01
Full Text Available http://dx.doi.org/10.5007/1807-0221.2015v12n20p132 Este artigo relata uma atividade de formação de professores implementada a partir do Projeto de Extensão “Formação Continuada de Professores em Gênero e Sexualidade”, visando atender às dificuldades dos educadores em lidar com expressões da sexualidade que aparecem no cotidiano escolar. O projeto teve como objetivos: formar professores para atuarem com questões de gênero e sexualidade do cotidiano escolar; desconstruir mitos, tabus e preconceitos relacionados às questões de gênero e sexualidade, e instrumentalizar professores para o desenvolvimento de ações relacionadas aos temas propostos. Os cursistas relataram que sentiram-se mais instrumentalizados para mediar expressões da sexualidade do cotidiano escolar. Entendemos que o curso oferecido pelo projeto atingiu seus objetivos, promovendo algumas rupturas em posicionamentos que reduziam a sexualidade ao campo biomédico, bem como a fundamentalismos que a compreendiam de uma forma binária e mantenedora das desigualdades de gênero, permitindo que emergissem intervenções em consonância com os princípios propostos nas políticas públicas.
Mammas, Ioannis N; Spandidos, Demetrios A
2017-10-01
Born in Gelsenkirchen-Buer in Germany on March 11th, 1936, Professor Harald zur Hausen, Emeritus Professor of Virology at the University of Freiburg and 2008 Nobel Prize Laureate in Physiology or Medicine for his discovery of human papillomavirus (HPV), which causes cervical cancer, believes that good knowledge of virological methods and diagnostic possibilities are an asset for all young paediatricians. Professor zur Hausen considers that the creation of an educational platform on Paediatric Virology is definitely very beneficial for young paediatricians, as this will greatly enhance their knowledge in the field of Virology. He very actively advocates the vaccination of boys for the eradication of HPV infection and emphasises that male HPV vaccination should be included into the current vaccination programmes. He would have certainly considered Dr George N. Papanicolaou (Kyme, Island of Euboea, Greece, 1883 - Miami, Florida, USA, 1962) as an excellent candidate for the Nobel Prize, stating that the contribution of Dr Papanicolaou did not find sufficient recognition in the past. In the context of the 3rd Workshop on Paediatric Virology, which will be held in Athens, Greece, on October 7th, 2017, Professor zur Hausen will give his plenary lecture on 'Paediatric Virology and Oncology: Virus persistence and the important first years of life'.
Hartman, Katherine B.; Hunt, James B.
2013-01-01
This study examines RateMyProfessors.com ratings and comments as a form of electronic word-of-mouth communications. The data represent 2,371 user ratings and comments for 442 marketing professors from 51 U. S. colleges and universities. Qualitative comments were analyzed using updated thematic content analyses. The results indicate significant…
Xu, Weiwei; Meng, Xianjun; Zhu, Anning; Wang, Yu; Luo, Wuyougumo; Kuang, Zifang
2017-01-12
Professor ZHANG Yongshu , who studied from professor LIU Zhangjie , is a famous acupuncturist in Quanzhou of Southern Fujian. The publications authored by professor ZHANG Yongshu were collected in this study to summarize his academic characteristics of acupuncture and moxibustion. The result indicated he highly valued the regulation of yang qi , and established the theory of "developing yang to nourish yin ", which proposes to develop yang qi to achieve the effect of culturing yin ; he summarized eight methods to regulate the governor vessel and conception vessel, which can condition the body's yin and yang ; he paid attention to moxibustion therapy and its dosage, and made the best of direct moxibustion. In addition, he focused on meridian theory with effective application of meridian syndrome differentiation; in clinical treatment, he regulated the hand- yangming meridian to treat diseases by nourishing yang , generating yin and regulating fu .
Directory of Open Access Journals (Sweden)
Duško Bjelica
2012-09-01
Full Text Available At the Faculty of Sports and Physical Education from Niksic, in cooperation with the Ministry of Education and Sports, the Government of Montenegro, a one-day seminar was organized for professors of physical education from all Montenegrin towns. The seminar, attended by 86 professors, was held on October 26, 2011 with actual topics in the field of sports, monitoring and control of growth and development of children, as well as new methodology in the field of physical education. Taking into account that there are about 200 primary and secondary schools in Montenegro, the number of the seminar attendees was very representative and it represented by accident chosen sample in research of professors of physical education. Method of the questionnaire was implemented in this research and the used questionnaire consisted of three group of questions for testing attitudes about: development of Montenegrin sports, personal expert specialization and work satisfaction. This questionnaire represents a part of the research done at the Faculty of Sports and Physical Education whose aim is to get directions for organization of similar seminars in the next time period through monitoring and insight into attitudes of professors of physical education and that way to give a contribution to permanent specialization of professors of physical education.
Directory of Open Access Journals (Sweden)
Daniela Pederiva Pensin
2017-10-01
Full Text Available O texto toma como objeto a constituição do professor da educação superior considerando a complexidade do presente. Ao intentar sua problematização, o faz inspirado nos estudos de orientação foucaultiana, servindo-se do discurso como conceito teórico-metodológico. A busca por este objetivo mobilizou: reconhecer a constituição do professor da educação superior inextrincavelmente articulada à constituição da docência; assentir a constituição histórica e contextualizada deste professor; tomá-la em sua singularidade na invenção de um tipo sujeito específico; dar visibilidade ao que se coloca como verdades sobre este professor por meio dos discursos institucionais. Tomou-se como superfície analítica os Projetos Pedagógicos Institucionais de nove universidades do Rio Grande do Sul e buscou-se pelas recorrências discursivas ─ formas de fazer circular verdades autorizadas que, em meio a jogos de verdade, constituem o professor. Organizado em duas seções, na primeira trata a constituição do professor desde uma perspectiva histórica, que permite ver o professor imerso na atmosfera da educação de seu tempo numa constituição não estática, tampouco linear. A segunda seção traz a compreensão de que o professor, no presente, constitui-se em meio a práticas de uma docência singular, que opera pelo agenciamento. O movimento analítico que sustenta este texto conduz à compreensão de que o professor se constitui, no presente, como um sujeito que opera pelo agenciamento e ao operar mobiliza a ideia de fazer do indivíduo alguém capaz de produzir efeitos, ao menos, em três dimensões: (1 uma dimensão de mercado, (2 uma dimensão de conhecimento e tecnologia, (3 uma dimensão humanizadora.
Superdotação/altas habilidades percebidas por pais e professores do ensino fundamental, nível I
Directory of Open Access Journals (Sweden)
Nathalya Elizabeth Ferrer Ubeda
2017-11-01
Full Text Available As políticas educacionais de inclusão propõem medidas que garantem a participação e desenvolvimento de estudantes com superdotação/altas habilidades, todavia, há um grande desafio no que tange à sua identificação. A realização deste estudo objetivou identificar a percepção de pais e professores quanto às características de superdotação/altas habilidades de seus filhos e alunos. O estudo foi realizado no Ensino Fundamental, Nível I, de uma cidade de pequeno porte no estado de São Paulo. Utilizou-se questionários para pais e professores a fim de realizar coleta de informações. A análise dos dados revelou que os pais demonstraram grandes expectativas quanto ao potencial de seus filhos, enquanto que os professores foram mais ponderados ao escolher os indicadores referentes ao potencial de seus alunos. Ambos apresentaram conhecimento superficial quanto ao assunto e os professores fizeram poucas indicações no item Criatividade, elemento indispensável no processo, pois envolve originalidade de pensamento na solução de problemas.
Gender and Teamwork: An Analysis of Professors' Perspectives and Practices
Beddoes, Kacey; Panther, Grace
2018-01-01
Teamwork is increasingly seen as an important component of engineering education programmes. Yet, prior research has shown that there are numerous ways in which teamwork is gendered, and can lead to negative experiences for women students. This article presents the first interview findings on professors' perspectives on gender and teamwork.…
First Impressions and Professor Reputation: Influence on Student Evaluations of Instruction
Buchert, Stephanie; Laws, Eric L.; Apperson, Jennifer M.; Bregman, Norman J.
