Energy Technology Data Exchange (ETDEWEB)
Tahmasebi, Elham [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of); Shakerzadeh, Ehsan, E-mail: e.shakerzadeh@scu.ac.ir [Chemistry Department, Faculty of Science, Shahid Chamran University, Ahvaz (Iran, Islamic Republic of); Biglari, Zeinab [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of)
2016-02-15
Graphical abstract: - Highlights: • Encapsulation of Li, Na and K narrow the HOMO–LUMO gaps of the clusters. • The group III nitrides nanoclusters strongly interacted with the alkali metals. • First hyperpolarizabilities remarkably enhance for B{sub 12}N{sub 12} encapsulated with Na/K. - Abstract: Density functional theory (DFT) calculations have been carried out to study the influence of alkali metals (Li, Na and K) encapsulation within the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and the group IV carbides (C{sub 24}, Si{sub 12}C{sub 12}and Ge{sub 12}C{sub 12}) nanoclusters. The encapsulation of Li, Na and K atoms is found to narrow the HOMO–LUMO gaps of the considered clusters. The electronic properties of these clusters, especially the group III nitrides nanoclusters, are strongly sensitive to interaction with the alkali metals. Moreover it is observed that the encapsulation of alkali metals enhances the first hyperpolarizabilities of B{sub 12}N{sub 12} nanocluster. Surprisingly, due to the alkali metals encapsulation within B{sub 12}N{sub 12} nanocluster, the first hyperpolarizability values are remarkably increased to 8505.49 and 122,503.76 a.u. for Na@B{sub 12}N{sub 12} and K@B{sub 12}N{sub 12}, respectively. Also the TD-DFT calculations at both CAM-B3LYP/6-311+G(d) and PBE0/6-311+G(d) levels of theory are also performed to investigate the origin of first hyperpolarizabilities.
Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections
Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.
2012-01-01
The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.
Self-Help Groups and Professional Helpers.
Balgopal, Pallassana R.; And Others
1986-01-01
Suggests innovative solutions for mutual benefits for self-help groups and the professionals. Through a derivative paradigm the role of the professional helper within self-help groups is presented. (Author/BL)
Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets
International Nuclear Information System (INIS)
Swamy, K.S.K.
1987-01-01
The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)
A.M.C. Dooremalen; J. van Hoof; H.T.G. Weffers; M.H. Wetzels; MD E.J.M. Wouters
2014-01-01
J. van Hoof, A.M.C. Dooremalen, M.H. Wetzels, H.T.G. Weffers, E.J.M. Wouters (2014) Exploring technological and architectural solutions for nursing home residents, care professionals and technical staff: Focus groups with professional stakeholders. International Journal for Innovative Research in
Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)
International Nuclear Information System (INIS)
Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi
1982-01-01
Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)
Gregoire, Marc
2014-01-01
Master complex C++ programming with this helpful, in-depth resource From game programming to major commercial software applications, C++ is the language of choice. It is also one of the most difficult programming languages to master. While most competing books are geared toward beginners, Professional C++, Third Edition, shows experienced developers how to master the latest release of C++, explaining little known features with detailed code examples users can plug into their own codes. More advanced language features and programming techniques are presented in this newest edition of the book,
Ao, Mingqi; Xu, Guiying; Pang, Jinyu; Zhao, Taotao
2009-09-01
The aggregation of ionic liquid-type imidazolium gemini surfactant [C(12)-4-C(12)im]Br(2) on silicon wafer, which is compared with its monomer [C(12)mim]Br, have been studied. AFM morphology images and contact angle measurements suggest that the aggregations of [C(12)-4-C(12)im]Br(2) and [C(12)mim]Br on silicon wafer follow different mechanisms. Below the critical surface aggregation concentrations (CSAC), both surfactant molecules are adsorbed with their hydrophobic tails facing the air. But above the CSAC, [C(12)-4-C(12)im]Br(2) molecules finally form a bilayer structure with hydrophilic head groups facing the air, whereas [C(12)mim]Br molecules form a multilayer structure, and with increasing its concentration, the layer numbers increase with the hydrophobic chains and hydrophilic head groups facing the air by turns. Besides, the watery wettability of [C(12)-4-C(12)im]Br(2)-treated silica surface is lower than that of [C(12)mim]Br at the concentration of 5.0 cmc, and the infrared spectroscopy suggests that the poorer watery wettability of [C(12)-4-C(12)im]Br(2) may be relative to the less-ordered packing of methylene chains inside the aggregate. These different aggregation behaviors for the two surfactants ascribe to the different molecular structures and electrostatic interactions. This work would have certain theoretical guidance meaning on the modification of solid surface.
Dooremalen, A.M.C.; van Hoof, J.; Weffers, H.T.G.; Wetzels, M.H.; Wouters, E.J.M.
2014-01-01
J. van Hoof, A.M.C. Dooremalen, M.H. Wetzels, H.T.G. Weffers, E.J.M. Wouters (2014) Exploring technological and architectural solutions for nursing home residents, care professionals and technical staff: Focus groups with professional stakeholders. International Journal for Innovative Research in Science & Technology 1(3): 90-105
Cross sections for 12C+12C→12C(0+2)+12C(g.s.) using breathing mode doorways
International Nuclear Information System (INIS)
Ahmed, M.U.; Beres, W.P.
1982-01-01
A previously derived projection operator method is applied to the calculation of the cross section for 12 C+ 12 C→ 12 C(0 + 2 )+ 12 C(g.s.) with a breathing mode model being used to describe the 0 + 2 (7.68 MeV) state of 12 C. The relationship to processes leading to alpha particle channels is discussed. The cross section for 12 C+ 12 C→ 12 C(3 - )+ 12 C(g.s.) is also calculated and possible correlations with inelastic scattering to the 0 + 2 and 2 + states of 12 C are discussed. The results for both 0 + 2 and 3 - inelastic scattering are in reasonable agreement with experiment
Microscopic investigation of the 12C + 12C interaction
International Nuclear Information System (INIS)
Baye, D.; Pecher, N.; Brussels Univ.
1982-01-01
The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)
Excitation functions of the systems 12C+14C and 13C+12C
International Nuclear Information System (INIS)
Haindl, E.
1975-01-01
The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de
DEFF Research Database (Denmark)
Faldt, André; Krebs, Frederik C; Thorup, Niels
1997-01-01
of opposite chirality are present within the unit cell, Finally compound 13 crystallises in a centrosymmetric space group. The room temperature pyroelectric coefficient of 3 has been determined, The spatial extent of the trioxatriangulene ground system has been perturbed by chemical substitution......4,8,12-Trioxa-4,8,12,12c-tetrahydrodibenzo [cd,mn]pyrene (3),2,6,10-tri-tert-butyl-4,8,12 -trioxa-4,8,12,12c-tetrahydrodibenzo [cd,mn]pyrene (11) and 2,6,10-tri-tert-butyl-4,8,12-trioxa-12c -methyl-4,8,12,12c -tetrahydrodibenzo[cd,mn]pyrene (12)have been synthesised and their crystal structures...... and the effect: of the substitutions upon the space group symmetry of the chemical derivative has been uncovered by X-ray structural resolution, The non-centrosymmetric point group symmetry of the molecules is reflected in a non-centrosymmetric space group symmetry whenever the spatial perturbations do...
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Screening effects on 12C+12C fusion reaction
Koyuncu, F.; Soylu, A.
2018-05-01
One of the important reactions for nucleosynthesis in the carbon burning phase in high-mass stars is the 12C+12C fusion reaction. In this study, we investigate the influences of the nuclear potentials and screening effect on astrophysically interesting 12C+12C fusion reaction observables at sub-barrier energies by using the microscopic α–α double folding cluster (DFC) potential and the proximity potential. In order to model the screening effects on the experimental data, a more general exponential cosine screened Coulomb (MGECSC) potential including Debye and quantum plasma cases has been considered in the calculations for the 12C+12C fusion reaction. In the calculations of the reaction observables, the semi-classical Wentzel-Kramers-Brillouin (WKB) approach and coupled channel (CC) formalism have been used. Moreover, in order to investigate how the potentials between 12C nuclei produce molecular cluster states of 24Mg, the normalized resonant energy states of 24Mg cluster bands have been calculated for the DFC potential. By analyzing the results produced from the fusion of 12C+12C, it is found that taking into account the screening effects in terms of MGECSC is important for explaining the 12C+12C fusion data, and the microscopic DFC potential is better than the proximity potential in explaining the experimental data, also considering that clustering is dominant for the structure of the 24Mg nucleus. Supported by the Turkish Science and Research Council (TÜBİTAK) with (117R015)
Investigation of low spin resonances in the 12C+12C and 16O+12C systems
International Nuclear Information System (INIS)
Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.
1979-01-01
The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr
Lopez-Valladares, Gloria; Danielsson-Tham, Marie-Louise; Goering, Richard V; Tham, Wilhelm
2017-01-01
Among 504 clinical lineage II isolates of Listeria monocytogenes isolated during 1958-2010 in Sweden, 119 pulsed-field gel electrophoresis (PFGE) types (AscI) have been identified based on the number and distribution of all banding patterns in each DNA profile. In this study, these types were further divided into PFGE groups based on the configuration of small bands with sizes kb. The 504 isolates included 483 serovar 1/2a isolates distributed into 114 PFGE types and 21 serovar 1/2c isolates distributed into 9 PFGE types; these were further divided into 21 PFGE groups. PFGE group, that is, configuration of small bands below 145.5 kb, and serovars were correlated. L. monocytogenes isolates belonging to PFGE groups A, B, C, E, F, H, K, L, M, S, V, W, Y, and Ö-6 to Ö-12 shared serovar 1/2a, with one exception. PFGE group E also included two PFGE types sharing serovar 1/2c and four PFGE types belonging to either serovar 1/2a or 1/2c. Isolates belonging to PFGE group N shared serovar 1/2c. In contrast to lineage I isolates, small fragments kb were visible in all L. monocytogenes isolates belonging to lineage II. In the results from both the present and previous studies, the genomic region of small bands was genetically more conservative than in large bands. The distribution of these small bands established the relatedness of strains and defined a genetic marker for both lineages I and II, while also establishing their serogroup. The division of L. monocytogenes PFGE types into PFGE groups is advantageous as the profile of every new isolate can be identified easily and quickly through first studying the PFGE group affiliation of the isolate based on the smaller band patterns kb, and then identifying the PFGE type based on the band patterns >145.5 kb.
Effect of mentoring on professional values in model C clinical nurse leader graduates.
Gazaway, Shena B; Anderson, Lori; Schumacher, Autumn; Alichnie, Chris
2018-04-19
Nursing graduates acquire their nursing values by professional socialization. Mentoring is a crucial support mechanism for these novice nurses, yet little is known about the model C clinical nurse leader graduate and the effects of mentoring. This investigation examined how mentoring affected the development of professional nursing values in the model C clinical nurse leader graduate. A longitudinal design was used to survey model C clinical nurse leader graduates before and after graduation to determine how different types of mentoring relationships influenced professional values. Demographic surveys documented participant characteristics and the Nurses Professional Values Scale - Revised (NPVS-R) assessed professional nursing values. Mean NPVS-R scores increased after graduation for the formally mentored participants, while the NPVS-R scores decreased or remained unchanged for the other mentoring groups. However, no significant difference was found in NPVS-R scores over time (p = .092) or an interaction between the NPVS-R scores and type of mentoring relationships (p = .09). These results suggest that model C clinical nurse leader graduate participants experiencing formal mentoring may develop professional nursing values more than their colleagues. Formal mentoring relationships are powerful and should be used to promote professional values for model C clinical nurse leader graduates. © 2018 John Wiley & Sons Ltd.
Group cohesion in sports teams of different professional level
Directory of Open Access Journals (Sweden)
Vazha M. Devishvili
2017-12-01
Full Text Available Background. Team sports are not only the most exciting sporting events. but also complex activities that make serious demands on players. The effectiveness of the team depends not only on the high level of gaming interaction. but also on the relationship between the players. The work is based on the material of sports teams and is devoted to the study of the phenomenon of group cohesion. As a basic model. the authors choose a 4-factor model that describes cohesion in sports teams. The paper also considered the phenomenon of the emergence of the aggregate subject in the process of joint activity. when the participants feel themselves as a whole and experience feelings of satisfaction and a surge of energy. Objective. The main objective of the work is to investigate the relationship between the level of team cohesion and subjective feelings of unity of its players. As additional variables in the study there is a sport (football and volleyball and team level (amateur and professional. To test the assumptions. two methods were used (the Sport Team Cohesion Questionnaire and the Subject Unity Index. which allow not only to determine the overall level of cohesion and unity. but also to reveal the structure of both phenomena. The study involved two men’s volleyball and two men’s football teams of different ages: 8-9 years (39 athletes; 12-14 years (24 athletes and 18-25 years (41 athletes. Design. For amateur groups represented by children’s and teenage sports teams. significant correlations between unity and unity were obtained (r = 0.618. p <0.01; r = 0.477. p <0.05. For professional teams. no significant correlations were found. Influence of the sport on cohesion is also different for amateur and professional teams. In the first case. the cohesion is higher for football players (U = 118. p <0.05. and in the second case for volleyball players (U = 124. p <0.05. Results. The findings indicate that the professional level of players affects group
Shamsudeen, Riyaj; Yu, Kai; Farooq, Tariq
2013-01-01
Expert Oracle RAC 12c is a hands-on book helping you understand and implement Oracle Real Application Clusters (RAC), and to reduce the total-cost-of-ownership (TCO) of a RAC database. As a seasoned professional, you are probably aware of the importance of understanding the technical details behind the RAC stack. This book provides deep understanding of RAC concepts and implementation details that you can apply toward your day-to-day operational practices. You'll be guided in troubleshooting and avoiding trouble in your installation. Successful RAC operation hinges upon a fast-performing netwo
12 CFR 564.6 - Professional association membership; competency.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Professional association membership; competency. 564.6 Section 564.6 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPRAISALS § 564.6 Professional association membership; competency. (a) Membership in appraisal organizations...
Professional groups driving change toward patient-centred care
DEFF Research Database (Denmark)
Burau, Viola; Carstensen, Kathrine; Lou, Stina
2017-01-01
BACKGROUND: Patient-centred care based on needs has been gaining momentum in health policy and the workforce. This creates new demand for interprofessional teams and redefining roles and tasks of professionals, yet little is known on how to implement new health policies more effectively. Our aim...... was to analyse the role and capacity of health professions in driving organisational change in interprofessional working and patient-centred care. METHODS: A case study of the introduction of interprofessional, early discharge teams in stroke rehabilitation in Denmark was conducted with focus on day......-to-day coordination of care tasks and the professional groups' interests and strategies. The study included 5 stroke teams and 17 interviews with different health professionals conducted in 2015. RESULTS: Professional groups expressed highly positive professional interest in reorganised stroke rehabilitation...
Self-help groups for former patients: relations with mental health professionals.
Emerick, R E
1990-04-01
Data from a national survey of 104 self-help groups for former mental patients were examined to assess actual and potential partnerships between these groups and mental health professionals. The groups' level of interaction with and attitudes toward professionals varied with the structure, affiliation, and service model of the groups. The majority were moderate "supportive" groups in which partnerships with professionals could occur but were problematic. Less common were radical "separatist" groups, with which professional partnerships were almost guaranteed to fail, and conservative "partnership" groups, with which partnerships were likely to succeed. Strong antipsychiatric attitudes throughout the mental patient movement suggest that mental health professionals who approach former-patient groups with narrow clinical conceptions of mental illness are likely to fail in establishing partnerships.
12 CFR 411.300 - Professional and technical services.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Professional and technical services. 411.300 Section 411.300 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Other Than Own Employees § 411.300 Professional and technical services. (a) The prohibition on...
12 CFR 411.205 - Professional and technical services.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Professional and technical services. 411.205 Section 411.205 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.205 Professional and technical services. (a) The prohibition on the use of...
Search for 12 C+ 12 C clustering in 24 Mg ground state
Indian Academy of Sciences (India)
In the backdrop of many models, the heavy cluster structure of the ground state of 24 Mg has been probed experimentally for the first time using the heavy cluster knockout reaction 24 Mg( 12 C, 212 C) 12 C in thequasifree scattering kinematic domain. In the ( 12 C, 212 C) reaction, the direct 12 C-knockout cross-section was ...
Critical Friends Group for EFL Teacher Professional Development
Vo, Long Thanh; Nguyen, Hoa Thi Mai
2010-01-01
For the best student outcomes, teachers need to engage in continuous professional development. As a result, models of teacher professional development have been developed, among which is the Critical Friends Group (CFG) technique. However, whether it works well with EFL teachers in an Asian context like Vietnam, where EFL teachers in particular do…
Rothes, Inês Areal; Henriques, Margarida Rangel
2017-12-01
In a help relation with a suicidal person, the theoretical models of suicidality can be essential to guide the health professional's comprehension of the client/patient. The objectives of this study were to identify health professionals' explanations of suicidal behaviors and to study the effects of professional group, theoretical intervention models, and patient suicide experience in professionals' representations. Two hundred and forty-two health professionals filled out a self-report questionnaire. Exploratory principal components analysis was used. Five explanatory models were identified: psychological suffering, affective cognitive, sociocommunicational, adverse life events, and psychopathological. Results indicated that the psychological suffering and psychopathological models were the most valued by the professionals, while the sociocommunicational was seen as the least likely to explain suicidal behavior. Differences between professional groups were found. We concluded that training and reflection on theoretical models in general and in communicative issues in particular are needed in the education of health professionals.
Pycnonuclear 12C+12C reaction at zero temperature
International Nuclear Information System (INIS)
Gasques, L R; Beard, M; Chamon, L C; Wiescher, M
2005-01-01
We present pycnonuclear reaction calculations for a one-component ionic crystal at zero temperature considering different theoretical approaches. The rates depend directly on the determination of the astrophysical S-factor at low energies, which has been obtained through the barrier penetration formalism. A totally parameter-free model for the real part of the nuclear interaction has been employed in the calculation of 12 C+ 12 C fusion cross sections
Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands
International Nuclear Information System (INIS)
Amiot, C.
1983-01-01
The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41
Inelastic 12C(12C, 12C)12C scattering via the Glauber optical potential at E/A=30 MeV and 85 MeV
International Nuclear Information System (INIS)
Chauvin, J.; Lebrun, D.; Durand, F.; Buenerd, M.
1984-07-01
It is shown that some approximations implied in the optical limit of the Glauber theory are justified for low energies heavy-ions surface collisions. The Glauber optical potential -with no free parameters- leads to reasonable predictions for both elastic and inelastic scattering in the 12 C + 12 C system
Operational, professional, and business characteristics of radiology groups in the United States.
Sunshine, J H; Bansal, S
1992-05-01
To learn the main operational, professional, and business characteristics of U.S. radiology group practices, researchers at the American College of Radiology surveyed these groups. Major findings included the following: Approximately 30% of groups provide only diagnostic radiologic services, a similar percentage provides only radiation therapy for oncologic patients, and the remainder provides both types of services. Forty-one percent of groups practice only in hospitals, 11% practice only in an office, and 48% practice in both settings. Diagnostic-only practices average 10,000-12,000 procedures per full-time equivalent radiologist per year. Groups typically require new members to be part of the group for almost 3 years before they become full partners. Formal call schedules are nearly universal among radiology groups. Groups are becoming increasingly involved with health maintenance organizations and other "alternative delivery systems," but fee-for-service remains by far the dominant source of groups' revenue. Most studied characteristics of groups are changing relatively slowly, and trends are generally toward increasing formalization of arrangements.
Application of inverse kinematics to 1H+23Na→12C+12C
International Nuclear Information System (INIS)
Bennett, S.J.; Clarke, N.M.; Freer, M.; Fulton, B.R.; Hall, S.J.; Karban, O.; Murgatroyd, J.T.; Tungate, G.; Gyapong, G.J.; Jarvis, N.S.; Watson, D.L.; Rae, W.D.M.; Smith, A.E.; Lilley, J.S.; Woods, P.J.; Page, R.D.
1993-01-01
Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the 1 H( 23 Na, 12 C) 12 C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in 24 Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the 23 Na(p, 12 C) 12 C reaction. (orig.)
Neuman, Donald R.
This study compared the effects of professional and subprofessional counselors using group insight and group desensitization techniques with high and low imagery arousal test anxious college students. Two professional and two subprofessional counselors met with groups of three students for five interviews to administer insight and desensitization…
Infrared Astronomy Professional Development for K-12 Educators: WISE Telescope
Borders, Kareen; Mendez, B. M.
2010-01-01
K-12 educators need effective and relevant astronomy professional development. WISE Telescope (Wide-Field Infrared Survey Explorer) and Spitzer Space Telescope Education programs provided an immersive teacher professional development workshop at Arecibo Observatory in Puerto Rico during the summer of 2009. As many common misconceptions involve scale and distance, teachers worked with Moon/Earth scale, solar system scale, and distance of objects in the universe. Teachers built and used basic telescopes, learned about the history of telescopes, explored ground and satellite based telescopes, and explored and worked on models of WISE Telescope. An in-depth explanation of WISE and Spitzer telescopes gave participants background knowledge for infrared astronomy observations. We taught the electromagnetic spectrum through interactive stations. The stations included an overview via lecture and power point, the use of ultraviolet beads to determine ultraviolet exposure, the study of WISE lenticulars and diagramming of infrared data, listening to light by using speakers hooked up to photoreceptor cells, looking at visible light through diffraction glasses and diagramming the data, protocols for using astronomy based research in the classroom, and infrared thermometers to compare environmental conditions around the observatory. An overview of LIDAR physics was followed up by a simulated LIDAR mapping of the topography of Mars. We will outline specific steps for K-12 infrared astronomy professional development, provide data demonstrating the impact of the above professional development on educator understanding and classroom use, and detail future plans for additional K-12 professional development. Funding was provided by WISE Telescope, Spitzer Space Telescope, Starbucks, Arecibo Observatory, the American Institute of Aeronautics and Astronautics, and the Washington Space Grant Consortium.
Absolute cross sections measurement for the 12C + 12C system at astrophysically relevant energies
International Nuclear Information System (INIS)
Barron-Palos, L.; Aguilera, E.F.; Aspiazu, J.; Huerta, A.; Martinez-Quiroz, E.; Monroy, R.; Moreno, E.; Murillo, G.; Ortiz, M.E.; Policroniades, R.; Varela, A.; Chavez, E.
2006-01-01
The 12 C + 12 C fusion reaction has been studied in the center-of-mass energy range of 2.25 to 6.01 MeV. Through the detection of gamma rays from the first excited states of the residual nuclei 20 Ne, 23 Na and 23 Mg, absolute cross sections for the 12 C( 12 C,-bar α), 12 C( 12 C,-bar p) and 12 C( 12 C,-bar n) reactions have been obtained. In this new measurement, the energy dependence of the S-factor is found to increase as the energy decreases below 3 MeV in the center of mass. This tendency was observed in previous measurements by Mazarakis et al., and has since then become a subject of controversy. In this work, where the cross sections are measured at even lower energies, we confirm the rise in the S-factor toward the energy region relevant for star evolution and nucleosynthesis calculations (E c.m. =1-3 MeV)
Charity Hudley, Anne H.; Mallinson, Christine
2017-09-01
Professional development on issues of language and culture is often separate from professional development on issues related to STEM education, resulting in linguistic and cultural gaps in K-12 STEM pedagogy and practice. To address this issue, we have designed a model of professional development in which we work with educators to build cultural and linguistic competence and to disseminate information about how educators view the relevance of language, communication, and culture to STEM teaching and learning. We describe the design and facilitation of our model of culturally and linguistically responsive professional development, grounded in theories of multicultural education and culturally supportive teaching, through professional development workshops to 60 K-12 STEM educators from schools in Maryland and Virginia that serve African American students. Participants noted that culturally and linguistically responsive approaches had yet to permeate their K-12 STEM settings, which they identified as a critical challenge to effectively teaching and engaging African-American students. Based on pre-surveys, workshops were tailored to participants' stated needs for information on literacy (e.g., disciplinary literacies and discipline-specific jargon), cultural conflict and mismatch (e.g., student-teacher miscommunication), and linguistic bias in student assessment (e.g., test design). Educators shared feedback via post-workshop surveys, and a subset of 28 participants completed in-depth interviews and a focus group. Results indicate the need for further implementation of professional development such as ours that address linguistic and cultural issues, tailored for K-12 STEM educators. Although participants in this study enumerated several challenges to meeting this need, they also identified opportunities for collaborative solutions that draw upon teacher expertise and are integrated with curricula across content areas.
Study of the alpha+12C →16O capture via 12C(16O,12C)16O transfer reaction
International Nuclear Information System (INIS)
Morais, M.C.; Lichtenthaeler, R.; Arazi, A.; Hojman, D.; Cardona, M.A.; Fimiani, L.; Carnelli, P.F.; Marti, G.V.; Pacheco, A.J.; Heimann, D. Martinez; Negri, A.E.; Capurro, O.A.; Niello, J.O. Fernandez; Montero, P.