2008-01-01
We examined the effects of professor reputation versus first impressions on student evaluations of instruction. Students in 19 Psychology courses completed course evaluation surveys either before meeting the instructor or 2 weeks into the semester. Both groups then completed the course evaluation again at the end of the semester. Unlike…
Teaching Management: A Field Guide for Professors, Consultants, and Corporate Trainers
Clawson, James G. S.; Haskins, Mark E.
2006-01-01
How can every management class be a dynamic, unforgettable experience? This much-needed book distills over half a century of the authors' combined experience as university professors, consultants, and advisors to corporate training departments. In a lively, hands-on fashion, it describes the fundamental elements in every learning situation,…
Dose vocal em professores: correlação com a presença de disfonia
Gama, Ana Cristina Côrtes; Santos, Juliana Nunes; Pedra, Elisângela de Fátima Pereira; Rabelo, Alessandra Terra Vasconcelos; Magalhães, Max de Castro; Casas, Estevam Barbosa de Las
2016-01-01
RESUMO Professores são profissionais com alta prevalência de disfonia, para a qual os principais fatores de risco são as longas jornadas de trabalho em salas de aula com presença de ruído ambiental. O objetivo da pesquisa foi calcular o tempo de fonação e a dose cíclica de professoras com disfonia e de professoras sem alteração de voz durante a atividade letiva. Para o estudo, dois grupos foram analisados: cinco professoras com disfonia funcional constituíram o grupo de professores disfônicos...
A CONSTRUÇÃO DO EU PROFESSOR – RELATOS DE UMA EXPERIÊNCIA
Directory of Open Access Journals (Sweden)
José Augusto Ayres Florentino
2016-07-01
Full Text Available O presente ensaio é parte de um trabalho apresentado no seminário: Por una hermenéutica de la experiencia: aproximación entre Nietzsche y Foucault , realizado durante o período de doutorado-sanduíche na Universidad Nacional de La Plata/Argentina, no ano de 2010. O objetivo com este exercício narrativo foi o de contar as primeiras experiências pedagógicas como professor em um curso de Especialização em uma Instituição de Ensino Superior e, posteriormente, de anatomia humana no curso Técnico Profissionalizante, entre os anos de 2007 e 2009. Para tanto, trago relatos de uma experiência vivida no início da carreira profissional como docente, relatando como o processo produtivo da experiência (que é sempre negativa me levaram a refletir e a repensar o meu agir pedagógico. Como se deu, a partir do saber da experiência, a construção do EU professor e, consequentemente, o giro epistemológico na minha prática educativa com a (reconstrução da minha profissionalidade. Este ensaio apoia-se em autores pertinentes à temática da formação professores e da experiência e do saber da experiência, tais como Sacristán, García, Larrosa e Gadamer.
Para superar as prescrições direcionadas ao professor de física
Directory of Open Access Journals (Sweden)
Maria P. M. de Almeida
2009-10-01
Full Text Available Neste estudo partimos da consideração da relevância da autonomia do professor na organização das relações de ensino de que participa em sala de aula. Como prescrições dirigidas ao professor se opõem à possibilidade de autonomia, buscamos compreender manifestações de caráter prescritivo visando contribuir para a diminuição de sua ocorrência. Para tanto, nos apoiamos numa vertente da análise do discurso para compreender como, em certas condições de produção, prescrições, explicitas ou implícitas, são direcionadas a professores de física da educação básica. Os discursos analisados foram obtidos em periódico, ata de encontro e através de entrevistas e questionário. Todos foram formulados em situações relacionadas com o ensino da física, no Brasil, em diferentes momentos desde a segunda metade do século passado. Entre as considerações que o estudo permite inferir, destacase a contribuição da participação na área de educação em ciências na superação das prescrições.
Profissão Professor: a dimensão afetiva contemplada em sua identidade
Directory of Open Access Journals (Sweden)
Rebeca Possobom Arnosti
2013-12-01
Full Text Available A pesquisa emerge do cenário de crises e contradições que envolvem a educação, o professor e a sua identidade. Na tentativa de re-significar esta identidade, visando encontrar elementos que contribuam com a construção da profissionalidade docente, partiu-se do pressuposto da importância de se investir no desenvolvimento pessoal do professor, contemplando sua dimensão afetiva. O objetivo deste estudo foi identificar nos docentes que atuam em escolas da rede de ensino, educação básica, os aspectos constitutivos da dimensão (sócio-afetiva de sua identidade. Trata-se de uma pesquisa qualitativa, tendo como instrumentos de coleta de dados observações e entrevistas semiestruturadas. Os dados contemplam as diferentes categorias da profissionalidade docente, de modo que se pode visualizar como a afetividade assume papel essencial na formação e no trabalho dos professores, já que seu desenvolvimento possibilita a construção de uma prática pedagógica diferenciada, facilita a elaboração de trabalhos pedagógicos coletivos e, ainda, quando reconhecida e desenvolvida na graduação, contribui para que crenças e princípios pessoais possam ser reavaliados sob uma perspectiva científica e profissional.
Professor Jorge Frascara, Departamento de Arte e Design
Directory of Open Access Journals (Sweden)
Stephania Padovani
2004-04-01
Full Text Available Professor do Departamento de Arte e Design da Universidade de Alberta; membro da Sociedade de Designers Gráfico do Canadá; membro do Icograda Past-Presidents Forum; membro do Editorial Boards of Design Issues (Universidade de Carnegie Mellon/MIT, Information Design Journal (John Benjamins e Tipográfica (Buenos Aires, Argentina; membro internacional da Society for the Science of Design (Japão, membro do Conselho Diretor do Communication Research Institute da Austrália (CRIA; e membro do Conselho Consultivo e Doutor em Design pela Universidade de Veneza.
Directory of Open Access Journals (Sweden)
Carmen Brunelli de Moura
2011-03-01
Full Text Available A ideia de programar ações de melhoria na qualidade do ensino levou o Estado a dividir com a mídia os espaços de formação de professores. Isso fez surgir uma discursividade cujos efeitos apontam para um currículo pedagógico que funciona em meio a um conjunto de verdades e equipa o professor com uma teoria voltada para a profissionalidade e conduta do outro. Diante de todo esse profissionalismo, é possível entrever uma teoria da pessoalidade? É possível descrever um currículo cujos efeitos apontam para a transformação das subjetividades do professor e não apenas para sua formação? A partir desses questionamentos, objetivo descrever como os discursos da mídia problematizam a subjetividade do professor, pensando-a a partir de um currículo psicagógico, cujas verdades não têm como finalidade formar, mas transformar o modo de ser do professor. Para problematizar esse currículo psicagógico, tomo o discurso produzido na edição de Dezembro/2001, da Revista Nova Escola. Conduzo este estudo a partir do campo da Linguística Aplicada com idéias que vêm das noções desenvolvidas por Michel Foucault, além de conceitos colhidos entre pesquisadores como Antonio Nóvoa, Stephen Ball, Alfredo Veiga-Neto, Tomas Tadeu da Silva, Zigmunt Bauman e outros. Os resultados desse estudo apontam que a mídia, ao pensar um currículo psicagógico, propicia ao professor espaços de liberdade diante das pressões sociais e históricas e a apreensão de subjetividades mais autônomas, singulares, mais abertas às mudanças que se apresentam continuamente na liquidez da modernidade.
On the knowledge of students and professors at Eindhoven UNiversity of Technology
Eikelder, ten H.M.M.; Meer, van der J.C.
2007-01-01
Using methods from statistical learning theory we compute the Vapnik-Chervonenkis dimension of full professors and students of the Eindhoven University of Technology. The results are surprising and disappointing. Furthermore, it is shown that during their study the students must have learned things
[Professor CHEN Xiuhua's experience in the treatment of atopic dermatitis].
Quan, Xiaohong; Li, Shuqian; Li, Ying
2017-03-12
Professor CHEN Xiuhua 's clinical experiences were introduced in the intervention on atopic dermatitis with external therapies of TCM acupuncture. On the basis of the theory as cultivating the earth and clearing the heart from professor CHEN Dacan and in terms of the disease stages and skin lesion characteristics, as well as in consideration of syndrome differen-tiation, the acupoints for strengthening the spleen and clearing heart fire are selected, such as Zhongwan (CV 12), Daheng (SP 15), Shuifen (CV 9), Tianshu (ST 25), Neiguan (PC 6) and Quchi (LI 11). For the repair of skin lesion, the integration of Chinese and western medicine is used, with the internal application and external use of Chinese herbal medicines involved. The topical ointments are selected rationally. The self-blood therapy is used with acupuncture, bleeding therapy and acupoint injection applied in combination on the basis of the theory of TCM zangfu organs and modern immunological mechanism, which stimulates the nonspecific immune response in the body and strengthens acupoint stimulus effects. Medical thread therapy of Guangxi Zhuang medicine is used in moxibustion for skin damage, which effectively stops itching and promotes wound healing and skin repair.
Representações sociais dos professores no ensino-aprendizagem do adolescente com Síndrome de Down
Directory of Open Access Journals (Sweden)
Sandra Conceição Maria Vieira
2015-12-01
Full Text Available ResumoEste artigo tem por objetivo compreender e analisar as representações sociais dos professores sobre o processo ensino aprendizagem do adolescente com síndrome de Down. Adotou uma abordagem qualitativa, utilizando o conceito das representações sociais. A escola escolhida é regular e adepta a educação inclusiva. A coleta de dados foi realizada por meio de um questionário. As entrevistas foram transcritas na íntegra e submetidos à análise do discurso.Três professores participaram da pesquisa. Percebeu- se que esses professores ainda não sabem bem o que fazem dentro de sala de aula, porque nenhum deles conseguiram responder, de fato, como trabalham pedagogicamente com esses alunos com Síndrome de Down. Pode- se acreditar que os aspectos indicativos de Representações sociais foram amplas. A representação mostrou- se como desafiadora para maior parte dos professores entrevistados, visto que compreendem que é necessário realizar o processo de inclusão, porém muitas vezes não sabem como. Ainda existe uma concepção que o aluno não aprende, demonstrando uma representação excludente, em relação ao fato de excluí-lo do direito adquirir conhecimentos como qualquer outro aluno e ao fato da falta de meios pedagógicos que facilitariam o processo ensino aprendizagem dos mesmos.
Wang, Shaosong
2016-07-12
By using the methods of experience summary and case report, professor WANG Linpeng 's clinical experience of acupuncture for migraine was summarized.Professor WANG proposed the different acupuncture plans should be established according to the active stage and remission stage of migraine; in the active stage acupuncture should be applied at gallbladder meridian with penetration needling technique to reinforce the stimulation intensity; in the remission stage the aim was to regulate zang-fu and back- shu points should be emphasized.In addition, attention should be paid on acupuncture technique and preventive treatment.For menstruation-type and psychological disorder-type migraine, different acupuncture plans should be adopted and regulating meridian and spirit was essential in the treatment.
Educação política de professores: conceitos e importância
Directory of Open Access Journals (Sweden)
Rangel, Mary
2005-01-01
Full Text Available Este artigo traz aos leitores conceitos da teoria política de Hannad Arendt, demonstrando a sua relevância para a educação de professores. A argumentação do texto contempla a importância da dimensão política do magistério e dos seus fundamentos. Assim, abordam-se conceitos arendtianos sobre política, poder e violência, enfatizando-os na formação e na prática docente, seja para os professores possam incorporá-los ao processo de ensino-aprendizagem, seja para que possam exercer, de modo consciente e fundamentado, a educação para a vida cidadã
A Professor Returns to the Classroom in a Professional Development School.
Lyman, Lawrence
This paper describes one professor's sabbatical leave, when he returned to a third/fourth grade classroom as a teacher. It examines logistical arrangements necessary for success and insights gained. He worked in a Professional Development School (PDS) for 1 year, mentoring a PDS intern, 2 student teachers in the traditional preservice program, and…
Directory of Open Access Journals (Sweden)
L. MANEA
2017-07-01
Full Text Available In the higher education system in Romania, from the professors' perspective, the problem of ethical responsibility distinguishes among the didactic activities of the teaching staff, which is why the educational process must take place in a civilized and ethical environment based on mutual respect between professors and students, respectively between the scientific research activities of the teaching staff, from this perspective guaranteeing the good conduct of the professional in his/her scientific research activity. Both aspects regarding the ethical responsibility of the teaching staff in the higher education have been regulated since 2004, when an institutional reform was being carried out on the entire territory of Romania on the introduction of ethical codes as ethical tools for regulating from that perspective in particular the professions in the public domain.
Licona, Miguel M.
Science becomes distorted and undemocratic when it is categorized into disciplines that, in turn, perpetuate borders creating conditions of inequality for the general population. Science education reform represents a starting point from which to approach notions of exclusion and inaccessibility. Students not intending to major in science often encounter environments as well as professors that serve to limit their potential and thereby exclude them from greater exposure and participation in the sciences. This qualitative study considers professional practices of professors who hold key positions for the success of science teaching and learning. Through classroom observation, in-depth interviewing and a survey questionnaire, this study sheds fight on the process of science education reform. Participants included six university professors who taught a reformed science course developed under the guidance of a National Science Foundation initiative known as the Collaborative for Excellence in Teacher Preparation. The purpose of this study is to understand the nature of faculty beliefs concerning teaching and learning science for students not intending to major in science, most of whom are elementary education majors. In this study, professors' espoused belief systems were elicited while their mental models that drive behavior were observed in the classroom setting. Incongruencies between theories in practice and theories in use were uncovered and explored. Major implications for who can and cannot learn science within the context of a system that currently serves to pre-select who will succeed are uncovered as a result of this study. The constant comparative method developed by Glaser and Strauss was used to analyze the words of each individual participant as she/he worked to consider the incongruencies in her/his theory and practice (as cited in Maykut & Morehouse, 1994). Self-reflection is identified as key in the process of praxis that will aid professors in their
Relações educacionais: comportamentos do professor de inglês que afetam a motivação do aluno
Directory of Open Access Journals (Sweden)
Girlane Moura Hickmann
2015-10-01
Full Text Available Este artigo é um recorte de uma pesquisa realizada em Curitiba (PR com 82 alunos e quatro professores de uma escola de línguas ligada a uma universidade publica federal. Partiu-se do pressuposto de que os comportamentos dos professores, ao ministrar suas aulas, poderiam influenciar positiva ou negativamente em algumas variáveis motivacionais dos alunos durante as aulas. O estudo teve como objetivo avaliar o estado e as metas motivacionais do aprendiz e relacionar esses elementos com a forma como os professores conduzem suas aulas. Os dados foram levantados através de entrevistas, aplicação de questionários e da observação direta dos comportamentos emitidos em sala de aula. As análises estatísticas dos dados feitas através dos testes não paramétricos de Kruskal-Wallis e Tukey apontaram para os seguintes resultados: 1 Quanto maior era a responsividade do professor maiores eram a Atitude positiva dos alunos em relação ao curso e a Adoção de Metas de Aprendizagem Orientadas tanto para o Desempenho Pessoal como pelo Meio; 2 Quanto mais estratégias aversivas o professor usava em sala de aula maior era a Adoção de Metas de Aprendizagem Orientadas para o Desempenho Pessoal; 3 Quanto maior é a Exigência e o Controle Aversivo, mais ansioso ficou o aluno.