2009-01-01
Full text: The 12 C(α γ) 16 O reaction is one of the most important in nuclear astrophysics. The rate of this reaction influences the subsequent nucleosynthesis of heavier elements in massive stars and consequently determines the stellar evolution. The 12 C(α γ) 16 O reaction cross section is extremely small at stellar temperature, this is mainly due to the Gamow energy (∼ 300KeV at T= 2x10 8 K) be much lower than the Coulomb barrier, E C.B. : = 3:142MeV. The α+ 12 C → 16 O at low energies is dominated by subthreshold states (1 - , 7:12MeV) and (2 + , 6:92MeV) of the 16 O, thus spectroscopic factors measurements of these states are very important. We propose to use the α-transfer reaction 12 C( 16 O, 12 C) 16 O * at very forward angles to obtain those spectroscopic factors. In this way, measurements of elastic and inelastic angular distributions for the 12 C+ 16 O system were performed at the TANDAR Laboratory in Buenos Aires, using an 16 O beam of E lab = 46.3MeV. These angular distributions were obtained using 8 adjacent surface barrier detectors and the measurements were performed from 5 deg to 48.5 deg with steps of 1 deg. The scattering chamber has an angular precision better than 0.1 deg. The transfer angular distributions are being analysed by DWBA using the computer code FRESCO in order to obtain the two spectroscopic factors. (author)
Emission of particles in the 12 C + 12 C fusion
International Nuclear Information System (INIS)
Martinez Q, E.; Aguilera, E.F.; Rosales, P.
2002-01-01
A fusion process analysis of the 12 C + 12 C reaction is done, using the LILITA program. The analysis consisted mainly in varying the value of the Levels density parameter, determining on this way the value of such parameter which reproduces better the contribution of the different channels of fusion-evaporation of particles for this system at different energies. Moreover a comparison with measures done in the Instituto Nacional de Investigaciones Nucleares is realized. (Author)
2013-04-18
... subadvisory agreements (``Subadvisory Agreements'') with Chicago Fundamental Investment Partners, LLC, First... SECURITIES AND EXCHANGE COMMISSION [Investment Company Act Release No. 30460; 812-14113] Trust for Professional Managers and Aurora Investment Management L.L.C.; Notice of Application April 12, 2013. AGENCY...
Search for 12 C+ 12 C clustering in 24 Mg ground state
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 2. Search for 12C+12C clustering in 24Mg ground state. B N JOSHI ARUN K JAIN D C BISWAS B V JOHN Y K GUPTA L S DANU R P VIND G K PRAJAPATI S MUKHOPADHYAY A SAXENA. Regular Volume 88 Issue 2 February 2017 Article ID 29 ...
THE {sup 12}C + {sup 12}C REACTION AND THE IMPACT ON NUCLEOSYNTHESIS IN MASSIVE STARS
Energy Technology Data Exchange (ETDEWEB)
Pignatari, M. [Department of Physics, University of Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Hirschi, R.; Bennett, M. [Astrophysics Group, EPSAM Institute, Keele University, Keele, ST5 5BG (United Kingdom); Wiescher, M.; Beard, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Gallino, R. [Universita' di Torino, Torino, Via Pietro Giuria 1, I-10126 Torino (Italy); Fryer, C.; Rockefeller, G. [Computational Physics and Methods (CCS-2), LANL, Los Alamos, NM 87545 (United States); Herwig, F.; Timmes, F. X., E-mail: marco.pignatari@unibas.ch [The Joint Institute for Nuclear Astrophysics, Notre Dame, IN 46556 (United States)
2013-01-01
Despite much effort in the past decades, the C-burning reaction rate is uncertain by several orders of magnitude, and the relative strength between the different channels {sup 12}C({sup 12}C, {alpha}){sup 20}Ne, {sup 12}C({sup 12}C, p){sup 23}Na, and {sup 12}C({sup 12}C, n){sup 23}Mg is poorly determined. Additionally, in C-burning conditions a high {sup 12}C+{sup 12}C rate may lead to lower central C-burning temperatures and to {sup 13}C({alpha}, n){sup 16}O emerging as a more dominant neutron source than {sup 22}Ne({alpha}, n){sup 25}Mg, increasing significantly the s-process production. This is due to the chain {sup 12}C(p, {gamma}){sup 13}N followed by {sup 13}N({beta} +){sup 13}C, where the photodisintegration reverse channel {sup 13}N({gamma}, p){sup 12}C is strongly decreasing with increasing temperature. Presented here is the impact of the {sup 12}C+{sup 12}C reaction uncertainties on the s-process and on explosive p-process nucleosynthesis in massive stars, including also fast rotating massive stars at low metallicity. Using various {sup 12}C+{sup 12}C rates, in particular an upper and lower rate limit of {approx}50,000 higher and {approx}20 lower than the standard rate at 5 Multiplication-Sign 10{sup 8} K, five 25 M {sub Sun} stellar models are calculated. The enhanced s-process signature due to {sup 13}C({alpha}, n){sup 16}O activation is considered, taking into account the impact of the uncertainty of all three C-burning reaction branches. Consequently, we show that the p-process abundances have an average production factor increased up to about a factor of eight compared with the standard case, efficiently producing the elusive Mo and Ru proton-rich isotopes. We also show that an s-process being driven by {sup 13}C({alpha}, n){sup 16}O is a secondary process, even though the abundance of {sup 13}C does not depend on the initial metal content. Finally, implications for the Sr-peak elements inventory in the solar system and at low metallicity are
Energy Technology Data Exchange (ETDEWEB)
Martinez Q, E.; Aguilera, E.F.; Rosales, P. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
2002-07-01
A fusion process analysis of the {sup 12} C + {sup 12} C reaction is done, using the LILITA program. The analysis consisted mainly in varying the value of the Levels density parameter, determining on this way the value of such parameter which reproduces better the contribution of the different channels of fusion-evaporation of particles for this system at different energies. Moreover a comparison with measures done in the Instituto Nacional de Investigaciones Nucleares is realized. (Author)
International Nuclear Information System (INIS)
Imanishi, B.; Denisov, V.; Motobayashi, T.
1996-10-01
The charge-symmetric scattering systems, 12 C+ 13 N and 12 C+ 13 C have been investigated by using the orthogonalized coupled-reaction-channel (OCRC) method with the basis functions of the elastic, inelastic and transfer channels defined by the single-particle states, 1p1/2, 2s1/2, 1d5/2 and 1d3/2 of the valence nucleon in 13 N or 13 C. The data of the elastic scattering of 13 N on 12 C measured by Lienard et al. have been explained consistently with the data of the elastic and inelastic scattering of the 12 C+ 13 C system. The CRC effects both on the above systems are very strong, although those on the 12 C+ 13 N system are fairly weaker than the 12 C+ 13 C system. The role of the highly excited single-particle states 1d3/2 is particularly important in the formation of a specific CRC scheme, i.e., the formation of the covalent molecules due to the hybridization caused by the mixing of the different parity single-particle states. The fusion cross sections of the 12 C+ 13 C system at energies below the Coulomb barrier are strongly enhanced as a result of the strong CRC effects as compared with those of the 12 C+ 12 C system, while in 12 C+ 13 N system the enhancement of the sub-barrier fusion has not been observed. The above absorption mechanism for the 12 C+ 13 C system explains the lack of the molecular-resonance phenomena observed in the 12 C+ 12 C system. We check the effects of the dipole (E1) transition of the valence nucleon in 13 N (and also in 13 C) due to the core-core Coulomb interaction in the scattering at sub-barrier energies. The effects are not appreciable. (author)
Professional Discussion Groups: Informal Learning in a Third Space
Jordan, Robert A.
2013-01-01
In this ethnographic study, I explored two discussion groups and discovered Third Space elements such as cultural hybridity, counterscript, and sharing of experiences and resources contributed to a safe learning environment existing at the boundaries between participant personal and professional spaces. The groups operated under the auspices of a…
Directory of Open Access Journals (Sweden)
Metka NOVAK
2014-09-01
Full Text Available Introduction: One of the ways of building and developing a better cooperative relationship between parents of people with severe and profound intellectual disabilities and professional staff is the inclusion of parents in support groups for parents and staff in support groups for staff. Goal: To examine the correlation of the level of cooperative relationship between the parents of people with severe and profound intellectual disabilities and professional staff with the inclusion of parents in support groups for parents and staff in support groups for staff. Methodology: Respondents: parents (296 of people with severe and profound learning disabilities and staff (298 in five centres across Slovenia; Methods: descriptive statistics, test of homogeneity, the rankit method, one-way analysis of variance; Procedures: survey questionnaires for parents and staff. The data was processed using SPSS software for personal computers. Results: The difference between the variances of the groups (parent found is statistically significant (F = 6.16; p = 0.01. Staff included in support groups have a significantly lower level of cooperative relationship with parents (f=10; M = - 0.12 than staff not included in these groups (f = 191; M = 0.04. Conclusion:In contrast to theoretical findings the results indicated less successful cooperation for professional staff included in support groups. The results furthermore did not confirm any differences in the cooperative relationship of parents included in support groups and those who are not. We suggest an in-depth analysis of the workings of support groups.
Nuclear molecules in the systems 12C+12C and 16O+16O
International Nuclear Information System (INIS)
Tiereth, W.
1986-01-01
For the two heavy ion systems 12 C+ 12 C and 16 O+ 16 O by means of scattering experiments studies on the phenomena of nuclear molecules were performed. For the 12 C+ 12 C system in the range of the Coulomb wall precision measurements of the elastic scattering were performed. In the two energy ranges of 5.5 ≤ E c.m. ≤ 6.65 MeV and 6.95 ≤ E c.m ≤ 7.375 MeV where the existence of many quasimolecular resonances is known in energy steps of ΔE c.m. = 25 keV angular distributions in the range 10 0 ≤ θ c.m. ≤ 90 0 with Δθ c.m. = 1 0 were measured. For several of the found quasimolecular resonances the spin and the carbon width could be uniquely determined. This was reached by a partial wave analysis of the obtained data. Supplemented were the measurements of the elastic scattering by measurements of the excitation function of the θ 0 exit channel of the reaction 12 ( 12 C, θ) 20 Ne in the energy range from 5.2 ≤ E c.m. ≤ 6.1 MeV. At some known resonances in the 16 O+ 16 O system in the energy range from 15.5 MeV to 18 MeV the spin and the elastic width of these structures could be determined. For this a constrained partial wave analysis on complete angular distributions of the elastic scattering (9 0 ≤ θ c.m. ≤ 90 0 ) which were measured in energy steps of ΔE c.m. = 50 keV was performed. In the 16 O+ 16 O system besides the proof for the existence of a nuclear glory scattering was given. (orig.) [de
Ruel, Chris
2013-01-01
Demystifying the power of the Oracle 12c database The Oracle database is the industry-leading relational database management system (RDMS) used from small companies to the world's largest enterprises alike for their most critical business and analytical processing. Oracle 12c includes industry leading enhancements to enable cloud computing and empowers users to manage both Big Data and traditional data structures faster and cheaper than ever before. Oracle 12c For Dummies is the perfect guide for a novice database administrator or an Oracle DBA who is new to Oracle 12c. The book covers what
International Nuclear Information System (INIS)
Lazzarini, A.J.; Steadman, S.G.; Ledoux, R.J.; Sperduto, A.; Young, G.R.; Van Bibber, K.; Cosman, E.R.
1983-01-01
Prominent gross and intermediate width structures are observed in the 12 C+ 12 C, 12 C+ 12 C((2 + ), 1 C((2 + )+ 12 C((2 + ), 8 Be+ 16 O, and 8 Be+ 16 O + (3 - , O + ) decay channels following 24 Mg* population via the 12 C( 16 O,α) 24 Mg reaction at E/sub c.m./ = 33 MeV. Evidence that the 12 C( 16 O,α) 24 Mg reaction populates states in 24 Mg which are associated with 12 C+ 12 C resonances is presented in the form of correlation analyses between the α+ 12 C+ 12 C three-body spectra and previously measured 12 C+ 12 C elastic and inelastic excitation functions. Direct determination of 12 C+ 12 C widths from these measurements is obscured by a background of other strong transitions which appear to be present in the 12 C( 16 O,α) 24 Mg singles spectrum
Energy Technology Data Exchange (ETDEWEB)
Pachmayer, Yvonne C.
2008-08-22
This thesis contains the experimental results on dielectron production in {sup 12}C+{sup 12}C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c{sup 2} the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in {sup 12}C+{sup 12}C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c{sup 2} mass range, scales like pion production. (orig.)
Cooperation between mental health professionals and doctors in a Balint-oriented supervision group.
Keinänen, M
2001-01-01
A Balint-oriented supervision group for physicians is described concentrating on the study of the patient-doctor relationship, the recognition and diagnosis of psychiatric problems, and the planning of psychiatric treatment. The group includes five general practitioners, a gynecologist, a dermatologist, a psychiatrist and a psychologist, who have met once a month for an hour over a period of 12 years. Interaction between the physicians and the mental health professionals is illustrated by two clinical examples. The group helps the physician recognize, tolerate and use his countertransference feelings, and facilitates the examination and treatment of patients suffering from psychiatric problems. In Balint-oriented group work, the focus can be moved from physical symptoms to include observation of the patient's emotional life and significant object relations, to the factors that are crucial for his psychological balance. This kind of holistic observation in the examination and treatment of psychiatric problems is as important as appropriate laboratory investigations in the diagnosis and care of physical diseases.
DEFF Research Database (Denmark)
Holge-Hazelton, B.; Tulinius, Anne-Charlotte
2012-01-01
Background. Research has shown that peer-group supervision can strengthen GPs' professionalism, but little is known about the individual learning processes. To establish professionalism beyond professional behaviour, identity and idealism need to be included. The inner attitudinal values of profe......Background. Research has shown that peer-group supervision can strengthen GPs' professionalism, but little is known about the individual learning processes. To establish professionalism beyond professional behaviour, identity and idealism need to be included. The inner attitudinal values...
Energy Technology Data Exchange (ETDEWEB)
Chevrot, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Cermakova, E [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Vallee, C [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chancelier, M D [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chemla, N [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Rousselin, B [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Langer-Cherbit, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France)
1995-08-01
One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)
International Nuclear Information System (INIS)
Chevrot, A.; Cermakova, E.; Vallee, C.; Chancelier, M.D.; Chemla, N.; Rousselin, B.; Langer-Cherbit, A.
1995-01-01
One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)
International Nuclear Information System (INIS)
Roy, B.J.; Jha, V.; Biswas, D.C.; Parmar, A.; Mohanty, Biraja; Oswal, M.; Jhingan, Akhil; Nandi, T.
2013-01-01
With a motivation to understand the reaction mechanism aspects, systematic study of multi-nucleon transfer in different projectile + target combinations has been made. Data taken at the BARC-TIFR Pelletron - LINAC facility, Mumbai for the systems 18 O+ 206 Pb and 18 O+ 12 C both studied at an incident energy of E( 18 O) = 140.4 MeV are reported in different communications to this proceedings. The present communication reports the measurements for 58 Ni( 12 C, x) and 56 Fe( 12 C, x) at incident 12 C energies of E( 12 C) = 45 and 60 MeV carried out at the pelletron accelerator facility, IUAC, Delhi
Effect of curcumin Extract on Ttranslocation of Glut 4 in C2C12 Myotubes
Directory of Open Access Journals (Sweden)
J Zavarreza
2013-06-01
Full Text Available Introduction: Curcumin is a major phenolic compound of Curcuma longa, which has long been used in traditional Indian medicine. Recently, curcumin has been reported to have antihyperglycemic activity in animal models. However, the molecular basis of this action has not been adequatedly described. In the present study the antihyperglycemic effect of curcumin was examined using C2C12 myoblast cells. Methods: The effects of curcumin were investigated in C2C12 myotubes by treating the cells with 40 µM of curcumin for 1.5 h. C2C12 myotubes were homogenized and the subcellular fractionation was prepared using ultracentrifugation; Then protein assay was performed using Bradford method and Glut4 determination was done using SDS-PAGE. Moreover, western immunoblotting techniques were exerted for semi-quantitative measurement. Data analysis was performed via gene tools software of Gel documentation and SPSS. An ANOVA test was used to compare three groups together. Results: Comparison of Glut4 levels in C2C12 myotubes showed that myotubes which were exposed to1.5 hours of 40 µM curcunin had higher Glut4 percentages in both cytosolic and membrane fractions and Glut4 percentages were significant with a confidence interval (CI of 95% ( P<0.05 . Conclusion: The study results showed that curcumin can strongly induce the increase of Glut4 translocation in differentiated C2C12 cells, indicating its possible regulatory role in the glucose metabolism of skeletal muscle cells
International Nuclear Information System (INIS)
Olimov, K.K.; Olimov, K.; Gulamov, K.G.; Olimov, A.K.; Lutpullaev, S.L.; Yuldashev, B.S.; Haseeb, M.Q.
2015-01-01
The partial inelasticity coefficients of the negative pions were determined in minimum bias p, d, α, 12 C + 12 C and p, 12 C + 18 Ta collisions at 4.2A GeV/c taking into account the average number of participant nucleons of a projectile nucleus. In nucleus–nucleus collisions, the average values of partial inelasticity coefficients (〈K(π-)〉) of the negative pions did not depend on the mass numbers of projectile and target nuclei. Increase of 〈K(π - )〉 in going from p + 12 C to d, α, 12 C + 12 C collisions was due to an additional source of production of fast negative pions in nucleus–nucleus collisions — a charge exchange conversion of one or more neutrons of a projectile nucleus into a proton and π - . Linking the experimental results of the present analysis at intermediate energy with those obtained at high and ultra-high energies, it was concluded that the average values of partial inelasticity coefficients of pions in nucleon–nucleus and nucleus–nucleus collisions manifest a transitive behavior. At intermediate energies, the values of 〈K(π - )〉 were smaller by a factor of two and more as compared to those at high energies, and they increased further with increasing incident energy, reaching a plateau at E 0 > 100A GeV. (author)
Lutz, Gabriele; Pankoke, Nina; Goldblatt, Hadass; Hofmann, Marzellus; Zupanic, Michaela
2017-07-14
Professional competence is important in delivering high quality patient care, and it can be enhanced by reflection and reflective discourse e.g. in mentoring groups. However, students are often reluctant though to engage in this discourse. A group mentoring program involving all preclinical students as well as faculty members and co-mentoring clinical students was initiated at Witten-Herdecke University. This study explores both the attitudes of those students towards such a program and factors that might hinder or enhance how students engage in reflective discourse. A qualitative design was applied using semi-structured focus group interviews with preclinical students and semi-structured individual interviews with mentors and co-mentors. The interview data were analyzed using thematic content analysis. Students' attitudes towards reflective discourse on professional challenges were diverse. Some students valued the new program and named positive outcomes regarding several features of professional development. Enriching experiences were described. Others expressed aversive attitudes. Three reasons for these were given: unclear goals and benefits, interpersonal problems within the groups hindering development and intrapersonal issues such as insecurity and traditional views of medical education. Participants mentioned several program setup factors that could enhance how students engage in such groups: explaining the program thoroughly, setting expectations and integrating the reflective discourse in a meaningful way into the curriculum, obliging participation without coercion, developing a sense of security, trust and interest in each other within the groups, randomizing group composition and facilitating group moderators as positive peer and faculty role models and as learning group members. A well-designed and empathetic setup of group mentoring programs can help raise openness towards engaging in meaningful reflective discourse. Reflection on and communication of
The 12C+12C → 8Begs+16Ogs reaction at Ecm=27 to 36 MeV
International Nuclear Information System (INIS)
Aliotta, M.; Lattuada, M.; Spitaleri, C.
1996-01-01
The 12 C + 12 C → 8 Be gs + 16 O gs reaction has been experimentally investigated at c.m. energies between 27 and 36 MeV. A resonance is present at 32.5 MeV, i.e. at the same energy of the resonance previously observed [1] in the 12 C(0 + 2 ) + 12 C(0 + 2 ) exit channel, but its width is about three times narrower. Moreover the data indicate an enhancement of the cross section at a c.m. energy close to 29 MeV. These results are discussed and compared to the predictions of the Band Crossing Model obtained for different exit channels of the 12 C + 12 C reaction. (orig.)
Facilitating Support Groups for Professionals Working with People with AIDS.
Grossman, Arnold H.; Silverstein, Charles
1993-01-01
Describes support groups for health care professionals who work with people with human immunodeficiency virus (HIV) or Acquired Immune Deficiency Syndrome (AIDS) and who are experiencing burnout from excessive demands on their energy, strength, and resources. Discusses group administration, effective intervention techniques, and issues of health…
Angular correlation measurements for {sup 12}C{sup 12}C,{sup 12}C{sup 12}C 3{sup -} scattering
Energy Technology Data Exchange (ETDEWEB)
Wuosmaa, A.H.; Betts, R.R.; Freer, M.
1995-08-01
Previous studies of inelastic {sup 12}C + {sup 12}C scattering to a variety of final states identified significant resonance behavior in a number of different reaction channels. These resonances can be interpreted as either potential scattering resonances, or as population of cluster structures in the compound nucleus {sup 24}Mg, or as some interplay between the two mechanisms. Currently, for many of these resonances the situation remains unclear. One example is a large peak observed in the excitation function for the 3{sup -} - g.s. excitation, identified in previous work performed at the Daresbury Laboratory in England. This peak is observed at the same center-of-mass energy as one observed in the O{sub 2}{sup +}-O{sub 2}{sup +} inelastic scattering channel. That structure was suggested to correspond to exotic deformed configurations in the compound nucleus {sup 24}Mg. As the peak in the 3{sup -} + g.s. exit channel occurs at precisely the same energy as the purported resonance, it is tempting to associate the two. Before such an association can be confirmed or ruled out, further information must be obtained about the 3{sup -} + g.s. structure. In particular, it is important to determine the angular momenta that dominate the 3{sup -} + g.s. structure.
Dielectron production in 12C+12C collisions at 1 GeV per nucleon
International Nuclear Information System (INIS)
Pachmayer, Yvonne C.
2008-01-01
This thesis contains the experimental results on dielectron production in 12 C+ 12 C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c 2 the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in 12 C+ 12 C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c 2 mass range, scales like pion production. (orig.)
Allington, Ruth; Fernandez-Fuentes, Isabel
2013-04-01
A new IUGS Task Group entitled the Task Group on Global Geoscience Professionalism was formed in 2012 and launched at a symposium at the 341GC in Brisbane on strengthening communication between fundamental and applied geosciences and between geoscientists and public. The Task Group aims to ensure that the international geoscience community is engaged in a transformation of its profession so as to embed the need for a professional skills base alongside technical and scientific skills and expertise, within a sound ethical framework in all arenas of geoscience practice. This needs to be established during training and education and reinforced as CPD throughout a career in geoscience as part of ensuring public safety and effective communication of geoscience concepts to the public. The specific objective of the Task Group on Global Geoscience Professionalism that is relevant to this poster session is: • To facilitate a more 'joined up' geoscience community fostering better appreciation by academics and teachers of the professional skills that geoscientists need in the workplace, and facilitate better communication between academic and applied communities leading to more effective application of research findings and technology to applied practitioners and development of research programmes that truly address urgent issues. Other Task Group objectives are: • To provide a specific international forum for discussion of matters of common concern and interest among geoscientists and geoscientific organizations involved in professional affairs, at the local, national and international level; • To act as a resource to IUGS on professional affairs in the geosciences as they may influence and impact "Earth Science for the Global Community" in general - both now and in the future; • To offer and provide leadership and knowledge transfer services to countries and geoscientist communities around the world seeking to introduce systems of professional governance and self
Fahrni, Simon M.; Southon, John R.; Santos, Guaciara M.; Palstra, Sanne W. L.; Meijer, Harro A. J.; Xu, Xiaomei
2017-01-01
The vast majority of radiocarbon measurement results (C-14/C-12 isotopic ratios or sample activities) are corrected for isotopic fractionation processes (measured as C-13/C-12 isotopic ratios) that occur in nature, in sample preparation and measurement. In 1954 Harmon Craig suggested a value of 2.0
Study guide for 1Z0-071 Oracle Database 12c SQL : Oracle Certification Prep
Morris, Matthew
2016-01-01
This Study Guide is targeted at IT professionals who are working towards becoming an Oracle Database 12c SQL Certified Associate. The book provides information covering all of the exam topics for the Oracle certification exam: "1Z0-071: Oracle Database 12c SQL". The books in the Oracle Certification Prep series are built in lockstep with the test topics provided by Oracle Education's certification program. Each book is intended to provide the information that will be tested in a clean and concise format. The guides introduce the subject you'll be tested on, follow that with the information you'll need to know for it, and then move on to the next topic. They contain no drills or unrealistic self-tests to bump the page count without adding value. The series is intended to provide a concentrated source of exam information that is compact enough to be read through multiple times. This series is ideal for experienced Oracle professionals that are familiar with the topic being tested, but want a means to rapidly re...
DEFF Research Database (Denmark)
Poulsen, K A; Petersen, Stine Helene Falsig; Kolko, M
2007-01-01
to catalytically inactive 50-kDa iPLA(2)-VIA-ankyrin variants previously identified in humans. Both the mRNA and protein levels of this approximately 50-kDa variant were reduced significantly within 1 h following OGD. In C2C12 myoblasts, iPLA(2)-VIA seemed to predominantly reside at the endoplasmatic reticulum......The involvement of group VI Ca(2+)-independent PLA(2)s (iPLA(2)-VI) in in vitro ischemia [oxygen and glucose deprivation (OGD)] in mouse C2C12 myotubes was investigated. OGD induced a time-dependent (0-6 h) increase in bromoenol lactone (BEL)-sensitive iPLA(2) activity, which was suppressed...... by specific short interfering (si)RNA knockdown of iPLA(2)-VIA. OGD was associated with an increase in iPLA(2)-VIA protein levels, whereas mRNA levels were unchanged. The levels of iPLA(2)-VIB mRNA and protein were not increased by OGD. RT-PCR and Western blot analysis identified a mouse iPLA(2)-VIA homolog...