Impacto vocal de professores Teachers' vocal impact
Directory of Open Access Journals (Sweden)
Adriana Ricarte
2011-08-01
Full Text Available OBJETIVO: analisar o impacto vocal nas atividades diárias em professores do ensino médio. Correlacionar os achado da auto-percepção do problema vocal com os aspectos: efeitos no trabalho, na comunicação diária, na comunicação social e na sua emoção. MÉTODOS: a amostra foi constituída por 107 professores, sendo 86 com queixa e 21 sem queixa, selecionados em escolas da rede particular de ensino de Maceió-AL. Cada professor respondeu individualmente o protocolo Perfil Participação em Atividades Vocais na presença da pesquisadora, assinalando suas respostas em uma escala visual que varia de 0 a 10. O protocolo é composto por 28 questões com a presença integrada em cinco aspectos englobados para avaliar a qualidade de vida e o resultado de tratamentos vocais. O protocolo oferece, ainda, dois escores adicionais: pontuação de limitação nas atividades (PLA e de restrição de participação (PRP. RESULTADOS: na comparação dos grupos com e sem queixa vocal foram verificados que todos os resultados foram estatisticamente significantes (pPURPOSE: to analyze the vocal impact in the daily activities on high-school teachers. Correlate the finding of the auto-perception on the vocal problem with the following aspects: effects in the work, daily communication, social communication and, its emotion METHODS: the sample consisted of 107 teachers, 86 with and 21 with no complaint, selected from private teaching schools in Maceió-AL. Each teacher answered individually the Protocol for Voice Activity Participation Profile in the presence of the researcher, noting their responses on a visual scale ranging from 0 to 10. The protocol is composed of 28 questions with the presence integrated in five aspects to evaluate the quality of life and the result of vocal treatments. The protocol offers, still, two additional scores: punctuation of limitation in the activities (PLA and restriction of participation (PRP. RESULTS: comparing the groups with
PROFESSORES: IMAGENS DO FUTURO PRESENTE
Directory of Open Access Journals (Sweden)
Maitê Alves Bezerra
2014-06-01
Full Text Available Ao observar a comunidade portuguesa que busca compreender a historicidade das formas e dos processos de escolarização por meio do estabelecimento de intenso diálogo com outras comunidades, é impossível não dar destaque à figura de António Manuel Seixas Nóvoa. Nascido em Lisboa no ano de 1954, aos 18 anos inicia o curso de Ciências da Educação na Universidade de Lisboa. Após lecionar em importantes universidades tais como Paris V, Oxford e Columbia University, atualmente acumula as posições de reitor da Universidade de Lisboa e professor catedrático da Faculdade de Psicologia e de Ciências da Educação na Instituição. Nóvoa tem se destacado à frente de debates internacionais a respeito da história da educação e educação comparada.
Entre o familiar e o estranho: representações sociais de professores sobre o autismo infantil
Araújo Santos, Michele
2009-01-01
Este trabalho teve o objetivo de investigar, a partir do referencial da teoria das representações sociais, as idéias de senso comum - que circulam entre professores - a respeito do autismo infantil, mapeando os saberes que as apóiam (ancoragem) e as imagens que as concretizam (objetivação). Indagamos ainda se o conhecimento popular sobre o autismo cumpre sua função de familiarização, uma das premissas básicas da teoria das representações sociais. Contamos com 16 professores par...
2 Professors Rock Out Online to Study Fame--and Us
Young, Jeffrey R.
2009-01-01
Most people who stumble across the YouTube video of the self-proclaimed rock star Gory Bateson singing to a scantily clad prostitute in Amsterdam's red-light district probably have no idea that the work is part of a research project--or that the man holding the guitar is a tenured professor. The video has attracted more than 12,000 views and won a…
Directory of Open Access Journals (Sweden)
Luciana Silva Zapparolli
2018-03-01
Full Text Available Este estudo é uma pesquisa qualitativa de caráter descritivo para analisar a eficiência e eficácia do resultado obtido pelos alunos no processo de ensino e aprendizagem na modalidade de educação a distância tendo dois modelos, em um primeiro modelo, considerado típico, o professor atua em papéis separados, somente como autor ou tutor, no segundo modelo o professor atua como autor e tutor simultaneamente. Os dados foram coletados através de questionário, respondidos por professores que atuam no Ensino Superior, na modalidade de educação a distância, nos dois modelos. O estudo proposto proporcionou a oportunidade de registrar a experiência profissional adquirida nas atuações e poderá futuramente contribuir na implantação de outras iniciativas que utilizem ambientes virtuais de aprendizagem utilizando os modelos apresentados.
CARTOGRAFIAS AFETIVAS: PROPOSIÇÕES DO PROFESSOR-ARTISTA-CARTÓGRAFO-ETC
Directory of Open Access Journals (Sweden)
Juliana Cristina Pereira
2014-04-01
Full Text Available O poema Sobre Importâncias de Manoel de Barros que abre a apresentação desta pesquisa, Cartografias Afetivas: proposições do professor-artista-cartógrafo-etc., aponta para um sentido pessoal e íntimo de atribuir importâncias, dando especial valor para aquilo que afeta sensivelmente, retendo o que cada um seleciona e atualiza ao longo da vida. A passagem descrita acima de Manoel de Barros diz que “a importância de uma coisa há que ser medida pelo encantamento que a coisa produza em nós”; isto impulsiona a refletir não só sobre nossas importâncias, mas, também sobre a importância do outro. O que o outro, aquele que é conhecido e também o desconhecido, elege como importância em sua experiência de vida, e, se pudesse selecionar, cartografar alguns momentos, experiências íntimas ou coletivas, para compartilhar com o outro, para torná-las públicas, o que compartilharia? Assim, Cartografias Afetivas busca, a partir de uma proposição aberta, criar cartografias diversas, construindo coletivamente reflexões acerca do ser professor-artista-cartógrafo-etc. A proposta tem o intuito de potencializar afeto e provocar encontros e atravessamentos em redes na criação de cartografias, propondo outros modos de pensar a relação com a educação, com arte, com a vida e suas importâncias. Nessa relação, o professor-artista-cartógrafo-etc., na contemporaneidade, desenha seu percurso em constante conexão com o que acontece no espaço/arte/tempo/vida.
Ser professor na Educação Básica: letramentos em construção em um Curso de Letras
Directory of Open Access Journals (Sweden)
Adriana Fischer
2011-12-01
Full Text Available O objetivo deste trabalho é caracterizar como ocorre a constituição letrada de alunos de Letras quando assumem a posição de professores da Educação Básica. Para responder a este objetivo, são analisados movimentos dialógicos desses alunos em eventos de letramento acadêmico nomeados como identitários. Nestes, os alunos universitários são posicionados como professores em práticas que envolvem leitura e a produção escrita. Para melhor situar os sentidos desses movimentos, são analisados os motivos pelos quais eles optaram pelo Curso de Letras. A perspectiva sociocultural dos letramentos orienta as discussões dos dados coletados mediante o acompanhamento longitudinal dos sujeitos da pesquisa em duas disciplinas do primeiro ano do curso. Os resultados indicam que as escolhas no projeto didático do professor universitário dessas disciplinas, bem como a possibilidade de os alunos se posicionarem como corresponsáveis em eventos destinados ao ensino-aprendizagem da língua, são fatores determinantes na constituição letrada deles quando na posição de professores da Educação Básica. Palavras-chave: Curso de Letras. Letramentos. Eventos identitários. Formação de professores.
Badri, Farid; Sajiai, Hafsa; Amro, Lamyae
2017-01-01
Smoking is a major public health problem. Doctors and paramedical staff are not excluded from this plague. Smoking ban in hospitals originated from government effort to reduce passive smoking. The objectives were to evaluate smoking habits among doctors and paramedical staff in order to implement tobacco control strategy in this study population and to refer them to the smoking-cessation counselling. We conducted a descriptive cross-sectional study of the entire staff of the Hospital University Center Mohammed VI, Marrakech based on the distribution of anonymous questionnaires. A total of 530 questionnaires were distributed, and 380 were returned, a response rate of 71.7%. The study population consisted of 58.2% women (n=221) and 41.8% men (n=159). Doctors (n=220) were the most represented occupational category (57.9%) followed by nurses (31.8%). Smokers (n=62) accounted for 16.3% of our study population; the ex-smokers (n=31) accounted for 8.1% and the non-smokers (n=287) 75.5%. The average age of smokers was 31.1 years, ranging from 22 to 56 years. The prevalence of smoking was 16.3% (n=62) of study population, of whom 32.7% (n=52) among men compared to 4.5% (n=10) among women. The average age of smoking onset was 19 years with a range from 11 to 29 years and with a mean consumption of 9 cigarettes/day. 13% (n=50) of people even smoked narguilé, 9% (n=34) consumed alcohol, and 3% (n=21) cannabis. 67.7% of smokers (n=42) were planning to quit, of whom 30.9% (n=13) in the next 3 months, 52.4% (n=22) in the next 6 months and 16, 7% (n=16) were planning to quit in the year. Several activities encouraged smoking, including night shift, coffee breaks and meals in 90.3% (n=56), 64.3% (n=40) and 61.3% (n=38) of cases respectively. This survey highlights the need to carry out awareness-raising actions to strengthen people motivation to quit smoking and help them during their withdrawal.
Estresse e enfrentamento em professores: uma análise da literatura
Directory of Open Access Journals (Sweden)
Kelly Ambrosio Silveira
2014-12-01
Full Text Available O estresse tem sido associado a problemas de saúde em professores, sendo importante compreender suas estratégias de enfrentamento (coping. Assim, o presente estudo revisou a literatura sobre estresse e coping em professores, com a análise dos principais resultados de pesquisas da área e de suas características metodológicas. Foram analisados artigos publicados entre 2006-2011 em bases internacionais do Portal Periódicos/CAPES, com as palavras-chave: stress, coping e teacher. Os 19 artigos sobre o tema disponíveis integralmente foram analisados. A partir desse material, procedeu-se análise relacionada ao estresse, às estratégias de enfrentamento e às suas implicações para o trabalho docente. É evidenciada a necessidade de práticas avaliativas e interventivas em atenção ao coping e aos sintomas de estresse, de modo a ampliar a compreensão sobre os processos que levem ao bem-estar docente e, consequentemente, à qualidade do ensino ofertado.
Directory of Open Access Journals (Sweden)
Dr. Maytham Qais Mutlaq م.د. ميثم قيس مطلك
2016-10-01
Full Text Available The city of Najaf, one of the Islamic metropolises known scientific, literary and intellectual Bnhitha, has occupied the leading position in those fields, I took masses of students oF science brings together elements from different races and. In addition it emerged where many scientific and literary figures that recorded a significant presence, not only in Najaf, but extended its impact to other parts, and picked up their names Olson Scientific and Cultural Organization. When remember Najaf little scientific and cultural prosperity, and when little scientists referred to them stigmatized. In a decade of demonstrated to the viewer and the listener aware of their flags extraordinary, but reference from references bones, known as the scientific, cultural and literary biography, namely Mr. Mohammed Mahdi Bahr al-Ulum. It -Ma- liver from the livers of the scientific community, OvzAvmaz of its men, as long as I knew the family (Al Bahr al-Ulum scientific Bntegha abundant, and servicing of the debt and service fields of knowledge is incalculable. Mr. Mohammed Mahdi Bahr al-Ulum along with his knowledge of religious sciences also found those who fought the midst of hair, and maturities in which his mind, and the systems in which the systems. The fight in poetry and pathos to say it is reminiscent of the famous proverb poet Farazdaq: (gouge sprocket lesser of the writing of one house of the hair. If the leadership of reference and take science seminary stood beside her hair culture, flow of that poetry of Mr. Bahr al-Ulum, Juma Mr. (Mohammed Sadeq al-Ulum, and got up to achieve all of (Mohammed JawadFakhruddin and (Haider Shaker grandfather. This Court, which came in two parts: the first contains two poems in the right AhlulBayt (peace be upon them, and II took his poems on several occasions. And the search for the specificities biography of literary and operated from an artistic and creative phenomena search long to say it, are flocking views it; so
History of Higher Education: Educational Reform and the Emergence of the Nursing Professorate.
Ruby, Jane
1999-01-01
In the late 19th century, visionary leaders pursued liberal education for nurses, moving nursing education from hospitals to universities. The nursing professorate might never have developed had nursing education remained under the jurisdiction of hospitals. (SK)
Marraccini, Marisa E.; Weyandt, Lisa L.; Rossi, Joseph S.
2015-01-01
Objective: This study developed and examined the psychometric properties of a newly formed measure designed to assess professor/instructor bullying, as well as teacher bullying occurring prior to college. Additionally, prevalence of instructor bullying and characteristics related to victims of instructor bullying were examined. Participants:…
Directory of Open Access Journals (Sweden)
Miguel Ataide Pinto da Costa
2012-09-01
Full Text Available Este estudo objetivou verificar a percepção de professores em relação aos problemas enfrentados por alunos obesos no ambiente escolar, bem como associar tais problemas à definição de bullying. Foram entrevistados 63 professores da rede estadual de um município da região metropolitana do Rio de Janeiro e a eles foi feita uma pergunta aberta referente aos problemas enfrentados pelos alunos acima do peso. Tal pergunta, propositalmente, não mencionava a palavra bullying. Os professores foram abordados pelo pesquisador principal nas escolas, em período destinado ao descanso ou durante momentos em que os alunos estivessem realizando atividades que não necessitassem da intervenção direta do professor. As respostas foram agrupadas em dezessete categorias e os resultados mostraram que, segundo os professores, o problema mais enfrentado pelos alunos acima do peso é o preconceito. Além disso, como problemas enfrentados por esses alunos, ainda foram apontadas a exclusão, a timidez e a baixa autoestima, dentre outros. Os resultados também mostraram atitudes negativas do professor com relação aos alunos, os quais algumas vezes foram descritos como apáticos, desanimados, cansados, lentos, distraídos, preguiçosos, indispostos etc.; esse dado indica a possibilidade de o próprio professor atuar como autor do bullying. Os resultados da pesquisa evidenciam que mais estudos devem ser desenvolvidos a fim de buscar melhor compreensão do papel do professor diante da discriminação de alunos acima do peso, mais especificamente do bullying, de forma a permitir maior aprofundamento no desenvolvimento de ações que visem promover a diversidade cultural nas escolas.The purpose of this study was to investigate the perception of teachers in regard of the problems faced obese students in the school, as well as to associate such problems with the definition of bullying. Sixty-three teachers from the public schools in a city belonging to the
Challenges of nursing teaching-learning to care for human dying - professors' perceptions
Directory of Open Access Journals (Sweden)
Emanuelle Caires Dias Araújo Nunes
2017-10-01
Full Text Available Abstract The objective of this study was to investigate professors' perceptions about their experiences in the teaching-learning process of nursing care in relation to dying. This is a descriptive-exploratory, qualitative research, delimited by data saturation, was carried out with 11 nursing professors from three higher education institutions. Data collection involved the drawing-text theme technique and a semi-structured interview. Analysis used the technique of collective subject discourse. The results identified three categories: How I would like to take care in the context of finitude - my challenge; Challenging fragilities in the teaching of nurses in the context of care concerned with death and dying; Strategies to compensate or promote more substantial nurse training related to care in finitude. We conclude that the graduation of the nurses studied did not satisfactorily develop the necessary skills and abilities to deal with human death and dying. This study infers the need of permanent education to support transformations in this area.
[Professor DONG Gui-rong's experience for the treatment of peripheral facial paralysis].