Elastic scattering of {sup 12} C by {sup 12} C at intermediate energies
Energy Technology Data Exchange (ETDEWEB)
Khallaf, S A.E. [Department of Physics, Faculty of Science, Assiut University, Assiut, (Egypt); Abdel-Rahman, M A; Abdel-Raheem, S K; Mahmoud, S W.Z. [Department of Physics, Faculty of Science, El-Minia University, El-Minia, (Egypt)
1997-12-31
Using the double folding model (DF), the real part of the central potential for {sup 12} C + {sup 12} C system is derived. This potential as well as the single folding cluster model potential (SFC) were used to calculate the total and differential cross sections for {sup 12} C elastically scattered on {sup 12} C at three laboratory energies; E{sub 1ab}. = 300, 344.5 and 360 MeV. The calculations were carried out using five sets of nucleon nucleon (NN) interaction of the integrable Gaussian form and two sets of parameters for the nuclear matter density of the harmonic oscillator form. The transparency of the target nucleus was found to increase as the projectile energy increases. Good fits between the present calculations and the experimental data as well as the previously published calculations were obtained. The present simple methods used to calculate the real part of the optical potential stand on equal footing with the density dependent (DDM 3 Y) procedure and it reduces the potential computing time enormously. The suitable choice of NN interaction as well as nuclear matter densities is important. 24 figs., 3 tabs.
Collaborative groups: a reflective look for the professional development of mathematics teachers
Directory of Open Access Journals (Sweden)
Priscila Bernardo Martins
2018-01-01
Full Text Available The present work aims to present the conceptual characteristics about collaborative groups and to identify their importance in the professional development process of teachers who teach Mathematics. For this, we adopt a methodology of bibliographic research in which we bring authors who discuss this theme. Our theoretical framework is supported by authors who discuss the importance of collaborative groups in the teaching of Mathematics. The results show that the collaborative groups contribute to the professional development of teachers by promoting, through reflexivity, spaces of collective discussions about the practice of teachers in the classroom.
Energy Technology Data Exchange (ETDEWEB)
Wuosmaa, A.H.; Wiedenhoever, I.; Caggiano, J.; Carpenter, M.P.; Devlin, M.; Heinz, A.; Janssens, R.V.F.; Kondev, F.; Lauritsen, T.; Sarantites, D.G.; Sobotka, L.G.; Battacharyya, P
2003-10-09
Particle gamma-ray angular correlation measurements have been used to study the spin alignment and magnetic-substate population parameters for the 2{sup +}{sub 1} (4.443 MeV) state in {sup 12}C, populated in the {sup 12}C({sup 12}C,{sup 12}C[0{sup +}{sub 2}]){sup 12}C(2{sup +}{sub 1}) inelastic scattering reaction in the vicinity of a prominent, narrow peak in the scattering excitation function. The data show a strong alignment of the spin with the orbital angular momentum, and suggest that the cross section peak corresponds to a spin 14{sup +} resonance at E{sub c.m.}=28.0 MeV. This energy is close to that where a strong peak is also observed in the 0{sup +}{sub 1}+0{sup +}{sub 2} excitation function. A comparison between the data for these two channels lends some support to recent theoretical calculations of resonance behavior for angular-momentum-mismatched channels in {sup 12}C+{sup 12}C inelastic scattering.
13C NMR and relaxation studies of the nanomagnet Mn12-acetate
Achey, Randall M.; Kuhns, Philip L.; Reyes, Arneil P.; Moulton, William G.; Dalal, Naresh S.
2001-08-01
The nanomagnet [Mn12O12(CH3COO)16(H2O)4].2CH3COOH.4H2O, also known as Mn12, has been synthesized with 13C labeling at the CH3 groups, and investigated by 13C NMR at fields up to 23 T. Using oriented samples, it is possible to resolve four distinct 13C peaks at room temperature, located on both sides of the unshifted Larmor frequency. These peaks were assigned to the four hyperfine-shifted, magnetically inequivalent sets of 13CH3 groups in the Mn12 lattice, based on a comparison with the crystal structure and point-dipole and spin-density calculations. These results establish that the unpaired electron spin density of the S=10 system in this cluster extends over the entire molecular framework, not just the core. These results are discussed in relationship to inelastic neutron scattering measurements. The temperature and field dependence of the 13C nuclear-spin-lattice-relaxation time T1 on the least shifted peak was measured. A single weakly field-dependent minimum at about 60 K is observed in the temperature dependence of the measured T1. The relaxation mechanism responsible for the T1 minimum is ascribed mainly to hindered rotation of the methyl group of the acetate ligand at higher temperature, and to electronic spin fluctuations at lower temperature.
Exploring the Influence of Student Focus Groups in Their Professional and Personal Development
Hosseini, S.; Hut, R.
2014-12-01
A scientific career is often more than a 9-to-5 commitment, both in terms of time and passion. An important factor that fuels this passion is engaging with the community on many levels. In the history of education and professional development, there are numerous studies that emphasis the importance of surrounding groups and like-minded peers in one's professional and personal development in a less constrained environment. In our experience, in modern days where students are surrounded with too much information and yet too little clear signal, the idea of mentor and advisor can no longer limit to one or two people. We strongly feel it is imperative to have the opportunity to share expertise on scientific issues, career options, develop presenting and writing skills, participate in professional volunteer activities with alike and advanced colleagues, share future opportunities, and successfully navigating life both inside and outside of graduate school in a relaxed environment. Most of the professional scientific and engineering communities put a lot of effort to create and maintain professional groups in masters and Ph.D. levels but the dynamics within these groups prove it to be very different and it is challenging to maintain both momentum and productivity. Authors of this report would present their experience in creating, running and maintaining various student groups in the discipline of physics, astronomy, planetary science, hydrology, and optical engineering in US, Europe and Middle East. The common factors and differences based on the supportive community, location, and the educational level would be discussed. An outline of potential helpful factors within the academic institutes and professional communities would be presented based on the examination on various successful and unsuccessful experiences.
Klytta, C; Wilz, G
2007-02-01
Because the effectiveness of self-help groups (SHGs) has not been proven yet and also since multi-focus reviews on SHGs are rare, the present article offers an overview of the current state of research. Possible reasons for the conflicting results in the literature are also investigated. An extensive literature search was done to review studies which used longitudinal design and control groups to measure the effectiveness of SHGs and so-called "support groups". Positive effects in comparison to the control groups were proven in four out of seven of the studies. In the remaining three studies the outcomes between the groups were the same. Considering the naturalistic designs of the studies, these results clearly indicate that SHGs are indeed effective. An insufficient consideration of the heterogeneity of the groups is held responsible for the difficulties associated with previous research on the topic, especially as far as the differentiation between SHGs and professionally led groups is concerned. The definition excludes professional leadership but, in fact, professional involvement in SHGs up to their leadership is the rule. The following suggestions have been derived from this literature analysis: uniform classifications for SHGs and professionally-led support groups should be established in order to make it possible to provide a clear distinction between these types of groups as well as to indicate the extent of professional involvement in them. A plea is made for a generally stronger consideration of organisational differences in the research of SHGs.
Matheson, Catriona; Robertson, Helen D; Elliott, Alison M; Iversen, Lisa; Murchie, Peter
2016-07-01
The modern primary healthcare workforce needs to be resilient. Early research framed professional resilience as avoiding 'burnout'; however, more recent literature has introduced the concept of positive adaptation to professional challenges, which results in individuals thriving in their role. To explore what primary health professionals working in challenging environments consider to be characteristics of resilience and what promotes or challenges professional resilience. A qualitative focus group in north east Scotland. Five focus groups were held with 20 health professionals (six GPs, nine nurses, four pharmacists, and a practice manager) based in rural or deprived city areas in the north east of Scotland. Inductive thematic analysis identified emerging themes. Personal resilience characteristics identified were optimism, flexibility and adaptability, initiative, tolerance, organisational skills, being a team worker, keeping within professional boundaries, assertiveness, humour, and a sense of self-worth. Workplace challenges were workload, information overload, time pressures, poor communication, challenging patients, and environmental factors (rural location). Promoters of professional resilience were strong management support, teamwork, workplace buffers, and social factors such as friends, family, and leisure activities. A model of health professional resilience is proposed that concurs with existing literature but adds the concept of personal traits being synergistic with workplace features and social networks. These facilitate adaptability and enable individual health professionals to cope with adversity that is inevitably part of the everyday experience of those working in challenging healthcare environments. © British Journal of General Practice 2016.
Resonance states in 16O+16O, 12C+16O, α+ 16O and α+ 12C with ...
Indian Academy of Sciences (India)
The resonance states in 16O + 16O, 12C + 16O, + 16O and + 12C are described using modified Morse potential proposed earlier whose success has already been demon-strated in the case of 12C + 12C system. The general validity of such a potential with long range, shallow depth and repulsive soft core determined ...
de Oliveira, Marcelo T; Hughes, David L; Nepogodiev, Sergey A; Field, Robert A
2008-02-04
Aceric acid (3-C-carboxy-5-deoxy-alpha-l-xylofuranose) residues are present in pectic polysaccharide rhamnogalacturonan II (RG II) in the form of synthetically challenging 1,2-cis-glycofuranosides. To access synthetic fragments of RG II incorporating aceric acid, a four-step procedure based on C-2 epimerisation of initially prepared 1,2-trans-glycofuranoside was developed. Readily available derivatives of branched-chain l-lyxofuranose bearing a 3-C-vinyl group as a masked 3-C-carboxyl group were investigated as potential precursors of aceric acid units. In the first step of the procedure, installation of a participating group at C-2 of the furanose ring ensured stereocontrol of the O-glycosylation, which was carried out with the thioglycoside of 2-O-acetyl-3,5-di-O-benzyl-3-C-vinyl-L-lyxofuranose. After the glycosylation step, the 2-O-acetyl group was removed, the free 2-OH group was oxidised and the resulting ketone was finally reduced to form the C-3-vinyl-L-xylofuranoside. The use of L-Selectride in the key reduction reaction was essential to achieve the required stereoselectivity to generate 1,2-cis-furanoside.
3-D Teaching of Climate Change: An innovative professional learning model for K-12 teachers
Stapleton, M.; Wolfson, J.; Sezen-Barrie, A.
2017-12-01
In spite of the presumed controversy over the evidence for climate change, the recently released Next Generation Science Standards (NGSS) for K-12 include a focus on climate literacy and explicitly use the term `climate change.' In addition to the increased focus on climate change, the NGSS are also built upon a new three dimensional framework for teaching and learning science. Three dimensional learning has students engaging in scientific and engineering practices (Dimension 1), while using crosscutting concepts (Dimension 2) to explore and explain natural phenomena using disciplinary core ideas (Dimension 3). The adoption of these new standards in many states across the nation has created a critical need for on-going professional learning as in-service science educators begin to implement both climate change instruction and three dimensional teaching and learning in their classrooms. In response to this need, we developed an innovative professional learning model for preparing teachers to effectively integrate climate change into their new curriculum and engage students in three dimensional learning. Our professional learning model utilized ideas that have emerged from recent science education research and include: a) formative assessment probes for three dimensional learning that monitor students' progress; b) collaboration with scientists with expertise in climate science to understand the domain specific ways of doing science; and c) development of a community of practice for in-service teachers to provide feedback to each other on their implementation. In this poster presentation, we will provide details on the development of this professional learning model and discuss the affordances and challenges of implementing this type of professional learning experience.
Professional Commitment and Professional Marginalism in Teachers
Directory of Open Access Journals (Sweden)
Kalashnikov A.I.
2017-11-01
Full Text Available The article reviews teachers' attitudes towards the teaching profession which can be expressed both in professional commitment and in professional marginalism. The dominance of professional marginalism could affect destructively the students as well as the teacher’s personality, hence the issues related to the content of personal position of a marginal and the rate of marginalism among teachers. It was suggested that marginalism could be revealed in the study of professional commitment. The study involved 81 teachers of Sverdlovsk secondary schools aged 21—60 years with work experience ranging from 1 month to 39 years. The Professional Commitment Questionnaire was used as the study technique. The results showed that negative emotional attitude towards the profession and reluctance to leave the profession were grouped as a separate factor. The dispersion factor was 12,5%. The factor loadings ranged from 0.42 to 0.84. The study proved that professional marginalism in teachers includes dissatisfaction with work, feelings of resentment against profession and an unwillingness to leave the profession.
Energy Technology Data Exchange (ETDEWEB)
Enkovich, P. V., E-mail: enkovich@hppi.troitsk.ru; Brazhkin, V. V.; Lyapin, S. G.; Novikov, A. P. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation); Kanda, H. [National Institute for Materials Science (Japan); Stishov, S. M. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation)
2016-09-15
The Raman scattering by isotopically pure {sup 12}C and {sup 13}C diamond single crystals and by isotopically mixed {sup 12.5}C diamond single crystals is studied at a high accuracy. The studies are performed over a wide pressure range up to 73 GPa using helium as a hydrostatic pressure-transferring medium. It is found that the quantum effects, which determine the difference between the ratio of the Raman scattering frequencies in the {sup 12}C and {sup 13}C diamonds and the classical ratio (1.0408), increase to 30 GPa and then decrease. Thus, inversion in the sign of the quantum contribution to the physical properties of diamond during compression is detected. Our data suggest that the maximum possible difference between the bulk moduli of the {sup 12}C and {sup 13}C diamonds is 0.15%. The investigation of the isotopically mixed {sup 12.5}C diamond shows that the effective mass, which determines the Raman frequency, decreases during compression from 12.38 au at normal pressure to 12.33 au at 73 GPa.
Application of inverse kinematics to [sup 1]H+[sup 23]Na[yields][sup 12]C+[sup 12]C
Energy Technology Data Exchange (ETDEWEB)
Bennett, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Clarke, N.M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Freer, M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Fulton, B.R. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Hall, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Karban, O. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Tungate, G. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J. (Dept. of Physics, York Univ. (United Kingdom)); Jarvis, N.S. (Dept. of Physics, York Univ. (United Kingdom)); Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Rae, W.D.M. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Smith, A.E. (Dept. of Nuclear; Charissa Collaboration
1993-08-15
Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the [sup 1]H([sup 23]Na, [sup 12]C)[sup 12]C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in [sup 24]Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the [sup 23]Na(p, [sup 12]C)[sup 12]C reaction. (orig.)
Sparapani, Silvia; Bellini, Stefania; Gunaratnam, Mekala; Haider, Shozeb M; Andreani, Aldo; Rambaldi, Mirella; Locatelli, Alessandra; Morigi, Rita; Granaiola, Massimiliano; Varoli, Lucilla; Burnelli, Silvia; Leoni, Alberto; Neidle, Stephen
2010-08-21
A bis-guanylhydrazone derivative of diimidazo[1,2-a:1,2-c]pyrimidine has unexpectedly been found to be a potent stabiliser of several quadruplex DNAs, whereas there is no significant interaction with duplex DNA. Molecular modeling suggests that the guanylhydrazone groups play an active role in quadruplex binding.
Search for aligned structure of 12C-α-12C type at high excitation energy in 28Si
International Nuclear Information System (INIS)
Burnereau, Nicole.
1975-01-01
The 16 O+ 12 C→ 12 C+α+ 12 C reaction is studied mainly at 46MeV (at this energy a state of 28 Si is presumably formed with a spin value of 14 + ; resonance of 19.7MeV c.m.). The motivation is to detect an α particle with a negligible energy in the c.m. system. This is the signature of the preformation of three aligned clusters in which the average location of the α particle is in between the two 12 C's at the center of symmetry of the system. Such a detection is performed by detecting two 12 C's in coincidence at specific angles. The data are understood by three-body calculations with a coupling of relative angular momenta governed by an unique J value. Experimentally, an α energy of 200keV is measured with good statistics, supporting the idea of aligned clusters as 28 Si intrinsic shape, related to some highly excited states [fr
A practical synthesis of long-chain iso-fatty acids (iso-C12–C19 and related natural products
Directory of Open Access Journals (Sweden)
Mark B. Richardson
2013-09-01
Full Text Available A gram-scale synthesis of terminally-branched iso-fatty acids (iso-C12–C19 was developed commencing with methyl undec-10-enoate (methyl undecylenate (for iso-C12–C14 or the C15 and C16 lactones pentadecanolide (for iso-C15–C17 and hexadecanolide (for iso-C18–C19. Central to the approaches outlined is the two-step construction of the terminal isopropyl group through addition of methylmagnesium bromide to the ester/lactones and selective reduction of the resulting tertiary alcohols. Thus, the C12, C17 and C18 iso-fatty acids were obtained in three steps from commercially-available starting materials, and the remaining C13–C16 and C19 iso-fatty acids were prepared by homologation or recursive dehomologations of these fatty acids or through intercepting appropriate intermediates. Highlighting the synthetic potential of the iso-fatty acids and various intermediates prepared herein, we describe the synthesis of the natural products (S-2,15-dimethylpalmitic acid, (S-2-hydroxy-15-methylpalmitic acid, and 2-oxo-14-methylpentadecane.
Neutrino cross sections on 12C
International Nuclear Information System (INIS)
Sandberg, V.D.
1996-01-01
Measurements of the charged current reactions 12 C(v e ,e - ) 12 N and 12 C(v μ ,μ - ) 12 N for inclusive transitions to 12 N excited states and exclusive transitions to 12 N , are presented. The data presented represent 3 years of running of the LSND experiments and are from runs in 1993, 1994, and 1995 and total to 14772 Coulombs of protons on target. The v e scattering and v μ - exclusive scattering results are in good agreement with theoretical expectations, while the v μ - inclusive scattering results are smaller than expected from a continuum random phase calculation
"Flipping" educational technology professional development for K-12 educators
Spencer, Daniel
As the demand for more effective professional development increases in K-12 schools, trainers must adjust their training methods to meet the needs of their teacher learners. Just as lecture-heavy, teacher-centered instruction only meet the learning needs of a small minority of students, "sit and get" professional development rarely results in the teachers gaining the skills and confidence necessary to use technology effectively in their instruction. To resolve the frustrations of teachers related to ineffective professional development, a "Flipped PD" training model was developed based on the learning needs of adult learners, the integration of technological, pedagogical, and content knowledge (TPACK), learning activities, and the Flipped Classroom concept. Under this model, training shifts from a passive, trainer-centered format, to an active, learner-centered format where teachers learn to use technology in their classrooms by first focusing on pedagogical issues, then choosing the options that work best for addressing those issues in their unique situation, and completing "learn-by-doing" projects. Those who participate in "Flipped PD" style trainings tend to have more confidence upon completion that they can use the tools they were trained on in their teaching, as well as believe that the PD was engaging and a good use of their time.
Sub-Coulomb α Transfers on C12 and the C12(α, γ)O16 S Factor
International Nuclear Information System (INIS)
Brune, C. R.; Geist, W. H.; Kavanagh, R. W.; Veal, K. D.
1999-01-01
The 12 C( α, γ) 16 O reaction is crucial for the understanding of He burning in massive stars, but the low-energy cross section is highly uncertain. To address this problem we have measured at sub-Coulomb energies total cross sections for the 12 C( 6 Li, d) 16 O and 12 C( 7 Li, t) 16 O reactions to the bound 2 + and 1 - states of 16 O . The data are analyzed to obtain the reduced α widths of these states. Together with capture and phase-shift data, these results provide for a more accurate determination of the low-energy 12C(α, γ) 16 O S factor: S E1 (0.3 MeV) =101±17 keV b and S E2 (0.3 MeV) =42 +16 -23 keV b for the E1 and E2 multipole components of the reaction. (c) 1999 The American Physical Society
Body image concerns in professional fashion models: are they really an at-risk group?
Swami, Viren; Szmigielska, Emilia
2013-05-15
Although professional models are thought to be a high-risk group for body image concerns, only a handful of studies have empirically investigated this possibility. The present study sought to overcome this dearth of information by comparing professional models and a matched sample on key indices of body image and appeared-related concerns. A group of 52 professional fashion models was compared with a matched sample of 51 non-models from London, England, on indices of weight discrepancy, body appreciation, social physique anxiety, body dissatisfaction, drive for thinness, internalization of sociocultural messages about appearance, and dysfunctional investment in appearance. Results indicated that professional models only evidenced significantly higher drive for thinness and dysfunctional investment in appearance than the control group. Greater duration of engagement as a professional model was associated with more positive body appreciation but also greater drive for thinness. These results indicate that models, who are already underweight, have a strong desire to maintain their low body mass or become thinner. Taken together, the present results suggest that interventions aimed at promoting healthy body image among fashion models may require different strategies than those aimed at the general population. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Measurements of Ay(θ) for 12C(n,n)12C from En=2.2 to 8.5 MeV
International Nuclear Information System (INIS)
Roper, C.D.; Tornow, W.; Braun, R.T.; Chen, Q.; Crowell, A.; Trotter, D. Gonzalez; Howell, C.R.; Salinas, F.; Setze, R.; Walter, R.L.; Chen Zemin; Tang Hongqing; Zhou Zuying
2005-01-01
The analyzing power A y (θ) for neutron elastic scattering from 12 C has been measured for 33 neutron energies between E n =2.2 and 8.5 MeV in the angular range from 25 deg. to 145 deg. in the laboratory system. The primary motivation for these measurements is the need for an accurate knowledge of A y (θ) for 12 C(n,n) 12 C elastic scattering to enable corrections to high-precision neutron-proton and neutron-deuteron A y (θ) data in the neutron-energy range below E n =30 MeV. In their own right, 12 C(n,n) 12 C A y (θ) data are of crucial importance for improving both the parametrization of n- 12 C scattering and our knowledge of the level scheme of 13 C. The present A y (θ) data are compared with published data and previous phase-shift-analysis results
Energy Technology Data Exchange (ETDEWEB)
Okamoto, Michio [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Tanaka, Hiroyuki, E-mail: tanahiro-osk@umin.ac.jp [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Okada, Kiyoshi [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Kuroda, Yusuke [Department of Orthopaedic Surgery, Kansai Rosai Hospital, 3-1-69 Inabaso, Amagasaki, Hyogo 660-8511 (Japan); Nishimoto, Shunsuke; Murase, Tsuyoshi; Yoshikawa, Hideki [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan)
2014-01-17
Highlights: •Methylcobalamin activated the Erk1/2 signaling pathway in C2C12 cells. •Methylcobalamin promoted the proliferation and migration in C2C12 cells. •C2C12 cell apoptosis during differentiation was inhibited by methylcobalamin. -- Abstract: Methylcobalamin (MeCbl) is a vitamin B12 analog that has some positive effects on peripheral nervous disorders. Although some previous studies revealed the effects of MeCbl on neurons, its effect on the muscle, which is the final target of motoneuron axons, remains to be elucidated. This study aimed to determine the effect of MeCbl on the muscle. We found that MeCbl promoted the proliferation and migration of C2C12 myoblasts in vitro and that these effects are mediated by the Erk1/2 signaling pathway without affecting the activity of the Akt signaling pathway. We also demonstrated that MeCbl inhibits C2C12 cell apoptosis during differentiation. Our results suggest that MeCbl has beneficial effects on the muscle in vitro. MeCbl administration may provide a novel therapeutic approach for muscle injury or degenerating muscle after denervation.
Effect of Curcumin on Phosphorylation of AMPK and ACC in C2C12 Skeletal Muscle Cells
Directory of Open Access Journals (Sweden)
F Ghanbarzadeh
2013-10-01
Full Text Available Introduction: AMP activated protein kinase (AMPK as key regulators of cell metabolism, plays a major role in the activation of catabolic pathways, such as glucose transport and fatty acid oxidation. Thus, activation of this pathway can be used in the treatment of diabetes and metabolic syndrome. Many studied proposed the effectiveness of the polyphenols present in rhizomes of turmeric (curcumin on diabetes and its related complications. Therefore, this study investigated the effects of curcumin as an activator of AMPK pathway in C2C12 muscle cells. Methods: This study was done on C2C12 skeletal muscle cell line. The cells were classified into two distinct groups: first group was treated with 40µM curcumin and the second one with 0.1% DMSO as a negative control. The phosphorylated (AMPK and phosphorylated acetyl COA carboxylase (ACC were evaluated and compared by Western blotting technique. Results: intracellular phosphorylated AMPK protein content in Curcumin-treated group was 132.6% and ACC protein phosphorylated was 366.47%. Conclusion: This study showed that the levels of phosphorylated AMPK and ACC protein in cells treated with curcumin are higher than the negative control. Thus curcumin can be regarded as an activator of AMPK activity in these cells and can assist as a potential target for making anti diabetic medecine that has a synergistic activity with insulin.
IMPROVED LINE DATA FOR THE SWAN SYSTEM 12C13C ISOTOPOLOGUE
International Nuclear Information System (INIS)
Ram, Ram S.; Brooke, James S. A.; Bernath, Peter F.; Sneden, Christopher; Lucatello, Sara
2014-01-01
We present new, accurate predictions for rotational line positions, excitation energies, and transition probabilities of the 12 C 13 C isotopologue Swan d 3 Π-a 3 Π system 0-0, 0–1, 0–2, 1–0, 1–1, 1–2, 2–0, 2–1, and 2–2 vibrational bands. The line positions and energy levels were predicted through new analyses of published laboratory data for the 12 C 13 C lines. Transition probabilities were derived from recent computations of transition dipole moments and related quantities. The 12 C 13 C line data were combined with similar data for 12 C 2, reported in a companion paper, and applied to produce synthetic spectra of carbon-rich metal-poor stars that have strong C 2 Swan bands. The matches between synthesized and observed spectra were used to estimate band head positions for a few of the 12 C 13 C vibrational bands and to verify that the new computed line data match observed spectra. The much weaker C 2 lines of the bright red giant Arcturus were also synthesized in the band head regions
Interactions between ionic liquid surfactant [C12mim]Br and DNA in dilute brine.
He, Yunfei; Shang, Yazhuo; Liu, Zhenhai; Shao, Shuang; Liu, Honglai; Hu, Ying
2013-01-01
Interactions between ionic liquid surfactant [C(12)mim]Br and DNA in dilute brine were investigated in terms of various experimental methods and molecular dynamics (MD) simulation. It was shown that the aggregation of [C(12)mim]Br on DNA chains is motivated not only by electrostatic attractions between DNA phosphate groups and [C(12)mim]Br headgroups but also by hydrophobic interactions among [C(12)mim]Br alkyl chains. Isothermal titration calorimetry analysis indicated that the [C(12)mim]Br aggregation in the presence and absence of DNA are both thermodynamically favored driven by enthalpy and entropy. DNA undergoes size transition and conformational change induced by [C(12)mim]Br, and the charges of DNA are neutralized by the added [C(12)mim]Br. Various microstructures were observed such as DNA with loose coil conformation in nature state, necklace-like structures, and compact spherical aggregates. MD simulation showed that the polyelectrolyte collapses upon the addition of oppositely charged surfactants and the aggregation of surfactants around the polyelectrolyte was reaffirmed. The simulation predicted the gradual neutralization of the negatively charged polyelectrolyte by the surfactant, consistent with the experimental results. Copyright © 2012 Elsevier B.V. All rights reserved.
Stenov, Vibeke; Wind, Gitte; Skinner, Timothy; Reventlow, Susanne; Hempler, Nana Folmann
2017-09-18
Healthcare professionals' person-centered communication skills are pivotal for successful group-based diabetes education. However, healthcare professionals are often insufficiently equipped to facilitate person-centeredness and many have never received post-graduate training. Currently, assessing professionals' skills in conducting group-based, person-centered diabetes education primarily focus on experts measuring and coding skills on various scales. However, learner-centered approaches such as adequate self-reflective tools have been shown to emphasize professional autonomy and promote engagement. The aim of this study was to explore the potential of a self-assessment tool to identify healthcare professionals' strengths and areas in need of professional development to aid effective facilitation of group-based, person-centered diabetes education. The study entails of two components: 1) Field observations of five different educational settings including 49 persons with diabetes and 13 healthcare professionals, followed by interviews with 5 healthcare professionals and 28 persons with type 2 diabetes. 2) One professional development workshop involving 14 healthcare professionals. Healthcare professionals were asked to assess their person-centered communication skills using a self-assessment tool based on challenges and skills related to four educator roles: Embracer, Facilitator, Translator, and Initiator. Data were analyzed by hermeneutic analysis. Theories derived from theoretical model 'The Health Education Juggler' and techniques from 'Motivational Interviewing in Groups' were used as a framework to analyze data. Subsequently, the analysis from the field notes and interview transcript were compared with healthcare professionals' self-assessments of strengths and areas in need to effectively facilitate group-based, person-centered diabetes education. Healthcare professionals self-assessed the Translator and the Embracer to be the two most skilled roles whereas
Quasi-exclusive measurement of /sup 12/C(/sup 12/C, 3. cap alpha. )X at 2. 1 GeV/nucleon
Energy Technology Data Exchange (ETDEWEB)
Engelage, J; Baumgartner, M; Greiner, D E; Lindstrom, P J; Olson, D L; Wada, R; Crawford, H J; Webb, M L
1986-05-29
A study of the reaction /sup 12/C(/sup 12/C,3..cap alpha..)X at 2.1 GeV/nucleon has been completed. The energy and momentum transferred to the /sup 12/C projectile and the cross section for the dissociation of /sup 12/C into three alpha particles have been measured, 9.7 (+5.0/-2.5) millibarns. It is found that the results from this analysis are inconsistent with the predictions of current theoretical models for peripheral relativistic heavy ion collisions.
Elastic scattering, inelastic scattering, and transfer reactions induced by 12C bombardment of 12C
International Nuclear Information System (INIS)
Stokstad, R.G.; Wieland, R.M.; Fulmer, C.B.; Hensley, D.C.; Raman, S.; Snell, A.H.; Stelson, P.H.
1977-06-01
Graphs and tables of differential cross sections are presented for the elastic scattering of 12 C by 12 C, the single excitation (Q = -4.43 MeV) and the mutual excitation (Q = -8.86 MeV) for 14 bombarding energies in the range 70.7 less than or equal to E/sub lab/ less than or equal to 126.7 MeV. Differential cross sections for one- and two-nucleon transfer are presented for E/sub lab/ = 93.8 MeV
Probing the possibility of a C-12/C-13 galactic abundance gradient
International Nuclear Information System (INIS)
Hawkins, I.
1990-01-01
High S/N (equal to or greater than 500) observations of interstellar CH+ with the 3.0 m telescope were performed at Lick Observatory and with the 4.0 m telescope at CTIO, of the reddened, early-type stars HD 183143, HD 24432, and HD 157038 in an effort to probe the existence of a C-12/C-13 abundance gradient in our Galaxy. Previous very high quality optical observations of interstellar CH+ toward five stars within 1 kpc of the Sun have yielded a precise weighted mean C-12/C-13 isotope ratio of 43 plus or minus 4 (1 sigma) (Hawkins, Jura, and Meyer 1985; Hawkins and Jura 1987). The isotope ratios derived toward four lines of sight in the local ISM are uniform within 12 percent. The similarity among these carbon isotope ratios determined in diffuse clouds possessing different physical conditions precludes the possibility that the CH+ molecule is suffering from isotope selective effects in these regions. The precise C-12/C-13 derivable from high quality observations of (12)CH+ and (13)CH+ provide the unique opportunity to probe the homogeneity of the ISM in a large scale and the history of nucleosynthesis in our Galaxy. Since CH+ seems to be the most sensitive probe of C-12/C-13 in the diffuse ISM, observations toward more distant stars located up to 2.5 kpc from the Sun are the best way to study the possibility of a Galactic (C-12/C-13) abundance gradient. The researcher obtained 4232 angstrom data toward all three of the stars mentioned above, 3957 angstrom data toward HD 183143 and HD 157038, and 3745 angstrom data toward HD 157038. Because of the poorer quality of the HD 24432 spectrum, and its weaker CH+ absorption lines, the satellite (13)CH+ line was not detected, and thus only a lower limit on the C-12/C-13 ratio toward this star was obtained. The results obtained from careful reduction and analysis of the data toward these stars in the Northern and Southern Hemispheres are presented
SRS-sensor 13C/12C isotops measurements for detecting Helicobacter Pylori
Grishkanich, Aleksandr; Chubchenko, Yan; Elizarov, Valentin; Zhevlakov, Aleksandr; Konopelko, Leonid
2018-02-01
We developed SRS-sensor 13C/12C isotops measurements detecting Helicobacter Pylori for medical diagnostics of human health. Measuring of absolute 13C/12C isotope amount ratios allows to explore the topical problems of the modern world, alcoholic beverages and tobacco, medical diagnostics of human health. SRS method is used to measure the ratio of carbon isotopes in the exhaled carbon dioxide, which is used to diagnose the human infection of Helicobacter pylori and the influence of the Helicobacter pylori bacterium on the occurrence of gastritis, gastric and duodenal ulcers. A method for the analysis of human infection with Helicobacter pylori was developed on the basis of measurements of the ratio of 13C / 12C carbon isotopes in human exhaled air with a high level of measurement accuracy. The article reviews the work in the field of provision comparability of absolute 13C/12C isotope amount ratios in the environment and food. The analysis of the technical and metrological characteristics of traditional and perspective instruments for measuring isotope ratios is presented. The provision of comparability of absolute 13C/12C isotope amount ratios is carried by gravimetrically prepared reference standards. The key features and emerging issues are discussed.
β‐Taxilin participates in differentiation of C2C12 myoblasts into myotubes
Energy Technology Data Exchange (ETDEWEB)
Sakane, Hiroshi; Makiyama, Tomohiko; Nogami, Satoru; Horii, Yukimi [Department of Molecular and Cell Biology, Graduate school of Medicine, Dokkyo Medical University, 880 Kitakobayashi, Mibu-town, Tochigi 321-0293 (Japan); Akasaki, Kenji [Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, Fukuyama, Hiroshima 729-0292 (Japan); Shirataki, Hiromichi, E-mail: hiro-sh@dokkyomed.ac.jp [Department of Molecular and Cell Biology, Graduate school of Medicine, Dokkyo Medical University, 880 Kitakobayashi, Mibu-town, Tochigi 321-0293 (Japan)
2016-07-15
Myogenesis is required for the development of skeletal muscle. Accumulating evidence indicates that the expression of several genes are upregulated during myogenesis and these genes play pivotal roles in myogenesis. However, the molecular mechanism underlying myogenesis is not fully understood. In this study, we found that β-taxilin, which is specifically expressed in the skeletal muscle and heart tissues, was progressively expressed during differentiation of C2C12 myoblasts into myotubes, prompting us to investigate the role of β-taxilin in myogenesis. In C2C12 cells, knockdown of β-taxilin impaired the fusion of myoblasts into myotubes, and decreased the diameter of myotubes. We also found that β-taxilin interacted with dysbindin, a coiled-coil-containing protein. Knockdown of dysbindin conversely promoted the fusion of myoblasts into myotubes and increased the diameter of myotubes in C2C12 cells. Furthermore, knockdown of dysbindin attenuated the inhibitory effect of β-taxilin depletion on myotube formation of C2C12 cells. These results demonstrate that β-taxilin participates in myogenesis through suppressing the function of dysbindin to inhibit the differentiation of C2C12 myoblasts into myotubes. - Highlights: • β‐Taxilin is progressively expressed during differentiation of C2C12 cell. • Knockdown of β-taxilin impaired C2C12 myotube formation. • β‐Taxilin interacted with dysbindin. • Knockdown of dysbindin promoted C2C12 myotube formation. • The function of β-taxilin in C2C12 myotube formation depends on dysbindin.
Directory of Open Access Journals (Sweden)
Carmen Martínez-Losada
2017-07-01
Full Text Available Donor natural killer (NK cells can destroy residual leukemic cells after allogeneic hematopoietic stem cell transplantation. This effect is based on the interaction of killer-cell immunoglobulin-like receptors (KIR of donor NK cells with ligands of the major histocompatibility complex found on the surface of the target cells. HLA-C1 subtypes provide the ligand for KIR2DL2 and KIR2DL3 and the HLA-C2 subtypes for KIR2DL1. We have studied the probability of relapse (PR after single-unit unrelated cord blood transplantation (UCBT in relation to the potential graft-vs.-leukemia effect mediated by NK cells present in the umbilical cord blood (UCB by analyzing KIR-ligand and HLA-C typing of the receptor. Data from 33 consecutive patients given a single unit UCBT were included. We have considered two groups of patients based on the absence or the presence of one of the C-ligands for inhibitory KIR and the incompatibility HLA-C1/2 between UCB and patients. Group 1 (n = 21: the patient lacks a C-ligand for inhibitory KIR present in UCB NK cells, i.e., patients homozygous C1/C1 or C2/C2. Group 2 (n = 12: patients heterozygous C1/C2 in which KIR-mediated graft-vs.-leukemia effect is not expected (presence of both C ligands for inhibitory KIR in the receptor. With a median follow-up post-UCBT of 93 months, patients with absence of a C-ligand for inhibitory KIRs (Group 1 showed a lower actuarial PR than patients with both C-ligands (group 2: 21 ± 10 vs. 68 ± 18% at 2 year and 36 ± 13 vs. 84 ± 14% at 5 years (p = 0.025, respectively. In patients with acute lymphoblastic leukemia, the 2-year PR was 36 ± 21% for group 1 and 66 ± 26% for 2 (p = 0.038. Furthermore, group 1 had a lower incidence of grades II–IV acute graft-vs.-host disease (p = 0.04. In the setting of UCBT, the absence of a C-ligand (C1 or C2 of inhibitory KIR in the patient is associated with lower PR, which is probably due to the graft
Ethane's 12C/13C Ratio in Titan: Implications for Methane Replenishment
Jennings, Donald E.; Nixon, C. A.; Romani, P. N.; Bjoraker, G. L.; Sada, P. V.; Lunsford, A. W.; Boyle, R. J.; Hesman, B. E.; McCabe, G. H.
2009-01-01
As the .main destination of carbon in the destruction of methane in the atmosphere of Titan, ethane provides information about the carbon isotopic composition of the reservoir from which methane is replenished. If the amount of methane entering the atmosphere is presently equal to the amount converted to ethane, the 12C/13C ratio in ethane should be close to the ratio in the reservoir. We have measured the 12C/13C ratio in ethane both with Cassini CIRS(exp 1) and from the ground and find that it is very close to the telluric standard and outer planet values (89), consistent with a primordial origin for the methane reservoir. The lower 12C/13C ratio measured for methane by Huygens GCMS (82.3) can be explained if the conversion of CH4 to CH3 (and C2H6) favors 12C over 13C with a carbon kinetic isotope effect of 1.08. The time required for the atmospheric methane to reach equilibrium, i.e., for replenishment to equal destruction, is approximately 5 methane atmospheric lifetimes.
Local versus nonlocal αα interactions in a 3α description of 12C
International Nuclear Information System (INIS)
Suzuki, Y.; Matsumura, H.; Orabi, M.; Fujiwara, Y.; Descouvemont, P.; Theeten, M.; Baye, D.
2008-01-01
Local αα potentials reproducing the αα phase shifts fail to describe 12 C as a 3α system. Nonlocal αα potentials that renormalize the energy-dependent kernel of the resonating group method allow interpreting simultaneously the ground state and 0 2 + resonance of 12 C as 3α states. A comparison with fully microscopic calculations provides a measure of the importance of three-cluster exchanges in those states
Leptin rapidly activates PPARs in C2C12 muscle cells
International Nuclear Information System (INIS)
Bendinelli, Paola; Piccoletti, Roberta; Maroni, Paola
2005-01-01
Experimental evidence suggests that leptin operates on the tissues, including skeletal muscle, also by modulating gene expression. Using electrophoretic mobility shift assays, we have shown that physiological doses of leptin promptly increase the binding of C2C12 cell nuclear extracts to peroxisome proliferator-activated receptor (PPAR) response elements in oligonucleotide probes and that all three PPAR isoforms participate in DNA-binding complexes. We pre-treated C2C12 cells with AACOCF 3 , a specific inhibitor of cytosolic phospholipase A 2 (cPLA 2 ), an enzyme that supplies ligands to PPARs, and found that it abrogates leptin-induced PPAR DNA-binding activity. Leptin treatment significantly increased cPLA 2 activity, evaluated as the release of [ 3 H]arachidonic acid from pre-labelled C2C12 cells, as well as phosphorylation. Further, using MEK1 inhibitor PD-98059 we showed that leptin activates cPLA 2 through ERK induction. These results support a direct effect of leptin on skeletal muscle cells, and suggest that the hormone may modulate muscle transcription also by precocious activation of PPARs through ERK-cPLA 2 pathway
The role of three-body coulomb fields versus final state interactions in the decay of 12C-α-12C
International Nuclear Information System (INIS)
Quebert, J.L.; Bertault, D.; Scheurer, J.N.; Fouan, J.P.
1980-01-01
The alpha emission in 16 O + 12 C→ 12 C + α + 12 C has been thoroughly studied in the region of the rapidity plot: Ysub(α)=Ysub(c.m.). The three-body coulomb fields, as well as configurations close to alignment, account for the alpha yield which is observed. The apparent competition between direct and sequential decays is well explained by the coulomb break-up
Measurements of fusion cross section for 12C +63,65 Cu systems
International Nuclear Information System (INIS)
Rocha, C.A. da.
1987-01-01
Cross-section measurements for nuclear fusion in the 12 C+ 63.65 Cu system, at 12 C energy range from 0.9 to 1.8 times the Coulomb barrier are presented. In order to detect and to obtain the mass identification of the evaporation residues following the fusion process, the time of flight method was adopted in conjunction with an eletrostatic deflector capable of separating the evaporation residues from the beam particles. The limitation and advantadges of this method of measurement are discussed. The excitation functions were analysed using the unidimensional barrier penetration model with different nuclear potentials. Theoretical fusion cross-section values obtained from this analysis were systematically smaller than our measured values, in the energy region below the Coulomb barrier. In order to discover which channel enhances the fusion cross-section in this region, a coupled channel calculation was performed, with the CCFUS code. The experimental data for the above reactions were compared with the systems 16.18 O+ 63.65 Cu, measured by our group. In this comparison, it was noted that the systems 12 C+ 63.65 Cu, have greater fusion cross section below the Coulomb barrier. The comparison of velocity spectra of the evaporated residues for the two systems shows that 12 C+ 63 Cu has a strong reaction channel that was not present in the 12 C+ 65 Cu system. (author) [pt
The 90deg excitation function for elastic 12C+12C scattering. The importance of Airy elephants
International Nuclear Information System (INIS)
McVoy, K.W.; Brandan, M.E.
1992-01-01
The 90deg excitation function for elastic 12 C+ 12 C scattering, at laboratory energies between the Coulomb barrier and 130 MeV, exhibits a complex structure of peaks and valleys whose nature has remained an unsolved mystery for more than 20 years. The problem has primarily been caused by the difficulty of choosing from a plethora of discretely ambiguous optical potentials. However, data accumulated above 150 MeV over the last decade have determined unique potentials at these higher energies, and the requirement of continuity downward in energy has recently permitted the determination of a unique set of potentials for angular distributions at energies below 130 MeV, where the excitation-function data exist. These new potentials are used to provide a mean-field (i.e., nonresonant) interpretation of the structure in the 12 C+ 12 C 90deg excitation function between 70 and 130 MeV. Its most prominent minima are found to be Airy minima from nuclear rainbows, with the remaining structure arising primarily from more elementary optical phenomena related to Fraunhofer diffraction. These same potentials are also successful in explaining the details of excitation functions measured very recently at other angles by Morsad. (orig.)
Evidence for the 3-fold α-cluster symmetry of 12C
International Nuclear Information System (INIS)
Rae, W.D.M.; Fry, P.E.; Merchant, A.C.
1996-01-01
Recently, resonances have been observed in the reactions 12 C( 12 C, 12 C(O 2 + )) 12 C(3 - ) and 12 C( 12 C, 12 C(3 - )) 12 C(3 - ) at E cm ∼ 33 MeV. Previously resonances in the reaction 12 C( 12 C, 12 C) 12 C(3 - ) have been reported by Fulton et al. Here we present a new model of these resonances. We relate this model to the classical theory of both the asymmetric rotor and the symmetric top. We believe that detailed spin measurements from these data will provide evidence for the 3-fold symmetry of 12 C. (author). Letter-to-the-editor
X-ray diffraction study of the binding of the antisickling agent 12C79 to human hemoglobin
International Nuclear Information System (INIS)
Wireko, R.C.; Abraham, D.J.
1991-01-01
The hemoglobin binding site of the antisickling agent 12C79 has been determined by x-ray crystallography. 12C79 is recognized as one of the first molecules to reach clinical trials that was designed, de novo, from x-ray-determined atomic coordinates of a protein. Several previous attempts to verify the proposed Hb binding sites via crystallographic studies have failed. Using revised experimental procedures, the authors obtained 12C79-deoxhemoglobin crystals grown after reaction with oxyhemoglobin and cyanoborohydride reduction to stabilize the Schiff base linkage. The difference electron-density Fourier maps show that two 12C79 molecules bind covalently to both symmetry-related N-terminal amino groups of the hemoglobin α chains. This is in contrast to the original design that proposed the binding of one drug molecule that spans the molecular dyad to interact with both N-terminal α-amino groups
Mou, Yan; Xu, Dan; Mao, Ziling; Dong, Xuejiao; Lin, Fengke; Wang, Ali; Lai, Daowan; Zhou, Ligang; Xie, Bingyan
2015-11-12
The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents both butyl oleate and liquid paraffin were the most effective to improve palmarumycins C12 and C13 production. The addition of dibutyl phthalate, butyl oleate and oleic acid to the cultures of Berkleasmium sp. Dzf12 significantly enhanced palmarumycin C12 production by adsorbing palmarumycin C12 into the organic phase. When butyl oleate was fed at 5% (v/v) in medium at the beginning of fermentation (day 0), the highest palmarumycin C12 yield (191.6 mg/L) was achieved, about a 34.87-fold increase in comparison with the control (5.3 mg/L). n-Dodecane, 1-hexadecene and liquid paraffin had a great influence on the production of palmarumycin C13. When liquid paraffin was added at 10% (v/v) in medium on day 3 of fermentation, the palmarumycin C13 yield reached a maximum value (134.1 mg/L), which was 4.35-fold that of the control (30.8 mg/L). Application of the aqueous-organic solvent system should be a simple and efficient process strategy for enhancing palmarumycin C12 and C13 production in liquid cultures of the endophytic fungus Berkleasmium sp. Dzf12.
Directory of Open Access Journals (Sweden)
Yan Mou
2015-11-01
Full Text Available The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents both butyl oleate and liquid paraffin were the most effective to improve palmarumycins C12 and C13 production. The addition of dibutyl phthalate, butyl oleate and oleic acid to the cultures of Berkleasmium sp. Dzf12 significantly enhanced palmarumycin C12 production by adsorbing palmarumycin C12 into the organic phase. When butyl oleate was fed at 5% (v/v in medium at the beginning of fermentation (day 0, the highest palmarumycin C12 yield (191.6 mg/L was achieved, about a 34.87-fold increase in comparison with the control (5.3 mg/L. n-Dodecane, 1-hexadecene and liquid paraffin had a great influence on the production of palmarumycin C13. When liquid paraffin was added at 10% (v/v in medium on day 3 of fermentation, the palmarumycin C13 yield reached a maximum value (134.1 mg/L, which was 4.35-fold that of the control (30.8 mg/L. Application of the aqueous-organic solvent system should be a simple and efficient process strategy for enhancing palmarumycin C12 and C13 production in liquid cultures of the endophytic fungus Berkleasmium sp. Dzf12.
Excited states in 22Mg via the 12C(12C,2n)22Mg reaction
International Nuclear Information System (INIS)
Jewett, Cybele; Baktash, Cyrus; Bardayan, Daniel W.; Blackmon, Jeff C.; Chipps, K.; Galindo-Uribarri, Alfredo; Greife, U.; Gross, Carl J.; Jones, K. L.; Liang, Junjien; Livesay, Jake; Kozub, R. L.; Nesaraja, Caroline D; Radford, David C.; Sarazin, F.; Smith, Michael Scott; Thomas, J. S.; Yu, Chang-Hong
2007-01-01
The 12C(12C, 2n)22Mg reaction was measured with the CLARION array and the RMS separator at the Holifield Facility of Oak Ridge National Laboratory. This experiment was performed to gather more information on the excited states in 22Mg, which might be of relevance to recent radioactive ion beam measurements of the astrophysically important 21Na(p,γ)22Mg reaction. The results are compared to direct measurements, transfer experiments and a competing experiment performed with Gammasphere
Social representations about criminals and crimes in various professional groups of young people
Directory of Open Access Journals (Sweden)
Yakushenko A.V.
2014-12-01
Full Text Available Describes a study whose purpose was to study the peculiarities of social representations of crime and criminals in different groups of students. The sample included 88 people aged 18 to 27 years, divided into four groups, depending on the subject of professionalization - psychologists, lawyers, journalists, representatives of technical professions. The study is based on the ideas of the theory of social representations proposed S.Moskovisi. The main method of study was a survey in a variant form, including an associative technique, the technique of "incomplete sentences", as well as open and closed questions. Associations were analyzed using analysis of prototypical proposed P.Verzhesom. The results obtained by Method "offers Incomplete" were to machine-using content analysis. Testable hypothesis regarding the specifics of professional social representations in various student groups received polnouyu or partial empirical support.
International Nuclear Information System (INIS)
Iqbal, A.; Haseeb, M.Q.; Olimov, K.K.; Khan, Imran; Yuldashev, B.S.
2014-01-01
The dependences of the experimental transverse momentum spectra of the negative pions, produced in minimum bias 12 C + 12 C collisions at a momentum of 4.2A GeV/c, on the collision centrality and the pion rapidity range were studied. To analyze quantitatively the change in the p t spectra of π - mesons with the changes of collision centrality and pion rapidity range, the extracted p t spectra were fitted by Hagedorn, Boltzmann, simple exponential and Gaussian functions. The values of the extracted spectral temperatures T 1 and T 2 were consistently larger for the p t spectra of π - mesons coming from midrapidity range as compared to those of the negative pions generated in the target and projectile fragmentation regions. The spectral temperatures T 1 and T 2 extracted from fitting the p t spectra of π - mesons in range p t = 0.1–1.2 GeV/c practically coincided with each other in peripheral, semicentral and central 12 C + 12 C collision events, and thus did not show any collision centrality dependence. However, the values of T 1 and T 2 extracted from fitting in range p t = 0.1–0.7 GeV/c were consistently and noticeably larger in case of central collisions as compared to peripheral and semicentral 12 C + 12 C collisions. Hagedorn and Boltzmann functions provided significantly better fits of the transverse momentum spectra of the negative pions with the physically acceptable values of the extracted temperatures as compared to Gaussian and simple exponential functions. (author)
Negative-binomial multiplicity distributions in the interaction of light ions with 12C at 4.2 GeV/c
International Nuclear Information System (INIS)
Tucholski, A.; Bogdanowicz, J.; Moroz, Z.; Wojtkowska, J.
1989-01-01
Multiplicity distribution of single-charged particles in the interaction of p, d, α and 12 C projectiles with C target nuclei at 4.2 GeV/c were analysed in terms of the negative binomial distribution. The experimental data obtained by the Dubna Propane Bubble Chamber Group were used. It is shown that the experimental distributions are satisfactorily described by the negative-binomial distribution. Values of the parameters of these distributions are discussed. (orig.)