Cao, Lian-Ying; Shen, Te-Li; Zhang, Wei; Chen, Si-Hui
2012-05-01
Professor DONG Gui-rong's theoretical principle and manipulation points for peripheral facial paralysis were introduced in details from the angels of syndrome differentiation, timing, acupoint prescription and needling methods. For the syndrome differentiation and timing, the professor emphasized to check the treatment timing and follow the symptoms, which should be treated by stages, besides, it was necessary to find and distinguish the reason and nature of diseases to have a combined treatment of tendons and muscles. For the acupoint prescription and needling methods, he has proposed that the acupoints selection should be compatible of distal and lacal, and made a best of Baihui (GV 20) to regulate the whole yang qi, also he has paid much attention to the needling methods and staging treatment. Under the consideration of late stage of peripheral facial paralysis, based on syndrome differentiation Back-shu points have been selected to regulate zang-fu function, should achieve much better therapeutic effect.
Marcas no corpo, cansaço e experiência: nuances do envelhecer como professor de Educação Física
Directory of Open Access Journals (Sweden)
Sílvia Maria Agatti Lüdorf
2013-09-01
Full Text Available Este trabalho objetivou compreender e interpretar os significados que os professores de Educação Física atribuem ao corpo e envelhecimento, e investigar como tais representações influenciariam sua prática profissional. Participaram da investigação, de natureza qualitativa, 43 professores de escolas e academias de ginástica com cerca de trinta anos de formação. Os dados foram tratados mediante análise de conteúdo. O envelhecimento do professor propicia maturidade, experiência e confiança no trabalho, mas o corpo físico parece desprender-se do sujeito, repercutindo em sentimentos contraditórios relacionados ao envelhecimento. Nas academias, há certo ajuste ao contexto da visibilidade, pois são valorizadas as potencialidades e as marcas de saúde impressas no corpo. Já o desgaste e o cansaço são particularmente sentidos pelos professores atuantes em escola.
O professor que cativa: entre a narrativa da história e o cuidado de si
Directory of Open Access Journals (Sweden)
Marcello Paniz Giacomoni
2016-03-01
Full Text Available O presente artigo apresenta e discute os primeiros passos da pesquisa “Ensino de História e narrativas: o professor e a persuasão em sala de aula”, desenvolvida no Programa de Pós Graduação de Educação da UFRGS, em nível de doutorado, sob orientação do Prof. Dr. Fernando Seffner. Partindo de uma reflexão sobre o Ensino de História e analisando o caráter narrativo da história, passando por autores como Hayden White, Peter Gay, Jörn Rüsen, Paul Ricoeur, e Walter Benjamin, desejamos compreender quais estratégias são utilizadas pelos professores na construção de suas aulas. Interessa-nos compreender quais elementos narrativos e de estilo compõem um discurso histórico capaz de obter a adesão do auditório escolar, a partir de referenciais da Nova Retórica. Nessa análise, o que propomos é uma arte, relacionando a narrativa com a criação subjetiva e a experiência vivida (no caso, a experiência histórica, compreendendo como os professores de História elaboram o conhecimento historiográfico em suas aulas. Essa elaboração visa a negociar a distância entre o tempo passado e o momento do aluno, gerando momentos de encantamento ao poder da palavra. Ensino de História, professores,narrativas,estilo,nova retórica,
Relação família e escola no contexto da inclusão: opinião de professores pré-escolares
Directory of Open Access Journals (Sweden)
Laura Borges
2015-04-01
Full Text Available O objetivo deste estudo foi o de descrever como os professores de crianças pré-escolares avaliam a relação entre a família e a escola, considerando especificamente o processo de inclusão. Participaram da pesquisa 20 professoras pré-escolares. Para responder aos objetivos, as professoras preencheram um questionário. Dentre os resultados têm-se que: (a 65% dos professores apontaram a socialização como o principal fator da escola que pode influenciar o sucesso da criança; (b 70% dos professores apontaram que a boa relação família e escola é tida por meio de troca de informações e diálogo; (c 85% dos professores apontaram as reuniões de pais e 65% o uso de bilhetes, como estratégias que utilizam para se comunicar com os pais e (d 45% dos professores relataram informar os pais sobre o desenvolvimento/aprendizagem da criança, como uma das principais ajudas que podem oferecer aos pais. Nota-se a necessidade de intervenção com pais e professores para estreitar a relação entre eles, a fim de que possam favorecer o desenvolvimento e a aprendizagem da criança pré-escolar incluída.
The Forgetful Professor and the Space Biology Adventure
Massa, Gioia D.; Jones, Wanda; Munoz, Angela; Santora, Joshua
2014-01-01
This video was created as one of the products of the 2013 ISS Faculty Fellows Summer Program. Our High School science teacher faculty fellows developed this video as an elementary/middle school education component. The video shows a forgetful professor who is trying to remember something, and along the journey she learns more about the space station, space station related plant science, and the Kennedy Space Center. She learns about the Veggie hardware, LED lighting for plant growth, the rotating garden concept, and generally about space exploration and the space station. Lastly she learns about the space shuttle Atlantis.
Diversidade e adversidade na escola: queixas e conflitos de professores frente à educação inclusiva.
Claudia Dias Prioste
2006-01-01
Este trabalho, situado na linha de pesquisa Psicologia e Educação, teve como objetivo identificar as adversidades produzidas no ambiente escolar mediante as propostas textuais da educação inclusiva. Trata-se de uma pesquisa de cunho qualitativo que contou com vinte e seis professores de uma escola pública Estadual de São Paulo. Os professores foram convidados a participarem colaborativamente de dezesseis encontros que tiveram como proposta o debate sobre o tema da inclusão. Nestes debates, pr...
The Importance of the Professor in College Classroom Climate for Immigrant Students
Boesch, Becky
2014-01-01
This exploratory qualitative study examined the role that professors play in classroom climate for immigrant students within their first two years in higher education. The research questions were 1) How are immigrant students generally experiencing the climate of higher education classrooms? 2) How specifically does the immigrant student's…
Narrative of a Teaching Practice. An Autoethnography about Being a Geriatrics Professor
Bulgarelli, Alexandre F.; Toassi, Ramona F. C.
2018-01-01
This study was developed to show a professor's perspective to comprehend his difficulties and challenges, within a different scenario and culture of teaching geriatric dentistry in a nursing home. It was a self-analysis theoretically supported by the Social Constructionism and the Interpretative Autoethnography perspective. Data were constructed…
Tan, Tao; Yan, Jie
2016-01-01
The brief discussion is introduced in the paper on the academic thought of professor YAN Jie, the contemporary famous TCM doctor, on functional dyspepsia treated with acupuncture and moxibustion. Treatment based on "the three-regional acupoint selection" is applied to professor YAN's treatment for functional dyspepsia, in which, acupuncture is on Sibai (ST 2), Liangmen (ST 21) and Zusanli (ST 36), and the supplementary points are added accordingly. The academic thought is described as the combination of acupuncture and moxibustion based on strengthening healthy qi, supplemented by soothing the liver and psychological counseling. Also, an example is provided.
Professor Howard Mason and oxygen activation
International Nuclear Information System (INIS)
Waterman, Michael R.
2005-01-01
Our understanding of the classification, function, mechanism, and structure of the enzymes which incorporate atoms of oxygen from atmospheric molecular oxygen during catalysis is based on the thoughtful and technically challenging experiments of two giants in the field of Biochemistry, Howard Mason and Osamu Hayaishi. This volume celebrates the 50th anniversary of the discovery and characterization of these 'oxygenase' enzymes and provides a broad view of how far this area of research has advanced. Professor Hayaishi describes herein his perspective on the background and major discoveries which led to the development of this field. Regrettably Howard Mason passed away at age 88 in 2003. I am indeed fortunate to have been a Ph.D. student with Howard and to have the opportunity to briefly review his role in the development of this field for this special commemorative issue of BBRC
Institutional Support for the Virtual Professor
Directory of Open Access Journals (Sweden)
Tom JONES
2004-01-01
Full Text Available Academics who hold positions at single-mode, distance education institutions are presently being hampered by an adherence to a long-standing set of protocols (specific office location, face-to-face meetings that were put in place when the conventional post-secondary was the norm. With the advent of a powerful merging of personal computers and the internet, a shift from those protocols to one of support for the virtual professor is in the offing, to the benefit of both the professoriate and the student. A key factor in this shift is the degree and quality of institutional support that will allow these changes to take place. This paper focuses on a number of the key factors that will have to be addressed if this new type of distance education academic is to function effectively.