Hem, Marit Helene; Molewijk, Bert; Gjerberg, Elisabeth; Lillemoen, Lillian; Pedersen, Reidar
2018-06-05
Professionals within the mental health services face many ethical dilemmas and challenging situations regarding the use of coercion. The purpose of this study was to evaluate the significance of participating in systematic ethics reflection groups focusing on ethical challenges related to coercion. In 2013 and 2014, 20 focus group interviews with 127 participants were conducted. The interviews were tape recorded and transcribed verbatim. The analysis is inspired by the concept of 'bricolage' which means our approach was inductive. Most participants report positive experiences with participating in ethics reflection groups: A systematic and well-structured approach to discuss ethical challenges, increased consciousness of formal and informal coercion, a possibility to challenge problematic concepts, attitudes and practices, improved professional competence and confidence, greater trust within the team, more constructive disagreement and room for internal critique, less judgmental reactions and more reasoned approaches, and identification of potential for improvement and alternative courses of action. On several wards, the participation of psychiatrists and psychologists in the reflection groups was missing. The impact of the perceived lack of safety in reflection groups should not be underestimated. Sometimes the method for ethics reflection was utilised in a rigid way. Direct involvement of patients and family was missing. This focus group study indicates the potential of ethics reflection groups to create a moral space in the workplace that promotes critical, reflective and collaborative moral deliberations. Future research, with other designs and methodologies, is needed to further investigate the impact of ethics reflection groups on improving health care practices.
Gender Variant and Transgender Issues in a Professional Development Book Group
Parker, Bruce; Bach, Jacqueline
2009-01-01
The idea for a professional development book group emerged from the authors ongoing conversations with colleagues about how teachers can gain the understanding necessary not only to foster and support gender variant and transgender students, but also incorporate these experiences into their curriculum in a meaningful way. In this article, the…
Energy Technology Data Exchange (ETDEWEB)
Fulton, B.R.; Bennett, S.J.; Freer, M.; Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J.; Jarvis, N.S.; Jones, C.D.; Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Brown, J.D.; Rae, W.D.M.; Smith, A.E. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Lilley, J.S. (Daresbury Lab., Warrington (United Kingdom))
1991-09-19
A new high resolution measurement of the {sup 12}C({sup 24}Mg, {sup 12}C{sup 12}C){sup 12}C breakup reaction has been performed. Sequential breakup is observed from specific states in {sup 24}Mg at excitation energies ranging from 20 to 26 MeV. Angular correlation measurements indicate that states with spins ranging from J=4 to 8 are populated. These states are consistent with superdeformed shape isomeric bands predicted by cranked cluster model and Nilsson-Strutinsky calculations. (orig.).
7 CFR 29.1164 - Cutters (C Group).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Cutters (C Group). 29.1164 Section 29.1164 Agriculture... INSPECTION Standards Grades § 29.1164 Cutters (C Group). This group consists of leaves normally grown at or just below the midportion of the stalk. Leaves of the C group have a tendency to roll concealing the...
Lown, Beth A; McIntosh, Sharrie; Gaines, Martha E; McGuinn, Kathy; Hatem, David S
2016-03-01
Empathy and compassion provide an important foundation for effective collaboration in health care. Compassion (the recognition of and response to the distress and suffering of others) should be consistently offered by health care professionals to patients, families, staff, and one another. However, compassion without collaboration may result in uncoordinated care, while collaboration without compassion may result in technically correct but depersonalized care that fails to meet the unique emotional and psychosocial needs of all involved. Providing compassionate, collaborative care (CCC) is critical to achieving the "triple aim" of improving patients' health and experiences of care while reducing costs. Yet, values and skills related to CCC (or the "Triple C") are not routinely taught, modeled, and assessed across the continuum of learning and practice. To change this paradigm, an interprofessional group of experts recently recommended approaches and a framework for integrating CCC into health professional education and postgraduate training as well as clinical care. In this Perspective, the authors describe how the Triple C framework can be integrated and enhance existing competency standards to advance CCC across the learning and practice continuum. They also discuss strategies for partnering with patients and families to improve health professional education and health care design and delivery through quality improvement projects. They emphasize that compassion and collaboration are important sources of professional, patient, and family satisfaction as well as critical aspects of professionalism and person-centered, relationship-based high-quality care.
Directory of Open Access Journals (Sweden)
France Légaré
Full Text Available Decision-makers in organizations providing continuing professional development (CPD have identified the need for routine assessment of its impact on practice. We sought to develop a theory-based instrument for evaluating the impact of CPD activities on health professionals' clinical behavioral intentions.Our multipronged study had four phases. 1 We systematically reviewed the literature for instruments that used socio-cognitive theories to assess healthcare professionals' clinically-oriented behavioral intentions and/or behaviors; we extracted items relating to the theoretical constructs of an integrated model of healthcare professionals' behaviors and removed duplicates. 2 A committee of researchers and CPD decision-makers selected a pool of items relevant to CPD. 3 An international group of experts (n = 70 reached consensus on the most relevant items using electronic Delphi surveys. 4 We created a preliminary instrument with the items found most relevant and assessed its factorial validity, internal consistency and reliability (weighted kappa over a two-week period among 138 physicians attending a CPD activity. Out of 72 potentially relevant instruments, 47 were analyzed. Of the 1218 items extracted from these, 16% were discarded as improperly phrased and 70% discarded as duplicates. Mapping the remaining items onto the constructs of the integrated model of healthcare professionals' behaviors yielded a minimum of 18 and a maximum of 275 items per construct. The partnership committee retained 61 items covering all seven constructs. Two iterations of the Delphi process produced consensus on a provisional 40-item questionnaire. Exploratory factorial analysis following test-retest resulted in a 12-item questionnaire. Cronbach's coefficients for the constructs varied from 0.77 to 0.85.A 12-item theory-based instrument for assessing the impact of CPD activities on health professionals' clinical behavioral intentions showed adequate validity and
A PLG (Professional Learning Group): How to Stimulate Learners' Engagement in Problem-Solving
Sheety, Alia; Rundell, Frida
2012-01-01
This paper aims to describe, discuss and reflect the use of PLGs (professional learning groups) in higher education as a practice for enhancing student learning and team building. It will use theories supporting group-learning processes, explore optimal social contexts that enhance team collaboration, and reflect on the practice of PLG. The…
The 12C/13C Isotopic Ratio in Planetary Nebulae as Deduced from IUE Data
Miskey, C. L.; Feibelman, W. A.; Bruhweiler, F. C.
2000-05-01
The relative abundances of C, N, and O and the isotopic ratio of 12C/13C represent tracers of nucleosynthesis in intermediate stars with main-sequence masses between 0.6 and 8.0 solar masses in our Galaxy. Determining these abundances and the isotopic 12C/13C ratio in planetary nebulae (PNe) represent perhaps the best means to discern exactly how the ISM is enriched by CNO stellar nucleosynthesis. Walsh et al. (1996) and Clegg et al. (1997), using the Hubble Space Telescope, have derived the isotopic 12C/13C abundance ratio in the galactic carbon-rich PN, NGC 3918, and placed marginal constraints on it for the Magellanic PNe, N2 (SMC) and N122 (LMC). This was done using the well-known 12C 3P-1S (J=1-0 and J=2-0) transitions of C+2 at 1906.68 Angstroms and 1908.77 Angstroms and a J=0-0 transition at 1909.6 Angstroms, which is strictly forbidden in 12C. The finite nuclear spin of 13C (I=1/2) permits a corresponding F=1/2-1/2 electric dipole transition not seen in 12C. Since the 1909.6 Angstroms line is well separated from the other two 12C transitions, it provides an important means of determining 12C/13C in planetary nebulae. We have just completed a search of archival International Ultraviolet Explorer (IUE) high-dispersion spectra of approximately three dozen PNe, and derived 12C/13C ratios of 39 and 23 for the galactic PNe, NGC 2440 and NGC 6302, respectively. These are values much lower than the solar value of 89. In the other objects, the limited S/N of the IUE data indicate 12C/13C ratio upper limits much higher than 50. The implications of these results and their pertinence to stellar evolution are discussed.
File list: InP.Myo.20.AllAg.C2C12 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Myo.20.AllAg.C2C12 mm9 Input control Muscle C2C12 SRX262224,SRX262225,SRX148229...695944 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Myo.20.AllAg.C2C12.bed ...
Trends of 13C/12C ratios in pinyon tree rings of the American Southwest and the global carbon cycle
International Nuclear Information System (INIS)
Leavitt, S.W.; Long, A.
1986-01-01
An accurate atmospheric 13 C/ 12 C chronology can provide important constraints to models of the global carbon cycle. Trees accumulate carbon from atmospheric CO 2 into growth rings and offer potential for 13 C/ 12 C reconstructions, but results have not been reproducible. This paper presents δ 13 C curves from 5 sites, representing 20 pinyon (Pinus edulis) trees, where cores of 4 trees from each site have been pooled into a composite sample. Isotopic analysis of cellulose in 5-yr ring groups produces curves with a general trend of decreasing δ 13 C after 1800, but with pronounced short-term fluctuations superimposed upon the trend. Evidence indicates the fluctuations are strongly related to moisture availability (drought). A mean curve of the 5 δ 13 C chronologies from which the fossil-fuel component is subtracted suggests a substantial biospheric CO 2 contribution to the atmosphere since 1800
Tropea, S; Agodi, C; Blancato, A A; Bondì, M; Cappuzzello, F; Carbone, D; Cavallaro, M; Cirrone, G A P; Cuttone, G; Giacoppo, F; Nicolosi, D; Pandola, L; Raciti, G; Rapisarda, E; Romano, F; Sardina, D; Scuderi, V; Sfienti, C
2014-01-01
Over the last twenty years, there has been a renewed interest in nuclear fragmentation studies for both hadrontherapy applications and space radiation protection. In both fields, fragmentation cross sections are needed to predict the effects of the ions nuclear interactions within the patient’s and the astronaut’s body. Indeed, the Monte Carlo codes used in planning tumor treatments and space missions must be tuned and validated by experimental data. However, only a limited set of fragmentation cross sections are available in literature, especially at Fermi energies. Therefore, we have studied the production of secondary fragments in the 12 C+ 12 C and 12 C+ 197 Au reactions at 62 A MeV. In this work, the measured 4 He cross sections angular distributions at four selected angles are presented and compared.
Generation of particles with large transverse momenta in π--p- and π-12C-interactions at 40 GeV/c
International Nuclear Information System (INIS)
Jordanova, Yu.; Lyubimov, V.; Mitova, S.; Penev, V.N.; Shklovskaya, A.
1981-01-01
The generation of a particle with transverse momenta Psub(transverse)>0.8 GeV/c in π - -p- and π - - 12 C-interactions with a π - -meson beam at a momentum Psub(π)=40 GeV/c in a two-meter propan chamber is investigated. Analyses of the secondary particle correlations produced in the interactions, in which the emitted hadron or group of hadrons have large transverse momenta, are carried out. In the investigated interactions the secondary particle momenta are measured with an accuracy not less than 30%. In the experimental data treatment of the π - - 12 C-collisions the interactions of π - -mesons with the quasifree nucleons of 12 C-nucleus are taken into account on the basis of the multiperipherical model. The experimental data analyses indicate that: 1) In the events with one or more secondary particles having large momenta Psub(transverse)>0.8 GeV/c the asymmetric correlations increase for both π - -p- and π - - 12 C-interactions; 2) Most correlated pairs of secondary particles having Psub(transverse)>0.8 GeV/c are produced with an almost equal rapidity and transverse momenta; 3) The presence of the secondary particles with large transverse momenta does not influence the resonance formation (in particular rho 0 -meson); 4) The effective mass distribution of the two secondary particles with Psub(transverse)>0.8 GeV/c has a broad peak at about 2 GeV/c
International Nuclear Information System (INIS)
Scheurer, J.N.; Bertault, D.; Caussanel, M.; Quebert, J.L.; Fouan, J.P.
1978-01-01
A yield of alpha particles emitted at rest is clearly observed in 16 O+ 12 C at several incident energies. These alpha particles are detected by two methods: i) the alpha particle is considered as a missing mass in the detection of two 12 C nuclei in coincidence; ii) the alpha particle is detected at zero degree with a velocity due to centre of mass motion. Such a yield is assigned to a linear chain formation of the type 12 C-α- 12 C and an excitation function between 40 and 65 MeV is given. The emission due to Coulomb effects is emphasized in the discussion to give the chief explanation of the coincidence results
Mou, Yan; Xu, Dan; Mao, Ziling; Dong, Xuejiao; Lin, Fengke; Wang, Ali; Lai, Daowan; Zhou, Ligang; Xie, Bingyan
2015-01-01
The endophytic fungus Berkleasmium sp. Dzf12, isolated from Dioscorea zingiberensis, was found to produce palmarumycins C12 and C13 which possess a great variety of biological activities. Seven biocompatible water-immiscible organic solvents including n-dodecane, n-hexadecane, 1-hexadecene, liquid paraffin, dibutyl phthalate, butyl oleate and oleic acid were evaluated to improve palmarumycins C12 and C13 production in suspension culture of Berkleasmium sp. Dzf12. Among the chosen solvents bot...
Characterization of an acute muscle contraction model using cultured C2C12 myotubes.
Directory of Open Access Journals (Sweden)
Yasuko Manabe
Full Text Available A cultured C2C12 myotube contraction system was examined for application as a model for acute contraction-induced phenotypes of skeletal muscle. C2C12 myotubes seeded into 4-well rectangular plates were placed in a contraction system equipped with a carbon electrode at each end. The myotubes were stimulated with electric pulses of 50 V at 1 Hz for 3 ms at 997-ms intervals. Approximately 80% of the myotubes were observed to contract microscopically, and the contractions lasted for at least 3 h with electrical stimulation. Calcium ion (Ca²⁺ transient evoked by the electric pulses was detected fluorescently with Fluo-8. Phosphorylation of protein kinase B/Akt (Akt, 5' AMP-activated protein kinase (AMPK, p38 mitogen-activated protein kinase (p38, and c-Jun NH2-terminal kinase (JNK1/2, which are intracellular signaling proteins typically activated in exercised/contracted skeletal muscle, was observed in the electrically stimulated C2C12 myotubes. The contractions induced by the electric pulses increased glucose uptake and depleted glycogen in the C2C12 myotubes. C2C12 myotubes that differentiated after exogenous gene transfection by a lipofection or an electroporation method retained their normal contractile ability by electrical stimulation. These findings show that our C2C12 cell contraction system reproduces the muscle phenotypes that arise invivo (exercise, in situ (hindlimb muscles in an anesthetized animal, and invitro (dissected muscle tissues in incubation buffer by acute muscle contraction, demonstrating that the system is applicable for the analysis of intracellular events evoked by acute muscle contraction.
Ruffolo, Mary C; Kuhn, Mary T; Evans, Mary E
2006-01-01
Building on the respective strengths of parent-led and professional-led groups, a parent-professional team leadership model for group interventions was developed and evaluated for families of youths with emotional and behavioral problems. The model was developed based on feedback from 26 parents in focus group sessions and recommendations from mental health professionals in staff meetings. Evaluations of an implementation of the model in a support, empowerment, and education group intervention (S.E.E. group) have demonstrated the usefulness of this approach in work with families of children with behavioral and emotional problems. This article discusses the challenges of instituting the model in an S.E.E. group. It explores how parents and professionals build the team leadership model and the strengths of this approach in working with parents of youths with serious emotional disturbances.
Leo, Francisco Miguel; González-Ponce, Inmaculada; Sánchez-Oliva, David; Pulido, Juan José; García-Calvo, Tomás
2015-01-01
This investigation presents two studies with the goal of adapting and validating a short version of the Group Environment Questionnaire in the Spanish sport context with professional players. Study 1 used a sample of 377 male soccer players aged between 18 and 39 years ( M = 24.51, SD = 3.73), in a preliminary study using exploratory factor analysis. Study 2 used a sample of 604 professional male and female athletes, ages between 15 and 38 years ( M = 24.34, SD = 4.03). The data analyzed were collected at three moments of the season. For each measurement, we developed seven first- and second-order structures that were analyzed with confirmatory factor analysis. Study 1 indicated appropriate factorial validity (> .60) and internal consistency (> .70), with only Item 3 presenting a low factor loading (.11), so its drafting was modified in the next study. Study 2 revealed that the Spanish version of the GEQ has high levels of internal consistency (> .70) and acceptable fit index values in its original four first-order factor structure in all three measurements ( χ²/df = 4.39, CFI = .95, IFI = .95, RMSEA = .07, SRMR = .04, AIC = 271.09). Discriminant validity (from r = .45 to r = .72) and concurrent validity (from r = .21 to r = .60) also presented appropriate values. Lastly, we conducted analysis of invariance, confirming that the models established in the different measurements were invariant. The short 12-item adaptation of the GEQ to Spanish is a valid and reliable instrument to measure team cohesion in professional male and female soccer players.
Energy Technology Data Exchange (ETDEWEB)
Szilner, S.; Basrak, Z.; Freeman, R.M.; Haas, F.; Beck, C. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires]|[Strasbourg-1 Univ., 67 (France); Morsad, A. [Universite Hassan II, Casablanca (Morocco). Faculte des Sciences
1996-12-31
A prominent and wide resonance centered at E{sub c.m.} = 32.5 MeV has recently been found in the (0{sub 2}{sup +}, 0{sub 2}{sup +}) inelastic channel of the {sup 12}C+{sup 12}C reaction. It has been suggested that it corresponds to a 6{alpha}-particle-chain state in {sup 24}Mg. In the present work we study {sup 12}C+{sup 12}C excitation functions between center-of-mass energies of 30 and 35 MeV in steps of 250 keV for weakly populated outgoing channels. We present the inelastic channels to the states above the {alpha}-particle decay threshold, (0{sub 1}{sup +},0{sub 2}{sup +}), (0{sub 1}{sup +},3{sub 1}{sup -}), and (0{sub 1}{sup +},4{sub 1}{sup 4}), and the one- and two-nucleon transfer channels. In the inelastic and the transfer channels we observe correlated intermediate-width structures at E{sub c.m.} = 31, 32.5, and 33.5 MeV, whose widths are appreciably smaller than the width measured in the (0{sub 2}{sup +},0{sub 2}{sup +}) channel. Our E{sub c.m.} = 31, 32.5, and 33.5 MeV, whose widths are appreciably smaller than the width measured in the (0{sub 2}{sup +},0{sub 2}{sup +}) channel. Our E{sub c.m.} = 32.5 MeV angular distribution of the (0{sub 1}{sup +},0{sub 2}{sup +})channel exhibits oscillatory behavior and, unlike that of the (0{sup +}{sub 2}, 0{sup +}{sub 2}) channel, does not display enhancement around {Theta}{sub c.m.} = 90 deg. Data were collected via the kinematic coincidence technique. For data reduction we use a novel approach allowing for the extraction of results on non-binary channels. (authors). 39 refs.
Laursen, Jannie; Broholm, Malene; Rosenberg, Jacob
2017-09-01
Health professionals must often balance between different rationalities within the hospital organisation. Having adequate time with patients, shorter waiting time and the ability to greater professional autonomy have been shown to help provide a higher quality of care. Empathy and sympathy appear to be crucial components for the health professionals and their relationship to patients. The aim of this study was to explore health professionals' experiences of relatives to critically ill patients in order to identify aspects that may facilitate a better understanding of this teamwork. The study was descriptive and exploratory and had a qualitative design with a phenomenological/hermeneutic orientation for the interviews. Focus group was the chosen methodology. The study comprised 19 health professionals in four focus groups. Two themes emerged from the interviews: the hospital culture does not integrate relatives, and health professionals felt that relatives took their resources and saw them as an obstacle in their daily work. Health professionals felt divided between the system and the individual sphere, which makes it difficult for them to integrate relatives more and see them as participants in a natural teamwork for the benefit of the patient. © 2016 Nordic College of Caring Science.
The 12C/ 13C isotopic ratio in Titan hydrocarbons from Cassini/CIRS infrared spectra
Nixon, C. A.; Achterberg, R. K.; Vinatier, S.; Bézard, B.; Coustenis, A.; Irwin, P. G. J.; Teanby, N. A.; de Kok, R.; Romani, P. N.; Jennings, D. E.; Bjoraker, G. L.; Flasar, F. M.
2008-06-01
We have analyzed infrared spectra of Titan recorded by the Cassini Composite Infrared Spectrometer (CIRS) to measure the isotopic ratio 12C/ 13C in each of three chemical species in Titan's stratosphere: CH 4, C 2H 2 and C 2H 6. This is the first measurement of 12C/ 13C in any C 2 molecule on Titan, and the first measurement of 12CH 4/ 13CH 4 (non-deuterated) on Titan by remote sensing. Our spectra cover five widely-spaced latitudes, 65° S to 71° N and we have searched for both latitude variability of 12C/ 13C within a given species, and also for differences between the 12C/ 13C in the three gases. For CH 4 alone, we find C12/C13=76.6±2.7 (1- σ), essentially in agreement with the 12CH 4/ 13CH 4 measured by the Huygens Gas Chromatograph/Mass Spectrometer instrument (GCMS) [Niemann, H.B., and 17 colleagues, 2005. Nature 438, 779-784]: 82.3±1.0, and also with measured values in H 13CN and 13CH 3D by CIRS at lower precision [Bézard, B., Nixon, C., Kleiner, I., Jennings, D., 2007. Icarus 191, 397-400; Vinatier, S., Bézard, B., Nixon, C., 2007. Icarus 191, 712-721]. For the C 2 species, we find C12/C13=84.8±3.2 in C 2H 2 and 89.8±7.3 in C 2H 6, a possible trend of increasingly value with molecular mass, although these values are both compatible with the Huygens GCMS value to within error bars. There are no convincing trends in latitude. Combining all fifteen measurements, we obtain a value of C12/C13=80.8±2.0, also compatible with GCMS. Therefore, the evidence is mounting that 12C/ 13C is some 8% lower on Titan than on the Earth (88.9, inorganic standard), and lower than typical for the outer planets ( 88±7 [Sada, P.V., McCabe, G.H., Bjoraker, G.L., Jennings, D.E., Reuter, D.C., 1996. Astrophys. J. 472, 903-907]). There is no current model for this enrichment, and we discuss several mechanisms that may be at work.
Zang, Hongjun; Chen, Eugene Y. X.
2015-01-01
There is increasing interest in the upgrading of C5 furfural (FF) and C6 5-hydroxymethyl furfural (HMF) into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs), to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h), when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h). On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed. PMID:25830482
Directory of Open Access Journals (Sweden)
Hongjun Zang
2015-03-01
Full Text Available There is increasing interest in the upgrading of C5 furfural (FF and C6 5-hydroxymethyl furfural (HMF into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs, to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h, when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h. On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed.
Poulsen, Kjeld; Cleal, Bryan; Willaing, Ingrid
2014-12-01
To investigate the extent and socioeconomic distribution of incident diabetes among the Danish working-age population. The Danish National Diabetes Register was linked with socioeconomic and population-based registers covering the entire population. We analysed the 12-year diabetes incidence using multivariate Poisson regression for 2,086,682 people, adjusting for gender, 10-year age groups, main population groups defined by country of origin, and seven socioeconomic groups: professionals, managers, technicians, workers skilled at basic level, unskilled workers, unemployed and pensioners. The crude 12-year incidence of diabetes was 5.8%. The saturated multivariate model, adjusted for gender, age, country of origin and socioeconomic status; showed a relative risk (RR) for diabetes incidence of 1.44 for male (reference: female), 3.95 for the age range of 50-59 years (reference: 30-39 years), 2.07 for unskilled workers (reference: professionals) and 2.15 for people from countries of 'non-Western origin' (reference: Danish origin). Diabetes incidence increases with age, male gender and low socioeconomic status; and also among people from countries of 'non-Western origin'. The results indicate that getting a more senior workforce will substantially increase the proportion of workers with diabetes, especially among already vulnerable groups. © 2014 the Nordic Societies of Public Health.
International Nuclear Information System (INIS)
Klauss, E.U.
1984-01-01
In the present thesis the excitation functions of the reaction 10 B( 14 N, 12 C) 12 C to the ground states, the first excited state at 4.43 MeV (Jsup(π) = 2 1 + ) of a 12 C residual nucleus, and to the double excitation of ejectile and residue nucleus to the 4.43 state are studied. The measurements were performed in an energy range 13MeV 14 N) 0 (in the c.m. system). By a fitting to elastic scattering data the optical potential for 10 B+ 14 N was determined. With this potential it was tried by means of Hauser-Feshbach calculations to calculate the cross sections of the reaction 10 B( 14 N, 12 C) 12 C. The strong 16 + resonance and indications of 18 + in the excitation function of the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 Csub(g.s.) should be pronounced. An unexpected large cross section was observed in the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 C(4 1 + ). This is considered as a further indication to the strong contribution of a direct process. (orig./HSI) [de
Characterizing the astrophysical S factor for 12C+12C fusion with wave-packet dynamics
Diaz-Torres, Alexis; Wiescher, Michael
2018-05-01
A quantitative study of the astrophysically important subbarrier fusion of 12C+12C is presented. Low-energy collisions are described in the body-fixed reference frame using wave-packet dynamics within a nuclear molecular picture. A collective Hamiltonian drives the time propagation of the wave packet through the collective potential-energy landscape. The fusion imaginary potential for specific dinuclear configurations is crucial for understanding the appearance of resonances in the fusion cross section. The theoretical subbarrier fusion cross sections explain some observed resonant structures in the astrophysical S factor. These cross sections monotonically decline towards stellar energies. The structures in the data that are not explained are possibly due to cluster effects in the nuclear molecule, which need to be included in the present approach.
12 CFR 268.601 - EEO group statistics.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false EEO group statistics. 268.601 Section 268.601... RULES REGARDING EQUAL OPPORTUNITY Matters of General Applicability § 268.601 EEO group statistics. (a... solely statistical purpose for which the data is being collected, the need for accuracy, the Board's...
Fragmentation of 12C nuclei in emulsion at 50 GeV/c
International Nuclear Information System (INIS)
El-Naghy, A.
1981-01-01
A total of 852 12 C-emulsion interactions at 4.2 GeV/nucleon was investigated. In 86% of these events, at least one projectile fragment was oberserved in each. The angular distributions of Z = 1,2, and >= 3 projectile fragments are narrow, and the dispersion of the distribution decreases with the increasing of Z. The production cross section of the reaction 12 C + Em → Li (from the projectile) + anything is about 6 x 10 -3 sigmasub(in). Only the projectile-fragmentation events, nsub(h) = O, were studied in detail; the percentage of these events is 10% of the total inelastic events. The events with the maximum probability are those in which α-fragment is the maximum-charged projectile fragment emitted. This indicates that the projectile nuclear structure plays an important role in the fragmentation process. In 1.2% of the total events, 12 C has been dissociated into 3 α-particles. (orig.)
Distinctions, Affiliations, and Professional Knowledge in Financial Reform Expert Groups
DEFF Research Database (Denmark)
Seabrooke, Leonard; Tsingou, Eleni
2014-01-01
to understand the different stresses in reports with and without clear mandates, and the role of important members of the policy community in promoting particular reform ideas. The contribution finds that differences in ideas emerging from the financial reform expert groups reflect nested power relationships...... the reports. Fractal distinctions, such as between ‘behaviour’ or ‘system’ as a reform focus, allow us to locate the object of regulation within expert groups, the experts' professional context and the politics behind the commissioning of work. Analysing fractal distinctions provides a useful way...... in the commissioning of work, constituent audiences and reform priorities among governing institutions, rather than distinct ‘European’ and ‘American’ ideas....
Evaluation of sex specificity on oxidative stress induced in lungs of mice irradiated by 12C6+ ions
International Nuclear Information System (INIS)
Liu Yang; Zhang Hong; Zhang Luwei
2008-01-01
The aim of this work is to identify if there is sex specificity on 12 C 6+ ion-induced oxidative damage in mouse lung at different time points. Kun-Ming mice were divided into two groups, each composed of six males and six females: control group and irradiation group with a single acute dose of 4 Gy. Animals were sacrificed at 2, 4 and 12 h respectively, there lungs were removed immediately, and the oxidative stress-related biomarkers were measured by Diagnostic Reagent Kits. The results showed that the relative activities of superoxide dismutase (4 h), catalase (2 h) and Se-dependent glutathione peroxidase (12 h) have significant changes (P 12 C 6+ ion is pronounced in the lungs of males. We thought that these sex-responded differences may be attributed to the influence of sex hormones. (authors)
Directory of Open Access Journals (Sweden)
Juan Luis Muñoz
2014-12-01
Full Text Available According to the WHO (World Health Organization and the European Union, suicide is considered to be a health problem of prime importance and to be one of the principal causes of unnatural death. In Spain, the number of suicides has increased 12% since 2005 . The Research Project “European Regions Enforcing Actions against Suicide (EUREGENAS, funded by the Health Program 2008-2013, has as main objective the description of an integrated model of Mental Health orientated to the prevention of suicide. The differences that allow distinguishing the meaning of prevention in suicide behavior are described and explained through a qualitative methodological strategy and through the creation of discussion groups formed by different groups of health professionals. The results highlight the existing differences between the diverse health professionals who come more in contact with this problem and it shows as well the coincidence of meaning that suicide has to be considered as a priority in the field of health.
The 12C/13C ratio in stellar atmospheres. VI. Five luminous cool stars
International Nuclear Information System (INIS)
Hinkle, K.H.; Lambert, D.L.; Snell, R.L.
1976-01-01
The isotopic abundance ratio, 12 C/ 13 C, is derived from the CO vibration rotation lines at 1.6 and 2.3 μ for five cool luminous stars by a simple curve-of-growth technique. A new analysis of CN lines at 8000 A is also described for α Sco and α Ori. Results derived independently from CO and CN are in agreement. Final results are 12 C/ 13 C=7 +- 2(α Ori), 12 +- 3(α Sco), 7 +- 3(β Peg), 25 +- 7(chi Cyg), 17 +- 4(α Her), and 7 +- 1.5(α Boo). The α Boo analysis provides a check on the CO curve-of-growth technique; the 12 C/ 13 C ratio from the 2.3 μ CO lines is in good agreement with the previously determined ratio from CN and CH lines
Bonding wood-saxon potential and the mechanism of resonance states in the ''1''2C+''1''2C system
International Nuclear Information System (INIS)
Kim, G.; Khaydarov, R.R.
2001-01-01
In present work the ''1''2C+''1''2C system are investigated in the realistic Woods--Saxon potential with Coulomb interaction. The comparison of the calculated states with the experimental data has shown, that the observed (identified) resonances may be explained by the single-channel description, i.e., as potential resonances. The quadrupole moments and transition probabilities for low-laying states have been calculated
Cloning of the cDNA for human 12-lipoxygenase
International Nuclear Information System (INIS)
Izumi, T.; Hoshiko, S.; Radmark, O.; Samuelsson, B.
1990-01-01
A full-length cDNA clone encoding 12-lipoxygenase was isolated from a human platelet cDNA library by using a cDNA for human reticulocyte 15-lipoxygenase as probe for the initial screening. The cDNA had an open reading frame encoding 662 amino acid residues with a calculated molecular weight of 75,590. Three independent clones revealed minor heterogeneities in their DNA sequences. Thus, in three positions of the deduced amino acid sequence, there is a choice between two different amino acids. The deduced sequence from the clone plT3 showed 65% identity with human reticulocyte 15-lipoxygenase and 42% identity with human leukocyte 5-lipoxygenase. The 12-lipoxygenase cDNA recognized a 3.0-kilobase mRNA species in platelets and human erythroleukemia cells (HEL cells). Phorbol 12-tetradecanoyl 13-acetate induced megakaryocytic differentiation of HEL cells and 12-lipoxygenase activity and increased mRNA for 12-lipoxygenase. The identity of the cloned 12-lipoxygenase was assured by expression in a mammalian cell line (COS cells). Human platelet 12-lipoxygenase has been difficult to purify to homogeneity. The cloning of this cDNA will increase the possibilities to elucidate the structure and function of this enzyme
Hudley, Anne H. Charity; Mallinson, Christine
2017-01-01
Professional development on issues of language and culture is often separate from professional development on issues related to STEM education, resulting in linguistic and cultural gaps in K-12 STEM pedagogy and practice. To address this issue, we have designed a model of professional development in which we work with educators to build cultural…
Brauer, H U; Walther, W; Dick, M
2018-04-01
Legal expert opinions are a crucial instrument of professional self-control in medicine. To give impulses for further development, focus groups were initiated to reflect upon the perspective of legal dental experts. 5 focus group discussions on the topic "Professionalization of legal dental experts" were conducted. A total of 32 experienced legal dental experts participated in the discussions. The results were evaluated by qualitative content analysis. A catalogue of 68 ideas was generated for improvement and divided into 15 categories. Among these were periodic quality circles, interprofessional exchange, supervision of novices and periodic feedback for legal dental experts and dentists. Self-reflection can be included as an instrument for quality improvement of legal dental expert opinions. © Georg Thieme Verlag KG Stuttgart · New York.
13C/12C ratios in human urine concrementes
International Nuclear Information System (INIS)
Hoefs, J.; Armbruster, T.
1978-01-01
Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de
Observation of Λ-hypernuclei in the reaction 12C(π+,K+)/sub Λ/12C
International Nuclear Information System (INIS)
Milner, E.C.
1985-12-01
The observation of Λ-hypernuclear levels in /sub Λ/ 12 C by associated production through the (π + ,K + ) reaction is reported. Spectrometers used in the measurements are discussed. The /sub Λ/ 12 C excitation energy spectra were recorded at laboratory scattering angles of 5.6 0 , 10.3 0 , and 15.2 0 . The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup π/ = 2 + states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (π + ,K + ) reaction, compared to the (K - ,π - ) reaction in which lower spin states are excited. 29 refs., 40 figs
Turner, David A; Fleming, Geoffrey M; Winkler, Margaret; Lee, K Jane; Hamilton, Melinda F; Hornik, Christoph P; Petrillo-Albarano, Toni; Mason, Katherine; Mink, Richard
2015-01-01
Communication and professionalism are often challenging to teach, and the impact of the use of a given approach is not known. We undertook this investigation to establish pediatric critical care medicine (PCCM) trainee perception of education in professionalism and communication and to compare their responses from those obtained from PCCM fellowship program directors. The Education in Pediatric Intensive Care (E.P.I.C.) Investigators used the modified Delphi technique to develop a survey examining teaching of professionalism and communication. After piloting, the survey was sent to all 283 PCCM fellows in training in the United States. Survey response rate was 47% (133 of 283). Despite high rates of teaching overall, deficiencies were noted in all areas of communication and professionalism assessed. The largest areas of deficiency included not being specifically taught how to communicate: as a member of a nonclinical group (reported in 24%), across a broad range of socioeconomic and cultural backgrounds (19%) or how to provide consultation outside of the intensive care unit (17%). Only 50% of fellows rated education in communication as "very good/excellent." However, most felt confident in their communication abilities. For professionalism, fellows reported not being taught accountability (12%), how to conduct a peer review (12%), and how to handle potential conflict between personal beliefs, circumstances, and professional values (10%). Fifty-seven percent of fellows felt that their professionalism education was "very good/excellent," but nearly all expressed confidence in these skills. Compared with program directors, fellows reported more deficiencies in both communication and professionalism. There are numerous components of communication and professionalism that PCCM fellows perceive as not being specifically taught. Despite these deficiencies, fellow confidence remains high. Substantial opportunities exist to improve teaching in these areas. Copyright © 2015
[Muscular trunk stability in professional and amateur volleyball players].
Miltner, O; Siebert, C; Tschaepe, R; Maus, U; Kieffer, O
2010-03-01
The aim of this study was to analyse the efficiency of muscular activity in the trunk stabilisation of professional volleyball players compared to a group of amateur hobby players. The results were compared amongst the groups as well as with a reference group consisting of asymptomatic individuals. The question to be answered was whether or not professional volleyball players possess a characteristic strength profile in their trunk musculature and if differences exist with regard to the individuals' competitive playing level. In this comparative study 12 professional volleyball players (German Bundesliga) and 18 non-professional volleyball players were analysed with regard to their isometric strength profile in all three planes. The reference group was provided by the Proxomed company, which had previously analysed healthy untrained individuals (n = 1045) of various age groups. A sports-specific profile for the musculature of volleyball players revealed a significant reduction in the flexion and rotation strength as well as a well-developed lateral flexion strength (highly significant when compared to the reference group). With reference to the level played, better strength values in flexion and lateral flexion were found among the professional athletes. Professional volleyball players present with a characteristic trunk musculature strength profile. A detailed analysis of the muscle strength of the spine as part of a sports medicine work-up could prove helpful in preventing injuries and overuse problems in professional and hobby volleyball players.
Burlingame, G M; Barlow, S H
1996-10-01
The outcome of clients who saw one of four "expert" professional group therapists selected by peer nomination or four "natural helper" nonprofessional nominated by students is contrasted in a 15-session psychotherapy group. Process measures tapping specific group and "common factors" were drawn from sessions 3, 8, and 14; outcome was assessed at pre, mid, posttreatment, and a 6-month follow-up. Results were examined by leader condition (professional vs. nonprofessional therapists) and time (group development). Virtually no reliable differences were found on measures of outcome primarily because of a floor effect on several measures. Therapist differences on the process measures tapping the "common factors" of therapeutic alliance, client expectancy, and perception of therapists were either nonsignificant or disappeared by the end of treatment. A complex picture of differences on one therapeutic factor (insight), common factor measures and subtle variation in the outcome data suggests a distinct pattern of change, however. Methodological limitations are also addressed including problems inherent in large-scale clinical-trial studies, ethical concerns raised by using nonprofessional leaders, and problems with generalizability, given the absence of significant psychopathology in group members.
DRAGON, a GPI-anchored membrane protein, inhibits BMP signaling in C2C12 myoblasts.
Kanomata, Kazuhiro; Kokabu, Shoichiro; Nojima, Junya; Fukuda, Toru; Katagiri, Takenobu
2009-06-01
Bone morphogenetic proteins (BMPs) induce osteoblastic differentiation of myoblasts via binding to cell surface receptors. Repulsive guidance molecules (RGMs) have been identified as BMP co-receptors. We report here that DRAGON/RGMb, a member of the RGM family, suppressed BMP signaling in C2C12 myoblasts via a novel mechanism. All RGMs were expressed in C2C12 cells that were differentiated into myocytes and osteoblastic cells, but RGMc was not detected in immature cells. In C2C12 cells, only DRAGON suppressed ALP and Id1 promoter activities induced by BMP-4 or by constitutively activated BMP type I receptors. This inhibition by DRAGON was dependent on the secretory form of the von Willbrand factor type D domain. DRAGON even suppressed BMP signaling induced by constitutively activated Smad1. Over-expression of neogenin did not alter the inhibitory capacity of DRAGON. Taken together, these findings indicate that DRAGON may be an inhibitor of BMP signaling in C2C12 myoblasts. We also suggest that a novel molecule(s) expressed on the cell membrane may mediate the signal transduction of DRAGON in order to suppress BMP signaling in C2C12 myoblasts.
From 14C/12C measurements towards radiocarbon dating of ice
Oerlemans, J.; Wal, R.S.W. van de; Roijen, J.J. van; Raynaud, D.; Borg, K. van der; Jong, A.F.M. de; Lipenkov, V.; Huybrechts, P.
1994-01-01
A dry extraction method of CO2 included in glacier ice adds a contamination equivalent to 1.8 μg modern carbon for a 35 μg C sample. This enables radiocarbon dating by accelerator mass spectrometry of 35 μg C samples to about 25 000 BP. Measured 14C/12C ratios are presented for a part of the Vostok
Professional ASPNET 35 SP1 Edition In C# and VB
Evjen, Bill; Rader, Devin
2009-01-01
Professional ASP.NET 3.5 SP1 In C# and VB. ASP.NET 3.5 brings the power of Visual Studio® 2008 along with the multitude of language improvements in C# 2008 and Visual Basic® 2008 as well as powerful new technology called LINQ, together with the ASP.NET 2.0 Framework you already know and love. Packed with valuable coverage of ASP.NET 3.5 SP1, this essential resource offers both C# and VB examples throughout the book, and shares new and updated content on the ADO.NET Entity Framework, ADO.NET Dynamic Data, and ADO.NET Data Services. While ASP.NET 3.5 boasts server controls like the ListView and
Poststreptococcal keratouveitis associated with group C streptococcus pharyngitis
Directory of Open Access Journals (Sweden)
Nataneli N
2011-09-01
Full Text Available Nathaniel Nataneli1, Zenia P Aguilera1, Pearl S Rosenbaum1, Tamar Goldstein1,2, Martin Mayers11Department of Ophthalmology, Bronx-Lebanon Hospital Center, Albert Einstein College of Medicine, Bronx, NY, USA; 2Sackler School of Medicine, Tel Aviv University, Tel Aviv, IsraelPurpose: To report the first case of poststreptococcal syndrome uveitis (PSU in association with group C streptococcus (GCS.Patients and methods: Chart review of a 24-year-old man who presented with bilateral ocular redness, pain, and photophobia for 5 days and "white rings" around his eyes for a duration of 3 days. The patient further reported fever and sore throat in the preceding week. Slit-lamp examination showed bilateral keratouveitis. A thorough uveitis workup, antistreptolysin O (ASLO titer, and throat culture were obtained. The patient was treated with frequent topical steroids and systemic doxycycline. The uveitis and keratitis subsided over the next few weeks, leaving extensive peripheral keratolysis.Results: The results of laboratory diagnostic testing revealed an elevated ASLO, C-reactive protein, as well as HLA-B27 positivity. Throat cultures grew beta-hemolytic GCS; group A streptococcus was culture negative.Conclusion: GCS pharyngitis may be a causative organism of PSU.Keywords: pharyngitis, keratolysis, keratouveitis
Mau, Wilfried; Bengel, Jürgen; Pfeifer, Klaus
2017-04-01
In the German health care system, multiprofessional and coordinated rehabilitation care provides support for successful disease management. Against a background of the conditions and strong dynamics of the provision, this article gives an overview of some of the pertinent developments in rehabilitation-related undergraduate education and advanced professional training of physicians, psychologists, and exercise therapy professions in Germany. Frequently, there are few provisions and great variation between different locations. New conditions, such as the National Competence-Based Learning Objectives for Undergraduate Medical Education, the National Guidelines for Graduate Medical Education, and the ongoing reform of the psychotherapists' law emphasizing training in psychotherapy at university, allow the expectation of a positive effect on the competence of rehabilitation professionals. Education in physiotherapy is developing according to international standards aimed at improved evidence-based care. For the widely evidence-based undergraduate education and advanced professional training in sports and exercise therapy better profiling and professionalization should be sought.
The differential cross section of the 12C(p,p)12C reaction near the resonance at energy 1.726 MeV
International Nuclear Information System (INIS)
Duvanov, S.M.; Kobzev, A.P.
1996-01-01
New experimental results on the differential cross section of the 12 C(p,p) 12 C reaction near the separate resonance at 1726 keV were obtained for the 170 deg scattering angle. The cross section measured with a thin target has been used for computer simulation of the spectra measured for a defined initial proton energy for two thick targets. The precision measurements of the proton energies have been carried out using the resonance of 27 Al(p,γ) 28 Si reaction at 1726.0 keV. The energy scale of the excitation function of the 12 C(p,p) 12 C reaction near the resonance at 1726 keV has been defined more exactly. It will improve the precision of depth profiling of carbon in solids. 11 refs., 5 figs., 1 tab
C30F12.4 influences oogenesis, fat metabolism, and lifespan in C. elegans
Directory of Open Access Journals (Sweden)
Lu Wang
2016-09-01
Full Text Available ABSTRACT Reproduction, fat metabolism, and longevity are intertwined regulatory axes; recent studies in C. elegans have provided evidence that these processes are directly coupled. However, the mechanisms by which they are coupled and the reproductive signals modulating fat metabolism and lifespan are poorly understood. Here, we find that an oogenesis-enriched gene, c30f12.4, is specifically expressed and located in germ cells and early embryos; when the gene is knocked out, oogenesis is disrupted and brood size is decreased. In addition to the reproductive phenotype, we find that the loss of c30f12.4 alters fat metabolism, resulting in decreased fat storage and smaller lipid droplets. Meanwhile, c30f12.4 mutant worms display a shortened lifespan. Our results highlight an important role for c30f12.4 in regulating reproduction, fat homeostasis, and aging in C. elegans, which helps us to better understand the relationship between these processes.
What constitutes an excellent allied health care professional? A multidisciplinary focus group study
Directory of Open Access Journals (Sweden)
Paans W
2013-09-01
Full Text Available Wolter Paans, Inge Wijkamp, Egbert Wiltens, Marca V Wolfensberger Research and Innovation Group Talent Development in Higher Education and Society, Hanze University of Applied Sciences, Groningen, The Netherlands. Background: Determining what constitutes an excellent allied health care professional (AHCP is important, since this is what will guide the development of curricula for training future physical therapists, oral hygienists, speech therapists, diagnostic radiographers, and dietitians. This also determines the quality of care. Aim: To describe perspectives of AHCPs on which characteristics are commonly associated with an excellent AHCP. Methods: AHCPs' perspectives were derived from three focus group discussions. Twenty-one health care professionals participated. The final analysis of the focus group discussions produced eight domains, in which content validity was obtained through a Delphi panel survey of 27 contributing experts. Results: According to the survey, a combination of the following characteristics defines an excellent AHCP: (1 cognizance, to obtain and to apply knowledge in a broad multidisciplinary health care field; (2 cooperativity, to effectively work with others in a multidisciplinary context; (3 communicative, to communicate effectively at different levels in complex situations; (4 initiative, to initiate new ideas, to act proactively, and to follow them through; (5 innovative, to devise new ideas and to implement alternatives beyond current practices; (6 introspective, to self-examine and to reflect; (7 broad perspective, to capture the big picture; and (8 evidence-driven, to find and to use scientific evidence to guide one's decisions. Conclusion: The AHCPs perspectives can be used as a reference for personal improvement for supervisors and professionals in clinical practice and for educational purposes. These perspectives may serve as a guide against which talented students can evaluate themselves. Keywords: clinical
C-12/C-13 Ratio in Ethane on Titan and Implications for Methane's Replenishment
Jennings, Donald E.; Romani, Paul N.; Bjoraker, Gordon L.; Sada, Pedro V.; Nixon, Conor A.; Lunsford, Allen W.; Boyle, Robert J.; Hesman, Brigette E.; McCabe, George H.
2009-01-01
The C-12/C-13 abundance ratio in ethane in the atmosphere of Titan has been measured at 822 cm(sup -1) from high spectral resolution ground-based observations. The value 89(8), coincides with the telluric standard and also agrees with the ratio seen in the outer planets. It is almost identical to the result for ethane on Titan found by the composite infrared spectrometer (CIRS) on Cassini. The C-12/C-13 ratio for ethane is higher than the ratio measured in atmospheric methane by Cassini/Huygens GCMS, 82.3(l), representing an enrichment of C-12 in the ethane that might be explained by a kinetic isotope effect of approximately 1.1 in the formation of methyl radicals. If methane is being continuously resupplied to balance photochemical destruction, then we expect the isotopic composition in the ethane product to equilibrate at close to the same C-12/C-13 ratio as that in the supply. The telluric value of the ratio in ethane then implies that the methane reservoir is primordial.
[Team cohesiveness: opinions of a group of primary health care professionals from Salamanca].
González, F J; de Cabo, A; Morán, M J; Manzano, J M
1993-04-01
To assess the view of a group of Primary care professionals on their level of perception of group cohesiveness in their teams' work dynamic. A descriptive and sectional study. Four urban health centres in Salamanca with a recognised teaching activity. Both health professionals and those outside the Health Service, working in Primary Care, who had been members of their teams for more than a year (N = 90). Descriptive statistics and "Chi squared" tests were employed. 72%. A high level of agreement on the need for team work (95.23%). They perceived their group cohesiveness as being very low (84.21% affirmed that they encounter problems of cohesiveness). The main statements concerning this lack of cohesiveness were: "lack of common objectives" (25.5%), "intolerance between workers" (20.13%), "work not shared" (19.46%) and "the taking of decisions individually" (19.44%). The main causes given were: lack of support from Management (23.74%) and too little training for team work (21.58%). There is a high degree of conviction that the team work model is the most efficacious way of developing Primary Care. However in three of the four teams questioned, there were serious problems preventing the teams' reaching an adequate level of group cohesiveness.
Melo, Lucas Pereira de
2016-08-01
This article analyzes the significance that health professionals attribute to health education groups for people with Type 2 Diabetes Mellitus (T2DM). This ethnographic study was developed with five professionals from an Expanded Family Health team that operated in five diabetes health education groups. Information was gathered using participant observations and semi-structured interviews. Data were analyzed by means of a thematic coding technique. Three different categories emerged: (1) It is a way of educating them: groups as an educational and clinical monitoring forum; (2) they know I will be there for them: the groups as a resource to access the health system; and (3) this serves as a self-help group: after all, what purpose does this group serve? The conclusion reached is that the groups studied were a therapy and support hybrid that, by means of their structure, made it possible for the informants (perhaps, also for the patients) to construct other significance for the standardization of health policies and the dilemma of chronicity. Such hybridization made it possible to create outcomes for the specificities of health work in a "total life" context.
Directing-Group-mediated C-H-Alkynylations.
Caspers, Lucien D; Nachtsheim, Boris J
2018-05-18
C-C triple bonds are amongst the most versatile functional groups in synthetic chemistry. Complementary to the Sonogashira coupling the direct metal-catalyzed alkynylation of C-H bonds has emerged as a highly promising approach in recent years. To guarantee a high regioselectivity suitable directing groups (DGs) are necessary to guide the transition metal (TM) into the right place. In this Focus Review we present the current developments in DG-mediated C(sp 2 )-H and C(sp 3 )-H modifications with terminal alkynes under oxidative conditions and with electrophilic alkynylation reagents. We will discuss further modifications of the alkyne, in particular subsequent cyclizations to carbo- and heterocycles and modifications of the DG in the presence of the alkyne. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Arnberg, Karina; Mølgaard, Christian; Michaelsen, Kim Fleischer
2012-01-01
insulin, and insulin secretion estimated as the plasma C-peptide concentration in overweight adolescents. Overweight adolescents (n = 203) aged 12–15 y with a BMI of 25.4 ± 2.3 kg/m2 (mean ± SD) were randomized to 1 L/d of skim milk, whey, casein, or water for 12 wk. All milk drinks contained 35 g protein....... Outcomes were BMI-for-age Z-scores (BAZs), waist circumference, plasma insulin, homeostatic model assessment, and plasma C-peptide. We found no change in BAZ in the pretest control and water groups, whereas it was greater at 12 wk in the skim milk, whey, and casein groups compared with baseline...... and with the water and pretest control groups. The plasma C-peptide concentration increased from baseline to wk 12 in the whey and casein groups and increments were greater than in the pretest control (P
Hean, Sarah; Clark, Jill Macleod; Adams, Kim; Humphris, Debra
2006-03-01
The extent to which health and social care (HSC) students hold stereotypical views of other HSC professional groups is of great potential importance to team working in health care. This paper explores students' perceptions of different HSC professional groups at the beginning of their university programmes. Findings are presented from an analysis of baseline data collected as part of the New Generation Project longitudinal cohort study which is assessing the impact of interprofessional education over time on a range of variables including stereotyping. Questionnaires were administered to a cohort of over 1200 students from 10 different HSC professional groups entering their first year of university. Stereotypes were measured using a tool adapted from Barnes et al. (2000) designed to elicit stereotype ratings on a range of nine characteristics. The findings confirm that students arrive at university with an established and consistent set of stereotypes about other health and social care professional groups. Stereotypical profiles were compiled for each professional group indicating the distinctive characteristics of the groups as well as the similarities and differences between groups.Midwives, social workers and nurses were rated most highly on interpersonal skills and on being a team player whilst doctors were rated most highly on academic ability. Doctors, midwives and social workers were perceived as having the strongest leadership role, whilst doctors were also rated most highly on decision making. All professions were rated highly on confidence and professional competence and, with the exception of social workers, on practical skills. A comparison of profiles for each professional group reveals that, for example, pharmacists and doctors were perceived as having very similar characteristics as were social workers, midwives and nurses. However, the profiles of nurses and doctors were perceived to be very different. The implications of these similarities and
IGF-1 prevents simvastatin-induced myotoxicity in C2C12 myotubes.