Directory of Open Access Journals (Sweden)
salah addin abdi
2014-12-01
Full Text Available Stylistic is disclosure laws creativity in literary discourse structure. And case under limitation in the idea of interdependence between the texts and to look at the texts in interdependence to only Angle comparison especially as were texts between different languages and what it was limited in literary texts turned out to be working round will be the technical side of any aesthetic. This literature poets any three Ahmed Shawki and Mohamed Hrawi Egyptians and Iranian poet Abbas yamini Sharif appear in children's literature be texture , beautiful word baptism imagination and purpose of the enjoyment of the small receiver and educated and refined . This literature poets look alike poets sing one topic in their hair for children is " Alktab " models of pedagogy in their poets be of standard noodles in a level voice , coordination and harmony between the internal and external music And role of repetition with different check rhythm music and show a sense of psychological and the emphasis on meaning. Be guaranteed their poets raising a child and learned, passion is pride and love of science and learning. The imagination in the poet be kind of yamini imagination Altaleva in while an innovative Shawki’s imagination and fantasy Hrawi graph. The study of each relying on poetic texts for all three of them and the energy of poetic language and its technical and creative aesthetic and stylistic comparison methodology which is lean on comparison mainly her and emerged from the comparison in two languages literary two would different Comparative Literature but of its focus on language and style .
Beck, Ivan T
2006-09-01
The present paper reviews the life and achievements of Professor Boris Petrovich Babkin (MD DSc LLD). History is only worth writing about if it teaches us about the future; therefore, this historical review concludes by describing what today's and future gastrointestinal physiologists could learn from Dr Babkin's life. Dr Babkin was born in Russia in 1877. He graduated with an MD degree from the Military Medical Academy in St Petersburg, Russia, in 1904. Not being attracted to clinical practice, and after some hesitation concerning whether he would continue in history or basic science of medicine, he entered the laboratory of Professor Ivan Petrovich Pavlov. Although he maintained an interest in history, in Pavlov's exciting environment he became fully committed to physiology of the gastrointestinal system. He advanced quickly in Russia and was Professor of Physiology at the University of Odessa. In 1922, he was critical of the Bolshevik revolution, and after a short imprisonment, he was ordered to leave Russia. He was invited with his family by Professor EH Starling (the discoverer of secretin) to his department at University College, London, England. Two years later, he was offered a professorship in Canada at Dalhousie University, Halifax, Nova Scotia. After contributing there for four years, he joined McGill University, Montreal, Quebec, in 1928 as Research Professor. He remained there for the rest of his career. Between 1940 and 1941, he chaired the Department, and following retirement, he remained as Research Professor. At the invitation of the world-famous neurosurgeon, Wilder Penfield, Dr Babkin continued as Research Fellow in the Department of Neurosurgery until his death in 1950 at age 73. His major achievements were related to establishing the concept of brain-gut-brain interaction and the influence of this on motility, as well as on interface of multiple different cells, nerves and hormones on secretory function. He had a major role in the rediscovery
A Politecnia nos Discursos Coletivos dos Professores do Ensino Médio Politécnico
Directory of Open Access Journals (Sweden)
Maria de Fatima Baldez Rodrigues
2017-12-01
Full Text Available Este trabalho discute a compreensão de politecnia no discurso coletivo de um grupo de 52 professores do 1º ano de 13 escolas do Ensino Médio Politécnico, de um município do Estado Rio Grande do Sul. No segundo semestre de 2016 e primeiro de 2017, foi realizada uma entrevista com um professor de cada área do conhecimento. O material discursivo foi analisado com a técnica do Discurso do Sujeito Coletivo – DSC. No discurso sobre a compreensão de politecnia, os professores apresentam questionamentos que evidenciam uma não apropriação desse conceito, delegando à equipe diretiva a responsabilidade por explicar o mesmo. Associam a politecnia ao ensino de diversas técnicas que preparam para o mercado de trabalho ou a integração das áreas do conhecimento. O estudo aponta que as diferentes propostas de reestruturação curriculares implementadas, como a do Ensino Médio Politécnico (2012 e a Base Nacional Comum Curricular (2017 são capazes de gerar confusão entre culturas por trazerem à tona questionamentos sobre as ideias, tecnologias e organização social da escola e potencializar o surgimento de outras culturas de formação docente.
Wang, Ruikang K.; Priezzhev, Alexander; Fantini, Sergio
2004-07-01
To honour Professor Valery Tuchin, one of the pioneers in biomedical optics, Journal of Physics D: Applied Physics invites manuscript submissions on topics in biomedical optics, for publication in a Special section in May 2005. Papers may cover a variety of topics related to photon propagation in turbid media, spectroscopy and imaging. This Special cluster will reflect the diversity, breadth and impact of Professor Tuchin's contributions to the field of biomedical optics over the course of his distinguished career. Biomedical optics is a recently emerged discipline providing a broad variety of optical techniques and instruments for diagnostic, therapeutic and basic science applications. Together with contributions from other pioneers in the field, Professor Tuchin's work on fundamental and experimental aspects in tissue optics contributed enormously to the formation of this exciting field. Although general submissions in biomedical optics are invited, the Special cluster Editors especially encourage submissions in areas that are explicitly or implicitly influenced by Professor Tuchin's contributions to the field of biomedical optics. Manuscripts submitted to this Special cluster of Journal of Physics D: Applied Physics will be refereed according to the normal criteria and procedures of the journal, in accordance with the following schedule: Deadline for receipt of contributed papers: 31 November 2004 Deadline for acceptance and completion of refereeing process: 28 February 2005 Publication of special issue: May 2005 Please submit your manuscript electronically to jphysd@iop.org or via the Web site at www.iop.org/Journals. Otherwise, please send a copy of your typescript, a set of original figures and a cover letter to: The Publishing Administrator, Journal of Physics D: Applied Physics, Institute of Physics Publishing, Dirac House, Temple Back, Bristol BS1 6BE, United Kingdom. Further information on how to submit may be obtained upon request by e-mailing the
Directory of Open Access Journals (Sweden)
Ângela Sá Azevedo
2012-08-01
Full Text Available Este artigo teve como objetivo explorar a relação entre a percepção do comportamento do professor e auto-regulação da aprendizagem na Matemática. As respostas de 625 alunos do 3ºciclo do Ensino Médio Português (7º ao 9º anos aos questionários QIPBásico e IPAAr permitiram perceber diferenças nas variáveis supracitadas em função do sexo, da idade, do ano de escolaridade e do número de retenções, do nível educacional dos pais, do sexo do professor de Matemática e do número de anos com o mesmo professor. As conclusões mais relevantes para a prática pedagógica prendem-se à relação positiva entre a auto-regulação da aprendizagem dos alunos e a percepção de liderança, apoio e compreensão por parte dos professores, e relação negativa entre a auto-regulação e a percepção de insatisfação, insegurança e repreensão dos seus professores.
Laboratórios de Ensino de História: refletindo e construindo com os professores
Directory of Open Access Journals (Sweden)
Maiara Cemin Cagliari
2015-07-01
Full Text Available O presente artigo tem o intuito de apresentar a importância e as formas de abrangência dos Laboratórios de Ensino dos Cursos de História. Buscaremos problematizar a atuação desses espaços na formação e qualificação dos futuros professores da educação básica, demonstrando sua importância na troca de experiências de ensino e aprendizagem, promovendo o auxílio aos alunos em estágios obrigatórios de docência. Visa a discutir também a importância que as atividades práticas oferecidas pelos espaços de apoio ao ensino possuem na relação entre teoria e prática e sua importância para a formação dos professores historiadores. Por fim, propomos uma reflexão sobre a importância das estratégias elaboradas pelos laboratórios de ensino de História da Universidade Federal do Rio Grande do Sul – LHISTE e da Universidade de Caxias do Sul - NAEH para estimular novas abordagens no ensino de História. Palavras-chave Ensino; História; Laboratório; Estratégias; Professores
Nonfixed Retirement Age for University Professors: Modeling Its Effects on New Faculty Hires.