Bonifacio, Annalisa; Sanvee, Gerda M; Brecht, Karin; Kratschmar, Denise V; Odermatt, Alex; Bouitbir, Jamal; Krähenbühl, Stephan
2017-05-01
Statins are generally well tolerated, but treatment with these drugs may be associated with myopathy. The mechanisms of statin-associated myopathy are not completely understood. Statins inhibit AKT phosphorylation by an unclear mechanism, whereas insulin-like growth factor (IGF-1) activates the IGF-1/AKT signaling pathway and promotes muscle growth. The aims of the study were to investigate mechanisms of impaired AKT phosphorylation by simvastatin and to assess effects of IGF-1 on simvastatin-induced myotoxicity in C2C12 myotubes. C2C12 mouse myotubes were exposed to 10 μM simvastatin and/or 10 ng/mL IGF-1 for 18 h. Simvastatin inhibited the IGF-1/AKT signaling pathway, resulting in increased breakdown of myofibrillar proteins, impaired protein synthesis and increased apoptosis. Simvastatin inhibited AKT S473 phosphorylation, indicating reduced activity of mTORC2. In addition, simvastatin impaired stimulation of AKT T308 phosphorylation by IGF-1, indicating reduced activation of the IGF-1R/PI3K pathway by IGF-1. Nevertheless, simvastatin-induced myotoxicity could be at least partially prevented by IGF-1. The protective effects of IGF-1 were mediated by activation of the IGF-1R/AKT signaling cascade. Treatment with IGF-1 also suppressed muscle atrophy markers, restored protein synthesis and inhibited apoptosis. These results were confirmed by normalization of myotube morphology and protein content of C2C12 cells exposed to simvastatin and treated with IGF-1. In conclusion, impaired activity of AKT can be explained by reduced function of mTORC2 and of the IGF-1R/PI3K pathway. IGF-1 can prevent simvastatin-associated cytotoxicity and metabolic effects on C2C12 cells. The study gives insight into mechanisms of simvastatin-associated myotoxicity and provides potential targets for therapeutic intervention.
Cobalt triggers necrotic cell death and atrophy in skeletal C2C12 myotubes
International Nuclear Information System (INIS)
Rovetta, Francesca; Stacchiotti, Alessandra; Faggi, Fiorella; Catalani, Simona; Apostoli, Pietro; Fanzani, Alessandro; Aleo, Maria Francesca
2013-01-01
Severe poisoning has recently been diagnosed in humans having hip implants composed of cobalt–chrome alloys due to the release of particulate wear debris on polyethylene and ceramic implants which stimulates macrophagic infiltration and destroys bone and soft tissue, leading to neurological, sensorial and muscular impairments. Consistent with this premise, in this study, we focused on the mechanisms underlying the toxicity of Co(II) ions on skeletal muscle using mouse skeletal C2C12 myotubes as an in vitro model. As detected using propidium iodide incorporation, increasing CoCl 2 doses (from 5 to 200 μM) affected the viability of C2C12 myotubes, mainly by cell necrosis, which was attenuated by necrostatin-1, an inhibitor of the necroptotic branch of the death domain receptor signaling pathway. On the other hand, apoptosis was hardly detectable as supported by the lack of caspase-3 and -8 activation, the latter resulting in only faint activation after exposure to higher CoCl 2 doses for prolonged time points. Furthermore, CoCl 2 treatment resulted in atrophy of the C2C12 myotubes which was characterized by the increased expression of HSP25 and GRP94 stress proteins and other typical 'pro-atrophic molecular hallmarks, such as early activation of the NF-kB pathway and down-regulation of AKT phosphorylation, followed by the activation of the proteasome and autophagy systems. Overall, these results suggested that cobalt may impact skeletal muscle homeostasis as an inducer of cell necrosis and myofiber atrophy. - Highlights: • The effects of cobalt on muscle myofibers in vitro were investigated. • Cobalt treatment mainly causes cell necrosis in skeletal C2C12 myotubes. • Cobalt impacts the PI3K/AKT and NFkB pathways and induces cell stress markers. • Cobalt induces atrophy of C2C12 myotubes through the activation of proteasome and autophagy systems. • Co treatment triggers NF-kB and PI3K/AKT pathways in C2C12 myotubes
Cobalt triggers necrotic cell death and atrophy in skeletal C2C12 myotubes
Energy Technology Data Exchange (ETDEWEB)
Rovetta, Francesca [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Stacchiotti, Alessandra [Institute of Human Anatomy, Department of Clinical and Experimental Sciences, University of Brescia, Brescia I-25123 (Italy); Faggi, Fiorella [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Catalani, Simona; Apostoli, Pietro [Unit of Occupational Health and Industrial Hygiene, Department of Medical and Surgical Specialties, Radiological Sciences and Public Health, University of Brescia, Brescia I-25123 (Italy); Fanzani, Alessandro, E-mail: fanzani@med.unibs.it [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy); Aleo, Maria Francesca, E-mail: aleo@med.unibs.it [Unit of Biotechnologies, Department of Molecular and Translational Medicine, University of Brescia, Brescia I-25123 (Italy); Interuniversity Institute of Myology (IIM) (Italy)
2013-09-01
Severe poisoning has recently been diagnosed in humans having hip implants composed of cobalt–chrome alloys due to the release of particulate wear debris on polyethylene and ceramic implants which stimulates macrophagic infiltration and destroys bone and soft tissue, leading to neurological, sensorial and muscular impairments. Consistent with this premise, in this study, we focused on the mechanisms underlying the toxicity of Co(II) ions on skeletal muscle using mouse skeletal C2C12 myotubes as an in vitro model. As detected using propidium iodide incorporation, increasing CoCl{sub 2} doses (from 5 to 200 μM) affected the viability of C2C12 myotubes, mainly by cell necrosis, which was attenuated by necrostatin-1, an inhibitor of the necroptotic branch of the death domain receptor signaling pathway. On the other hand, apoptosis was hardly detectable as supported by the lack of caspase-3 and -8 activation, the latter resulting in only faint activation after exposure to higher CoCl{sub 2} doses for prolonged time points. Furthermore, CoCl{sub 2} treatment resulted in atrophy of the C2C12 myotubes which was characterized by the increased expression of HSP25 and GRP94 stress proteins and other typical 'pro-atrophic molecular hallmarks, such as early activation of the NF-kB pathway and down-regulation of AKT phosphorylation, followed by the activation of the proteasome and autophagy systems. Overall, these results suggested that cobalt may impact skeletal muscle homeostasis as an inducer of cell necrosis and myofiber atrophy. - Highlights: • The effects of cobalt on muscle myofibers in vitro were investigated. • Cobalt treatment mainly causes cell necrosis in skeletal C2C12 myotubes. • Cobalt impacts the PI3K/AKT and NFkB pathways and induces cell stress markers. • Cobalt induces atrophy of C2C12 myotubes through the activation of proteasome and autophagy systems. • Co treatment triggers NF-kB and PI3K/AKT pathways in C2C12 myotubes.
International Nuclear Information System (INIS)
Xu Shuai; Ma Xiaofei; Zhang Hong; Liu Yang
2013-01-01
The radioprotective effect of Diallyl disulfide (DADS) on "1"2C"6"+ ion irradiation was studied. Pretreated with DADS of different concentration, male Kung-Ming mice were exposed to whole body irradiation with dosage of 4 Gy "1"2C"6"+ ion. The animals were sacrificed after irradiation. Then the bone marrow cells micronucleus rate, malondialdehyde (MDA) levels, content of protein carbonylation, total antioxidant capacity (T-AOC) and alanine aminotransferase (ALT) activity were measured. As compared with those in irradiated group, the ratio of micronucleus cells in marrow and the hepatic ALT activity in the pretreatment group with low dose DADS decreased significantly (p < O.OOl). Similarly, the content of protein carbonylation and the levels of MDA dropped dramatically in the group with middle dose DADS treatment (p < 0.05). On the contrary, the hepatic T-AOC increased markedly in the group of pretreatment with low dose DADS (p < 0.05). The results showed that DADS protect lipoid, protein and genetic material from "1"2C"6"+ ion irradiation by right of resisting oxidative stress. (authors)
Graphene-Based Patterning and Differentiation of C2C12 Myoblasts
DEFF Research Database (Denmark)
Bajaj, Piyush; Rivera, Jose A; Marchwiany, Daniel
2014-01-01
This study aims at generating highly aligned functional myotubes using graphene as the underlying scaffold. Graphene not only supports the growth of C2C12 muscle cells but also enhances its differentiation and leads to spontaneous patterning of myotubes....
Abrahamsen, C; Nørgaard, B; Draborg, E; Nielsen, D
2017-08-25
For decades hospitals have been "vertically" organized, with the risk that specialization leads to fragmented and one-sided views of patient care and treatment that may cause poor communication and coordination of care and treatment. Two years after the introduction of an orthogeriatric unit for elderly patients admitted with fragility fractures, we studied the involved healthcare professionals' perspectives and experiences with working in an interprofessional organization. We performed four focus groups interviews with 19 healthcare workers representing different professions. The interviews were analysed using systematic text condensation (STC). Three themes were identified: 1) A patient-centred approach, 2) An opportunity for professional growth and 3) The benefits of interprofessional collaboration. The interviewees emphasized in particular the systematic and frequent face-to-face communication enabled by the interprofessional team meetings as essential to their feeling of enhanced collegial solidarity. All groups expressed their respect for other groups' competences and their vital contributions to good orthogeriatric care. However, collaboration was challenged by the groups' divergent views of the patients and of the relevance of the information given in the weekly meetings. Heavy workloads were also mentioned. The opportunity for professional growth was also felt to be imperilled by some professionals. All participants indicated their view that the orthogeriatric organization had improved the quality of care and treatment. Furthermore, good communication, mutual respect for other professional competences and shared goals were found to have enhanced interprofessional collaboration and improved the sense of having a shared mission. However, differences in approaches and expectations continued to challenge the orthogeriatric model after 2 years. Neither did all professionals find orthogeriatric care professionally challenging.
Energy Technology Data Exchange (ETDEWEB)
Meunier, M. [Supelec, 91 - Gif sur Yvette (France); Serre Combe, P. [CEA Grenoble, 38 (France); Sartorelli, G. [Maxwell Technologie, San Diego, CA (United States); Lafont, G. [PILLER France S.A., 92 - Nanterre (France); Green, A. [SAFT, 93170 Bagnolet (France); Perrin, M. [CEA Cadarache, 13 - Saint Paul lez Durance (France); Fregere, J.P.
2004-07-01
These proceedings of the 'Arts et Metiers' professional groups treats of energy storage solutions for delocalized power generation units. Four types of energy storage systems are presented with their operation principle, advantages and drawbacks: fuel cells and hydrogen, super-capacitors, flywheels, conventional batteries (lithium-ion, lead, redox, nickel-cadmium, zinc-air), and comparison between the different energy storage solutions including compressed air. (J.S.)
Gregoire, Marc; Kleper, Scott J
2011-01-01
Essential reading for experienced developers who are determined to master the latest release of C++ Although C++ is often the language of choice from game programming to major commercial software applications, it is also one of the most difficult to master. With this no-nonsense book, you will learn to conquer the latest release of C++. The author deciphers little-known features of C++, shares detailed code examples that you can then plug into your own code, and reveals the significant changes to C++ that accompany the latest release. You'll discover how to design and build applications that
Rickels, David A.; Brewer, Wesley D.
2017-01-01
The purpose of this study was to investigate participation in a Facebook social media community known as Band Director's Group (BDG) through examination of members' demographic profiles, self-reported usage behaviors, and perceptions about how group activity satisfies their professional development needs. Respondents to an online survey (n = 336)…
C-MORE Science Kits: Putting Technology in the Hands of K-12 Teachers and Students
Achilles, K.; Weersing, K.; Daniels, C.; Puniwai, N.; Matsuzaki, J.; Bruno, B. C.
2008-12-01
The Center for Microbial Oceanography: Research and Education (C-MORE) is a NSF Science and Technology Center based at the University of Hawaii. The C-MORE education and outreach program offers a variety of resources and professional development opportunities for science educators, including online resources, participation in oceanography research cruises, teacher-training workshops, mini-grants to incorporate microbial oceanography-related content and activities into their classroom and, most recently, C- MORE science kits. C-MORE science kits provide hands-on classroom, field, and laboratory activities related to microbial oceanography for K-12 students. Each kit comes with complete materials and instructions, and is available free of charge to Hawaii's public school teachers. Several kits are available nationwide. C-MORE science kits cover a range of topics and technologies and are targeted at various grade levels. Here is a sampling of some available kits: 1) Marine Murder Mystery: The Case of the Missing Zooxanthellae. Students learn about the effect of climate change and other environmental threats on coral reef destruction through a murder-mystery experience. Participants also learn how to use DNA to identify a suspect. Grades levels: 3-8. 2) Statistical sampling. Students learn basic statistics through an exercise in random sampling, with applications to microbial oceanography. The laptops provided with this kit enable students to enter, analyze, and graph their data using EXCEL. Grades levels: 6-12. 3) Chlorophyll Lab. A research-quality fluorometer is used to measure the chlorophyll content in marine and freshwater systems. This enables students to compare biomass concentrations in samples collected from various locations. Grades levels: 9-12. 4) Conductivity-Temperature-Depth (CTD). Students predict how certain variables (e.g., temperature, pressure, chlorophyll, oxygen) vary with depth. A CTD, attached to a laptop computer, is deployed into deep water
BAMBI Promotes C2C12 Myogenic Differentiation by Enhancing Wnt/β-Catenin Signaling
Directory of Open Access Journals (Sweden)
Qiangling Zhang
2015-08-01
Full Text Available Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI is regarded as an essential regulator of cell proliferation and differentiation that represses transforming growth factor-β and enhances Wnt/β-catenin signaling in various cell types. However, its role in skeletal muscle remains largely unknown. In the current study, we found that the expression level of BAMBI peaked in the early differentiation phase of the C2C12 rodent myoblast cell line. Knockdown of BAMBI via siRNA inhibited C2C12 differentiation, indicated by repressed MyoD, MyoG, and MyHC expression as well as reductions in the differentiation and fusion indices. BAMBI knockdown reduced the activity of Wnt/β-catenin signaling, as characterized by the decreased nuclear translocation of β-catenin and the lowered transcription of Axin2, which is a well-documented target gene of the Wnt/β-catenin signaling pathway. Furthermore, treatment with LiCl, an activator of Wnt/β-catenin signaling, rescued the reduction in C2C12 differentiation caused by BAMBI siRNA. Taken together, our data suggest that BAMBI is required for normal C2C12 differentiation, and that its role in myogenesis is mediated by the Wnt/β-catenin pathway.
Oracle database 12c release 2 in-memory tips and techniques for maximum performance
Banerjee, Joyjeet
2017-01-01
This Oracle Press guide shows, step-by-step, how to optimize database performance and cut transaction processing time using Oracle Database 12c Release 2 In-Memory. Oracle Database 12c Release 2 In-Memory: Tips and Techniques for Maximum Performance features hands-on instructions, best practices, and expert tips from an Oracle enterprise architect. You will learn how to deploy the software, use In-Memory Advisor, build queries, and interoperate with Oracle RAC and Multitenant. A complete chapter of case studies illustrates real-world applications. • Configure Oracle Database 12c and construct In-Memory enabled databases • Edit and control In-Memory options from the graphical interface • Implement In-Memory with Oracle Real Application Clusters • Use the In-Memory Advisor to determine what objects to keep In-Memory • Optimize In-Memory queries using groups, expressions, and aggregations • Maximize performance using Oracle Exadata Database Machine and In-Memory option • Use Swingbench to create d...
Patterson, Freyr; Fleming, Jennifer; Marshall, Kathryn; Ninness, Nadine
2017-10-01
Professional practice education is a core and essential component of occupational therapy training. With increasing numbers of education programmes and more students requiring professional practice placements, development of innovative models of professional practice education has emerged, but these require investigation. The aim of this study was to investigate student experiences and perceptions of the Student-Led Groups Program model of professional practice education in an inpatient brain injury rehabilitation unit. A qualitative approach, guided by phenomenological theory was used. Participants were 15 students who had completed a professional practice placement in the Student-Led Groups Program. Data were collected using in-depth semi-structured interviews and analysed thematically. Three over-arching themes emerged from the data; balance of support and freedom, development of clinical skills and missed opportunities. Students described how the structure of the placement facilitated independent learning and autonomy that was balanced with support from clinicians and student peers. Students perceived that they had developed a breadth of clinical skills and also had missed some learning opportunities in this professional practice placement structure. Overall student perceptions of the Student-Led Groups Program were positive, supporting the continued use of this model of professional practice education in this setting. The results highlight the value of structured and consistent approaches for supervision, including the use of formal approaches to peer supervision in the initial stages of learning. © 2017 Occupational Therapy Australia.
17 CFR 240.15c1-2 - Fraud and misrepresentation.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...
29 CFR 779.504 - The retailer and section 12(c).
2010-07-01
... Child Labor Provisions § 779.504 The retailer and section 12(c). Section 12(c) was amended in 1961 to prohibit the employment of oppressive child labor in any enterprise engaged in commerce or in the... comply with section 12(c) of the child labor provisions of the Act. As stated in § 779.503, compliance...
Cluster correlation effects in 12C+12C and 14N+10B fusion-evaporation reactions
Directory of Open Access Journals (Sweden)
Morelli L.
2015-01-01
Full Text Available The decay of highly excited states of 24Mg is studied in fusion evaporation events completely detected in charge in the reactions 12C+12C and 14N+10B at 95 and 80 MeV incident energy respectively. The comparison of light charged particles measured spectra with statistical model predictions suggests that the dominant reaction mechanism is compound nucleus (CN formation and decay. However, in both reactions, a discrepancy with statistical expectations is found for α particles detected in coincidence with Carbon, Oxigen and Neon residues. The comparison between the two reactions shows that this discrepancy is only partly explained by an entrance channel effect. Evidence for cluster correlations in excited 24Mg CN is suggested by the comparison between the measured and calculated branching ratios for the channels involving α particles.
DEFF Research Database (Denmark)
Stenov, Vibeke; Wind, Gitte; Skinner, Timothy
2017-01-01
engagement. The aim of this study was to explore the potential of a self-assessment tool to identify healthcare professionals’ strengths and areas in need of professional development to aid effective facilitation of group-based, person-centered diabetes education. Methods: The study entails of two components......: 1) Field observations of five different educational settings including 49 persons with diabetes and 13 healthcare professionals, followed by interviews with 5 healthcare professionals and 28 persons with type 2 diabetes. 2) One professional development workshop involving 14 healthcare professionals...
Excited states of 12C above the alpha-decay threshold
International Nuclear Information System (INIS)
Freer, M; Ashwood, N I; Barr, M; Curtis, N; Malcolm, J D; Wheldon, C; Ziman, V A; Almaraz-Calderon, S; Aprahamian, A; Bucher, B; Couder, M; Fang, X; Jung, F; Lu, W; Roberts, A; Tan, W P; Copp, P; Lesher, S
2011-01-01
The excitation energy spectrum of 12 C is important for both structural and astrophysical reasons; here we present evidence for a new state in 12 C. The two reactions 12 C( 4 He, 4 He+ 4 He+ 4 He) 4 He and 9 Be( 4 He, 4 He+ 4 He+ 4 He)n were measured using an array of four double sided strip detectors. Excited states in 12 C were reconstructed filtered by the condition that the alpha-decay proceeded via the 8 Be ground-state. In both measurements evidence was found for a new state at 13.3(0.2) MeV with a width 1.7(0.2) MeV. Angular correlation measurements from the 12 C( 4 He, 4 He+ 4 He+ 4 He) 4 He reaction indicates that the state may have J π = 4 + .
Directory of Open Access Journals (Sweden)
Sonia Ghiasi
2017-01-01
Full Text Available The aim of this study was to investigate the effect of 12 weeks moderate intensity aerobic exercise on leptin and C-reactive protein serum levels in obese men. The study was conducted in Urmia- Iran in 2015. Twenty-four obese men with an aged range 40-50 yrs. were enrolled into the study. Subjects were randomized to one of 2 groups exercise (n=12 and control groups (n=12. The exercise group performed aerobic exercise training up to 50-70 % heart rate reserve, three times a week for 12 weeks. Leptin and CRP serum level was measured by ELISA method before and after the 12 weeks. After 12 weeks exercise training, leptin and CRP serum level in the exercise group compared to the control group, were decreased significantly (P<0.05. To sum up, 12 weeks moderate intensity aerobic exercise in the reduction of CRP and leptin concentration had a prominent role that might be effective in reducing weight and improving cardiovascular risk factors.
Cendejas-Bueno, E.; Kolecka, A.; Alastruey-Izquierdo, A.; Theelen, B.; Groenewald, M.; Kostrzewa, M.; Cuenca-Estrella, M.; Gomez-Lopez, A.; Boekhout, T.
2012-01-01
The Candida haemulonii species complex is currently known as C. haemulonii groups I and II. Here we describe C. haemulonii group II as a new species, Candida duobushaemulonii sp. nov., and C. haemulonii var. vulnera as new a variety of C. haemulonii group I using phenotypic and molecular methods.
Effects of Continuing Professional Development on Group Work Practices in Scottish Primary Schools
Thurston, A.; Christie, D.; Howe, C. J.; Tolmie, A.; Topping, K. J.
2008-01-01
The present study investigated the effects of a continuing professional development (CPD) initiative that provided collaborative group work skills training for primary school teachers. The study collected data from 24 primary school classrooms in different schools in a variety of urban and rural settings. The sample was composed of 332 pupils,…
Magnitude of 14C/12C variations based on archaeological samples
International Nuclear Information System (INIS)
Kusumgar, S.; Agrawal, D.P.
1977-01-01
The magnitude of 14 C/ 12 C variations in the period A.D. 5O0 to 200 B.C. and 370 B.C. to 2900 B.C. is discussed. The 14 C dates of well-dated archaeological samples from India and Egypt do not show any significant divergence from the historical ages. On the other hand, the corrections based on dendrochronological samples show marked deviations for the same time period. A plea is, therefore, made to study old tree samples from Anatolia and Irish bogs and archaeological samples from west Asia to arrive at a more realistic calibration curve. (author)
7 CFR 29.2438 - Thin Leaf (C Group).
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Thin Leaf (C Group). 29.2438 Section 29.2438... REGULATIONS TOBACCO INSPECTION Standards Grades § 29.2438 Thin Leaf (C Group). This group consists of leaves... body than those of the B group, and show little or no ground injury. Choice- and fine-quality tobacco...
Chromosomal aberrations induced by 12C6+ ions and 6Co γ-rays in mouse immature oocytes
International Nuclear Information System (INIS)
Zhang Hong; Duan Xin; Yuan Zhigang; Li Wenjian; Zhou Guangming; Zhou Qingming; Bing Liu; Min Fengling; Li Xiaoda; Xie Yi
2006-01-01
The ovaries of Kun-Ming strain mice (3 weeks) were irradiated with different doses of 12 C 6+ ion or 6 Co γ-ray. Chromosomal aberrations were analyzed in metaphase II oocytes at 7 weeks after irradiation. The relative biological effectiveness (RBE) of 12 C 6+ ion was calculated with respect to 6 Co γ-ray for the induction of chromosomal aberrations. The 12 C 6+ ion and 6 Co γ-ray dose-response relationships for chromosomal aberrations were plotted by linear quadratic models. The data showed that there was a dose-related increase in frequency of chromosomal aberrations in all the treated groups compared to controls. The RBE values for 12 C 6+ ions relative to 6 Co γ-rays were 2.49, 2.29, 1.57, 1.42 or 1.32 for the doses of 0.5, 1.0, 2.0, 4.0 or 6.0 Gy, respectively. Moreover, a different distribution of the various types of aberrations has been found for 12 C 6+ ion and 6 Co γ-ray irradiations. The dose-response relationships for 12 C 6+ ion and 6 Co γ-ray exhibited positive correlations. The results from the present study may be helpful for assessing genetic damage following exposure of immature oocytes to ionizing radiation
Bakke, Christine K.