Larson, Richard C; Diaz, Mauricio Gomez
2012-03-01
We model the set of tenure-track faculty members at a university as a queue, where "customers" in queue are faculty members in active careers. Arrivals to the queue are usually young, untenured assistant professors, and departures from the queue are primarily those who do not pass a promotion or tenure hurdle and those who retire. There are other less-often-used ways to enter and leave the queue. Our focus is on system effects of the elimination of mandatory retirement age. In particular, we are concerned with estimating the number of assistant professor slots that annually are no longer available because of the elimination of mandatory retirement. We start with steady-state assumptions that require use of Little's Law of Queueing, and we progress to a transient model using system dynamics. We apply these simple models using available data from our home university, the Massachusetts Institute of Technology.
Study on Providing Professors with Efficient Service Based on Time Management Strategy
Li, Chunlin; Liu, Mengchao; Wang, Yining
2016-01-01
Time management is the study to use time scientifically by deploying skills, techniques and means, and maximizing time value to help individuals or organizations efficiently complete tasks and achieve goals. University professor as a body is an important force in teaching and research. In order to ensure high-quality teaching, productive research,…
The status of acoustics in Nigeria: A paper in honour of Professor ...
African Journals Online (AJOL)
... countries of the world vis-à-vis that of the Federal Republic of Nigeria in promoting anti-noise laws, ordinances and other governmental acoustical matters that bother on noise. Expounded in this study are the published works of many Nigerians in acoustical physics as pioneered by Professor Alex I. Menkiti, the honoree.
The Education of a Librarian and Educator: Professor Satoru Takeuchi of Japan
Williams, Robert V.
2015-01-01
The early life and professional career of Dr. Satoru Takeuchi, a noted Japanese librarian, educator, and author, are explored here within the context of Japanese library education since World War II. Professor Takeuchi, now retired from the University of Library and Information Science (ULIS) in Tsukuba, Japan, has been an influential educator,…
Comparative Literature in Ireland and Worldwide – An Interview with Professor Declan Kiberd
Directory of Open Access Journals (Sweden)
Yulia Pushkarevskaya Naughton
2010-03-01
Full Text Available Professor Declan Kiberd is Chair of Anglo-Irish Literature and Drama at University College Dublin, where he has taught for many years after having taught at the University of Kent at Canterbury and Trinity College Dublin. He is a director of the Abbey Theatre. He has been Parnell Fellow at Magdalene College Cambridge, and a visiting professor at Duke University and the Sorbonne. He has also been Director of the Yeats International Summer School (1985-7, Patron of the Dublin Shaw Society (1995-2000, a columnist with The Irish Times (1985-7 and The Irish Press (1987-93, the presenter of the RTÉ Arts programme, Exhibit A(1984-6, and a regular essayist and reviewer in The Irish Times, TLS,London Review of Books and The New York Times. Professor Kiberd is the author of many books including his seminal Inventing Ireland: The Literature of the Modern Nation (1995, Irish Classics (2000, and The Irish Writer and the World (2005, as well as Ulysses and Us, published just this year, and he was also the editor of the Penguin edition of theAnnotated Students’ Ulysses (1992. He is one of the most important voices in Irish Studies. Beyond that, he is also a prominent public intellectual, and he continues to be an inspirational figure for generations of students. In this interview, we discussed the relevance of the comparative approach to Irish Studies and the future of Comparative Literature in Ireland and worldwide.
Alves, Luciano Padilha; Araújo, Laura Tathianne Ramos; Xavier Neto, José Augusto
2010-01-01
INTRODUÇÃO: A voz é o principal instrumento na vida profissional do professor, requerendo uma adaptação precisa dos órgãos da fonação. O desconhecimento da disfonia em professores de nossa região motivou esta pesquisa. OBJETIVOS: Avaliar a frequência de disfonia em professores do Ensino Fundamental da rede municipal em Maceió-AL e identificar sintomas associados às queixas vocais e possíveis fatores de risco ao aparecimento de alterações vocais. METODOLOGIA: Estudo transversal abrangendo 126 ...
Directory of Open Access Journals (Sweden)
Ana Claudia Paviani Casalli
2017-04-01
Full Text Available Este trabalho objetivou descrever o repertório de habilidades sociais, problemas de comportamento e a competência acadêmica de 15 crianças/adolescentes com surdez, na visão de professores de classe bilíngue, intérprete e de professores de classes comuns. Participaram deste estudo quatro professores e um intérprete, sendo dois de classe comum e dois de classe bilíngue. Utilizou-se como instrumento de coleta de dados, o Sistema de Avaliação de Habilidades Sociais (SSRS-BR. A avaliação dos professores para as três escalas do instrumento – Habilidades Sociais, Problemas de Comportamento e Competência Acadêmica – foi positiva, pois a maioria dos alunos foi classificada com repertórios medianos e altos. Os resultados ainda mostraram-se contrários à hipótese inicial, pois esperava-se que as professoras da classe bilíngue, por atuarem diretamente com os alunos surdos, utilizando a Libras como língua de instrução, pudessem avaliá-los de forma mais positiva, com relação às Habilidades Sociais, Problemas de Comportamento e Competência Acadêmica, quando comparados às avaliações dos professores da classe comum, o que não ocorreu. Conclui-se que de modo geral os alunos surdos foram avaliados com um repertório mediano de habilidades sociais e competência acadêmica, sendo os professores da classe comum os que fizeram avaliações mais positivas. Sugere-se que pesquisas com a utilização de outras medidas de avaliação sejam realizadas para aprofundar e confirmar os dados obtidos.
Crenças de eficácia, motivação e a formação de professores de Física
Directory of Open Access Journals (Sweden)
Fábio Ramos da Silva
2011-01-01
Full Text Available http://dx.doi.org/10.5007/2175-7941.2011v28n1p214 Este trabalho tem como objetivo discutir a relação entre formação acadêmica de professores de Física do Ensino Médio e algumas variáveis subjetivas. Essas variáveis estão relacionadas com os conceitos de Crenças de Eficácia Pessoal dos Professores de Física e Crenças de Eficácia Geral no Ensino de Física, conceitos estes inspirados na Teoria Social Cognitiva de Bandura (2005 e em teorizações de seus seguidores (WOOLFOLK; ROY, 1990; RIGGS; ENOCHS, 1990. Os dados foram coletados durante os anos de 2006 e 2007, mediante um questionário de perguntas fechadas, aplicado a 136 professores de escolas públicas e privadas das regiões de Maringá/PR, Assis/SP, Presidente Prudente/SP e Marília/SP. Para análise dos dados utilizamos uma metodologia de natureza quantitativa, especificamente o teste Kruskal-Wallis, na tentativa de relacionar alguns fatores que compõem as crenças citadas acima e a formação acadêmica dos professores de Física do Ensino Médio. Os resultados apresentam a formação específica do professor de Física como um condicionante positivo para as variáveis estudadas. Nesse sentido, a formação acadêmica do professor de Física é destacada como um importante fator na oferta de um ensino “motivador”. Esse é um grande desafio em nosso país, pois temos um grande déficit de licenciados nessa disciplina (GOBARA; GARCIA, 2007. Paralelamente à oferta de formação adequada para professores de Física, é necessária a preocupação em oferecer condições e incentivos para a permanência desses profissionais na profissão, sobretudo, nas escolas públicas.
Assistant professor wins grant to help enrich graduate student careers with e-portfolios
Mackay, Steven D.
2010-01-01
Lisa McNair, an assistant professor with the department of engineering education, has won a $403,000 National Science Foundation Faculty Early Career Development (CAREER) grant to help engineering graduate students develop as reflective practitioners by using e-portfolios that could enrich their own careers.