2013-01-01
The purpose of this study is to examine whether participation in robotics provides opportunities for educational and professional skill development, significant enough to merit the recommendation of robotics courses as a part of mainstream curriculum offerings in K-12 schools. This non-experimental, mixed methods study examined current junior high…
Bahreini, Masoud; Moattari, Marzieh; Shahamat, Shohreh; Dobaradaran, Sina; Ravanipour, Mariam
2013-03-01
The aim of the study was to determine the effect of a portfolio-based professional development program on nurses' competence in a university hospital in Iran. A pre-test/post-test, controlled, quasi-experimental design was used. From the university hospital's 18 general wards, four wards were randomly selected. Two wards were randomly allocated as the experimental group (35 subjects) and two wards as the control group (38 subjects). Nurses in the experimental group participated in a 12-month portfolio-based professional development program and nurses in the control group participated in the routine professional development programs of their wards. The data were collected by the Nurse Competence Scale and were analyzed using descriptive statistics and independent and paired t-tests. After intervention, the average nurses' competence in the experimental group increased significantly (P professional portfolio is an effective tool for improving nurses' competence. The professional portfolios help nurses update their knowledge, skills, and competence towards their full role as nurses. © 2012 Wiley Publishing Asia Pty Ltd.
12C-12C total and reaction cross-section between 6 and 85 MeV/A from an optical model analysis
International Nuclear Information System (INIS)
Brandan, M.E.
1982-07-01
Values of σsub(R) and σsub(T) are obtained from an optical model analysis of 12 C- 12 C elastic scattering data between 6 and 85 MeV/A. They confirm the general trends predicted by DeVries and collaborators but show discrepancies at the region of the maxima. The o.m. analysis indicates a significant decrease of the real potential strength with energy
Energy Technology Data Exchange (ETDEWEB)
Ladron de Guevara, P
1973-07-01
We present the main results of a 0.33 events/urban experiment of {pi}{sup +} interactions in hydrogen at 1.2 GeV/c, using the 80 cm Saclay bubble chamber. the partial cross sections of the different reactions and the elastic differential cross section are computed by normalizing to the total cross section obtained by other groups. (Author) 34 refs.
Getting started with Oracle WebLogic Server 12c developer's guide
Nunes, Fabio Mazanatti
2013-01-01
Getting Started with Oracle WebLogic Server 12c is a fast-paced and feature-packed book, designed to get you working with Java EE 6, JDK 7 and Oracle WebLogic Server 12c straight away, so start developing your own applications.Getting Started with Oracle WebLogic Server 12c: Developer's Guide is written for developers who are just getting started, or who have some experience, with Java EE who want to learn how to develop for and use Oracle WebLogic Server. Getting Started with Oracle WebLogic Server 12c: Developer's Guide also provides a great overview of the updated features of the 12c releas
Jong, M. de; Harmsen, M.G.; Hoogerbrugge, N.; Massuger, L.F.A.G.; Hermens, R.P.M.G.; Hullu, J.A. de
2015-01-01
OBJECTIVE: To identify influencing factors of BRCA1/2 mutation carriers and their professionals for risk-reducing salpingectomy (RRS) with delayed oophorectomy (RRO) as a substitute for risk-reducing salpingo-oophorectomy (RRSO) and for study participation on this concept. METHODS: A qualitative
Apoptosis in differentiating C2C12 muscle cells selectively targets Bcl-2-deficient myotubes
Schoneich, Christian; Dremina, Elena; Galeva, Nadezhda; Sharov, Victor
2014-01-01
Muscle cell apoptosis accompanies normal muscle development and regeneration, as well as degenerative diseases and aging. C2C12 murine myoblast cells represent a common model to study muscle differentiation. Though it was already shown that myogenic differentiation of C2C12 cells is accompanied by enhanced apoptosis in a fraction of cells, either the cell population sensitive to apoptosis or regulatory mechanisms for the apoptotic response are unclear so far. In the current study we characterize apoptotic phenotypes of different types of C2C12 cells at all stages of differentiation, and report here that myotubes of differentiated C2C12 cells with low levels of anti-apoptotic Bcl-2 expression are particularly vulnerable to apoptosis even though they are displaying low levels of pro-apoptotic proteins Bax, Bak and Bad. In contrast, reserve cells exhibit higher levels of Bcl-2 and high resistance to apoptosis. The transfection of proliferating myoblasts with Bcl-2 prior to differentiation did not protect against spontaneous apoptosis accompanying differentiation of C2C12 cell but led to Bcl-2 overexpression in myotubes and to significant protection from apoptotic cell loss caused by exposure to hydrogen peroxide. Overall, our data advocate for a Bcl-2-dependent mechanism of apoptosis in differentiated muscle cells. However, downstream processes for spontaneous and hydrogen peroxide induced apoptosis are not completely similar. Apoptosis in differentiating myoblasts and myotubes is regulated not through interaction of Bcl-2 with pro-apoptotic Bcl-2 family proteins such as Bax, Bak, and Bad. PMID:24129924
de Lasson, Lydia; Just, Eva; Stegeager, Nikolaj; Malling, Bente
2016-06-24
The transition from student to medical doctor is challenging and stressful to many junior doctors. To practice with confidence and professionalism the junior doctors have to develop a strong professional identity. Various suggestions on how to facilitate formation of professional identity have been offered including the possible positive effect of group-coaching courses. The purpose of this study was to explore how group-coaching might facilitate professional identity formation among junior doctors in the transition period. Group-coaching courses comprising three whole-day sessions and five 2 h sessions during a period of 4 months were offered to junior doctors in the first years after graduation. The purpose was to support the participants' professional development, ability to relate to patients, relatives and staff and career development. The coaches in this study had a background as health professionals combined with coaching educations. Data was obtained through observations, open-ended questionnaires and interviews. A generic thematic analysis was applied. Forty-five doctors participated in six coaching groups. The three main themes emerging in the sessions were: Adoption to medical culture, career planning, and work/life-balance. The junior doctors found the coaching intervention highly useful in order to cope with these challenges. Furthermore, the group was a forum where the junior doctors could share thoughts and feelings with colleagues without being afraid that this would endanger their professional career. Many found new ways to respond to everyday challenges mainly through a new awareness of patterns of thinking and feeling. The participants found that the group-coaching course supported their professional identity formation (thinking, feeling and acting as a doctor), adoption to medical culture, career planning and managing a healthy work/life-balance. Further studies in different contexts are recommended as well as studies using other methods to
IAEA INTOR Workshop report, group 12
International Nuclear Information System (INIS)
1980-01-01
This report gives the material for the IAEA INTOR Workshop for data base discussion in Group 12, Start-up, Burn and Shutdown. Number of problem areas from the generation of a plasma to the termination of the discharge are covered, which should be assessed to develop a scenario for sustaining a plasma for the whole duration of a pulse. The reactor relevant burn pulse is also assessed. (author)
Sustaining K-12 professional development in geology: Recurrent participation in Rockcamp
Repine, T.E.; Hemler, D.A.; Behling, R.E.
2004-01-01
A reconnaissance study of the geology professional development program known as RockCamp was initiated to examine the sustained, or recurrent, participation of K-12 science teachers. Open-ended interviews, concept mapping, and creative writing assignments were used to explore the perceptions of six teachers possessing an exceptional record of participation. Efficacy, fun, right time of life, and support emerged as unanimous reasons for recurrent participation. Content, friendship, and methodology were very important. College credit was not critical. These teachers' perceptions suggest their sustained involvement in the RockCamp Program is stimulated by situated learning experiences stressing a compare, contrast, connect, and construct pedagogy within a supportive learning community.
Directory of Open Access Journals (Sweden)
Paola Pelegrineli Artilheiro
2010-06-01
Full Text Available O ultra-som terapêutico (US é um recurso bioestimulante utilizado para propiciar reparo muscular de melhor qualidade e menor duração, mas o potencial terapêutico do US contínuo não está totalmente estabelecido. O objetivo deste trabalho foi avaliar o efeito do US contínuo sobre a proliferação e viabilidade de células musculares precursoras (mioblastos C2C12. Mioblastos C2C12 foram cultivados em meio de cultura contendo 10% de soro fetal bovino e irradiados com US contínuo nas freqüências de 1 e 3 MHz nas intensidades de 0,2 e 0,5 W/cm2, durante 2 e 5 minutos. A viabilidade e proliferação celular foram avaliadas após 24, 48 e 72 h de incubação. Grupos não-irradiados serviram como controle. Foram realizados experimentos independentes em cada condição acima, e os dados obtidos submetidos à análise estatística. Os resultados mostram que não houve diferença estatisticamente significativa na proliferação e viabilidade celular entre os mioblastos tratados com US e as culturas controles após os diferentes períodos de incubação, em todos os parâmetros avaliados. Conclui-se que o US contínuo, nos parâmetros avaliados, não foi capaz de alterar a proliferação e viabilidade dos mioblastos.Therapeutic ultrasound (US is a biophysical stimulation resource widely used in order to promote better, faster muscle repair, but the effectiveness of continuous US in treating injuries is not fully established. The aim of the present in vitro study was to assess the effects of continuous ultrasound on viability and proliferation of skeletal muscle precursor cells (C2C12 myoblasts. C2C12 myoblasts were cultured in a medium containing 10% foetal bovine serum and irradiated with continuous ultrasound at 1 and 3 MHz frequencies, at intensities of 0.2 and 0.5 W/cm² for 2 and 5 minutes. Cell viability and proliferation were assessed after different incubation periods (24, 48 and 72 h. Non-irradiated groups served as control and data were
Directory of Open Access Journals (Sweden)
S. Coca
2005-09-01
I (p=0.028 and group III (p = 0.019. Other parameters measured, such as biggest tumor size and total tumoral volume were found to be lower in group II, although no statistical differences were found between groups. Only 10% of rats in group I showed moderated/extensive NK cell infiltration, vs. 60% of rats in group II (p = 0.077 and 70% in group III (p = 0.02. Conclusion: The administration of DMH to rodents provides a reliable and consistent means of inducing CRC that may be suitable for the evaluation of anti-cancer therapies. Our findings suggest that IL-12 is effective against the development of experimental CRC. Its antineoplastic effect could be attributed to the stimulus of this cytokine on the intratumoral infiltration of NK cells.Objetivo: la interleucina (IL-12 es una citocina que estimula la proliferación y la actividad citotóxica de los linfocito T y las células natural killer (NK. En trabajos previos se ha observado una relación entre la infiltración intratumoral de células NK y una mayor supervivencia en carcinomas colorrectales (CCR. Existen evidencias de un efecto aditivo en la actividad inmunomoduladora de la asociación de IL-12 con IL-2. Así, nos hemos propuesto el estudio de la capacidad de respuesta inmune antitumoral, tras la administración sistémica de IL-12 sola o combinada con IL-2, en un modelo experimental de CCR inducidos mediante la administración de 1,2-dimetilhidracina (DMH. Método: sesenta y cinco ratas Wistar de 6 semanas a las que se administró en inyección subcutánea una dosis semanal de DMH a razón de 20 mg/kg de peso durante 26 semanas. Finalizado el periodo de inducción, los animales se distribuyeron aleatoriamente en tres grupos. I: grupo control. Grupo II, se administró IL-12 recombinante murina. Grupo III: se administró IL-12, combinada con IL-2. Las ratas se sacrificaron en la semana 30, estudiándose los siguientes parámetros: número y localización de tumores, tamaño y carga tumoral. Se realiz
Directory of Open Access Journals (Sweden)
Katsuma M.
2014-03-01
Full Text Available The total quantum number N of the α+12C rotational bands in 16O is determined by a study of α+12C elastic scattering. The 8+ and 9− states are found around the excitation energy Ex = 30 MeV and they are the member of the known rotational bands. At the same time, the 02+ state (Ex = 6.05 MeV is found to be dominated by N = 8.
Neutron Scattering Differential Cross Sections for 12C
Byrd, Stephen T.; Hicks, S. F.; Nickel, M. T.; Block, S. G.; Peters, E. E.; Ramirez, A. P. D.; Mukhopadhyay, S.; McEllistrem, M. T.; Yates, S. W.; Vanhoy, J. R.
2016-09-01
Because of the prevalence of its use in the nuclear energy industry and for our overall understanding of the interactions of neutrons with matter, accurately determining the effects of fast neutrons scattering from 12C is important. Previously measured 12C inelastic neutron scattering differential cross sections found in the National Nuclear Data Center (NNDC) show significant discrepancies (>30%). Seeking to resolve these discrepancies, neutron inelastic and elastic scattering differential cross sections for 12C were measured at the University of Kentucky Acceleratory Laboratory for incident neutron energies of 5.58, 5.83, and 6.04 MeV. Quasi mono-energetic neutrons were scattered off an enriched 12C target (>99.99%) and detected by a C6D6 liquid scintillation detector. Time-of-flight (TOF) techniques were used to determine scattered neutron energies and allowed for elastic/inelastic scattering distinction. Relative detector efficiencies were determined through direct measurements of neutrons produced by the 2H(d,n) and 3H(p,n) source reactions, and absolute normalization factors were found by comparing 1H scattering measurements to accepted NNDC values. This experimental procedure has been successfully used for prior neutron scattering measurements and seems well-suited to our current objective. Significant challenges were encountered, however, with measuring the neutron detector efficiency over the broad incident neutron energy range required for these measurements. Funding for this research was provided by the National Nuclear Security Administration (NNSA).
Li, Ming; Cui, Yao; Li, Xiqing; Guo, Yanwu; Wang, Bin; Zhang, Jiadong; Xu, Jian; Han, Shuangyin; Shi, Xiwen
2016-08-01
The aim of this study was to explore changes in tumor tissues of glioma-bearing rats that underwent argon-helium cryoablation as well as changes in antitumor immunity before and after combined interleukin 12 treatment. Two hundred sixty Wistar rats were randomly divided into a blank control group, intravenous injection interleukin-12 group, cryotherapy group, and cryotherapy + intravenous injection group. C6 glioma cells proliferated in vitro were implanted subcutaneously on the backs of rats to establish C6 glioma-bearing animal models. Each group underwent the corresponding treatments, and morphological changes in tumor tissues were examined using hematoxylin-eosin staining. CD11c staining was examined using immunohistochemistry, and differences in dendritic cells and T-cell subsets before and after treatment were analyzed using flow cytometry. The control group showed no statistical changes in terms of tumor tissue morphology and cellular immunity, cryotherapy group, and cryotherapy + intravenous injection group, among which the count for the cryotherapy + intravenous injection group was significantly higher than those of all other groups. In the argon-helium cryotherapy group, tumor cells were damaged and dendritic cell markers were positive. The number of CD11c+ and CD86+ cells increased significantly after the operation as did the cytokine interferon-γ level (P < .01), suggesting a shift toward Th1-type immunity. Combined treatment of argon-helium cryoablation and interleukin 12 for gliomas not only effectively injured tumor tissues but also boosted immune function and increased antitumor ability. Therefore, this approach is a promising treatment measure for brain gliomas. © The Author(s) 2015.
12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C
International Nuclear Information System (INIS)
Ohnuma, H.; Hoshino, N.; Mikoshiba, O.
1985-07-01
The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)
Potent and Selective Covalent Quinazoline Inhibitors of KRAS G12C
Energy Technology Data Exchange (ETDEWEB)
Zeng, Mei; Lu, Jia; Li, Lianbo; Feru, Frederic; Quan, Chunshan; Gero, Thomas W.; Ficarro, Scott B.; Xiong, Yuan; Ambrogio, Chiara; Paranal, Raymond M.; Catalano, Marco; Shao, Jay; Wong, Kwok-Kin; Marto, Jarrod A.; Fischer, Eric S.; Jänne, Pasi A.; Scott, David A.; Westover, Kenneth D.; Gray, Nathanael S. (DFCI); (UTSMC); (Harvard-Med); (NYUSM)
2017-08-01
Targeted covalent small molecules have shown promise for cancers driven by KRAS G12C. Allosteric compounds that access an inducible pocket formed by movement of a dynamic structural element in KRAS, switch II, have been reported, but these compounds require further optimization to enable their advancement into clinical development. We demonstrate that covalent quinazoline-based switch II pocket (SIIP) compounds effectively suppress GTP loading of KRAS G12C, MAPK phosphorylation, and the growth of cancer cells harboring G12C. Notably we find that adding an amide substituent to the quinazoline scaffold allows additional interactions with KRAS G12C, and remarkably increases the labeling efficiency, potency, and selectivity of KRAS G12C inhibitors. Structural studies using X-ray crystallography reveal a new conformation of SIIP and key interactions made by substituents located at the quinazoline 2-, 4-, and 7-positions. Optimized lead compounds in the quinazoline series selectively inhibit KRAS G12C-dependent signaling and cancer cell growth at sub-micromolar concentrations.
Effects of repulsive three-body force in 12C + 12C scattering at 100A MeV
Directory of Open Access Journals (Sweden)
W.W. Qu
2015-12-01
Full Text Available The angular distribution of 12C + 12C scattering at an incident energy of 100A MeV has been measured. The elastic and inelastic scatterings in 12C to the excitation energies of up to ∼45 MeV were measured simultaneously for the first time with the high-resolution Grand Raiden spectrometer at the Research Center for Nuclear Physics (RCNP. The angular distributions of the elastic scattering to the ground state (01+ and inelastic scattering to the 4.44 MeV (21+ excited state were precisely obtained in the angular range of 1.0°–7.5° with a step of 0.1°. Additionally, the angular distribution was obtained for the sum of the cross sections for excitation energies above the 4.44 MeV state up to 11 MeV, which includes the 7.65 MeV (02+, 9.64 MeV (31−, and 10.30 MeV (22+ states, in addition to probably the simultaneous excitation of the 4.44 MeV state in the projectile and the target nuclei. Those combined data provide a means to study the effects of channel coupling on the elastic cross section. The observed angular distributions are compared with theoretical calculations based on three double-folding models with complex G-matrix interactions, the CEG07b, MPa, and ESC models. The importance of three-body repulsive forces included in the CEG07b and MPa models will be discussed.
International Nuclear Information System (INIS)
Abdel-Magied, N.
2013-01-01
The objective of this study was to evaluate the prophylactic efficacy of co-oral administration of vitamin B 12 with vitamin C against radiation induced haematological and biochemical alterations in male albino rats. Male albino rats were divided into six groups (n=8). Group 1: rats were kept as control, Group 2; rats received orally vita-min B 12 (2000μgkg -1 ). Group 3; rats received Vitamin B 12 with Vitamin C (500mgkg -1 ). Group 4; rats whole body exposed to 7Gy of gamma rays. Group 5; rats received vitamin B 12 for 21 successive days before irradiation. Group 6; rats received Vitamin B 12 with Vitamin C for 21 successive days before irradiation. Animals were sacrificed the third day post irradiation. The oral administration of Vitamin B 12 with or with-out Vitamin C enhanced the recovery from radiation-induced haemopoietic injury and some biochemical changes demonstrated by a significant increase (p0.05>) of WBCs, RBCs and Platelets count, Hb content, Hct%, serum erythropoietin and iron levels and a significant reduction (p0.05>) of serum homocysteine level (Hcy), creatine kinase (CK-MB) and lactate dehydrogenase (LDH) activities compared to their respective values in irradiated rats. Improvement of oxidative stress in heart and spleen tissues denoted by a significant decrease in lipid peroxidation (MDA) and a significant increase in glutathione (GSH) content was recorded also. The co-oral administration of vitamin B 12 with vitamin C has no effect on the prophylactic efficacy of vitamin B 12
Spinal instrumentation for unstable C1-2 injury.
Mizuno, J; Nakagawa, H
1999-06-01
Seventeen patients with unstable C1-2 injuries were treated between 1990 and 1997. Various methods of instrumentation surgery were performed in 16 patients, excluding a case of atlantoaxial rotatory fixation. Posterior stabilization was carried out in 14 cases using Halifax interlaminar clamp, Sof'wire or Danek cable, or more recently, transarticular screws. Transodontoid anterior screw fixation was performed in four cases of odontoid process fractures, with posterior instrumentation in two cases because of malunion. Rigid internal fixation by instrumentation surgery for the unstable C1-2 injury avoids long-term application of a Halo brace and facilitates early rehabilitation. However, the procedure is technically demanding with the risk of neural and vascular injuries, particularly with posterior screw fixation. Sagittal reconstruction of thin-sliced computed tomography scans at the C1-2 region, neuronavigator, and intraoperative fluoroscopy are essential to allow preoperative surgical planning and intraoperative guidance.
The reaction 12C + 12C at bombarding energies from 5 to 10 MeV per nucleon
International Nuclear Information System (INIS)
Morsad, A.
1986-01-01
The reaction 12 C + 12 C has been studied for energies ranging from E LAB = 60 to 120 MeV. The excitation functions and angular distributions were obtained for the elastic (0 + , 0 + ) and inelastic (2 + , 0 + ), (2 + , 2 + ) channels as well as for the transfer channels of one and two nucleons. For the transfer reactions, the feeding of the final bound states was very selective. Narrow correlated structures were found in the transfer and especially in the elastic and inelastic channels. In this energy range, there appears to be a transition from surface transparency to interference phenomena. The optical model in its simplest form is unable to describe the elastic scattering at large angles. This has been interpreted as a consequence of the coupling between the elastic and inelastic channels which is particularly strong of these energies. 80 refs [fr
Non commutative geometry methods for group C*-algebras
International Nuclear Information System (INIS)
Do Ngoc Diep.
1996-09-01
This book is intended to provide a quick introduction to the subject. The exposition is scheduled in the sequence, as possible for more understanding for beginners. The author exposed a K-theoretic approach to study group C * -algebras: started in the elementary part, with one example of description of the structure of C * -algebra of the group of affine transformations of the real straight line, continued then for some special classes of solvable and nilpotent Lie groups. In the second advanced part, he introduced the main tools of the theory. In particular, the conception of multidimensional geometric quantization and the index of group C * -algebras were created and developed. (author). Refs
40 CFR 721.10007 - Alcohols, C12-14-secondary, ethoxylated propoxylated.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Alcohols, C12-14-secondary... New Uses for Specific Chemical Substances § 721.10007 Alcohols, C12-14-secondary, ethoxylated... identified as alcohols, C12-14- secondary, ethoxylated propoxylated (PMN P-00-11; CAS No. 103331-86-8) is...
Ladi, Nor Fadzilah Abdul; Masri, Rohaidah; Idrus, Nor'ashiqin Mohd; Ting, Tan Yee
2017-05-01
Bieberbach groups are crystallographic groups. By computing the central subgroup of the nonabelian tensor square of a group, the properties of the group can be determined. In this paper, the central subgroup of the nonabelian tensor square of one Bieberbach group of dimension three with point group C2 × C2 is computed. In order to compute the ∇ (S3 (3)), the derived subgroup and the abelianization of the group are first constructed.
Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18
Directory of Open Access Journals (Sweden)
R. F. Weiss
2012-05-01
Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.
Ma, Fu-Bao; Tao, Hong; Wang, Hong-Jun
2009-10-01
To evaluate the Immunogenicity of Group A and Group C Meningococcal conjugate Vaccine with coupling Group B Meningococcal Outer Membrane Protein (Men B-OMP). 458 healthy children aged 3-5 months, 6-23 months, 2-6 years and 7-24 years were given the Groups A and C conjugate Vaccine with MenB-OMP or other vaccine as control group to measure the pre-and post-vaccination Men A and C and B by Serum Bactericidal Assay (SBA) in the double-blind randomized controlled trial. 97.65%-100% were 4 times or greater increase in SBA titer for the healthy children given the Groups A and C conjugate Vaccine with MenB-OMP, The geometric mean titer of SBA were 1:194-1:420, which significantly higber than controls. The Group A and C conjugate Vaccine with MenB-OMP was safe and well immunogenic.
Directory of Open Access Journals (Sweden)
Zhenguo Dong
2015-01-01
Full Text Available Our previous study reported that muscle cell enhancement factor 2C (MEF2C was fully activated after inhibition of the phosphorylation activity of integrin-linked kinase (ILK in the skeletal muscle cells of goats. It enhanced the binding of promoter or enhancer of transcription factor related to proliferation of muscle cells and then regulated the expression of these genes. In the present investigation, we explored whether ILK activation depended on PI3K to regulate the phosphorylation and transcriptional activity of MEF2C during C2C12 cell proliferation. We inhibited PI3K activity in C2C12 with LY294002 and then found that ILK phosphorylation levels and MEF2C phosphorylation were decreased and that MCK mRNA expression was suppressed significantly. After inhibiting ILK phosphorylation activity with Cpd22 and ILK-shRNA, we found MEF2C phosphorylation activity and MCK mRNA expression were increased extremely significantly. In the presence of Cpd22, PI3K activity inhibition increased MEF2C phosphorylation and MCK mRNA expression indistinctively. We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells. The results provide new ideas for the study of classical signaling pathway of PI3K-ILK-related proteins and transcription factors.
[Investigation on the incidence of genital herpes in different professional groups in Qingdao].
Quan, L
1993-10-01
Genital herpes is one of 8 legally reportable sexually transmitted diseases (STD) in China. Using a HSV antigen ELISA kit we detected and typed HSV antigen in 1,148 clinical specimens collected from the genital organs (penis, cervix, vagina and vulva) of 446 men and 702 women in Qindao and divided into 11 different professional and 2 special groups (patients with cervical cancer and pregnant women). The highest positive rate of HSV antigen was found among long-distance transport drivers (48.0%). The second and third high positive rates were among waiters and waitresses in private, restaurants (39.2%) and patients with cervical cancer (38.2%). The positive rates among self-employed retailers and employees in private inns and restaurants were notably higher than those among employees in state-run shops, restaurants and hotels. And, the positive rate among workers was higher than that among peasants. There was no notable difference between the positive rate of HSV antigen among men (24.2%) and that among women (21.5%). But the incidence of HSV-2 infection was much higher than that of HSV-1 infection. The results indicate that some special professional groups have high rates of genital HSV infection. More attention needs to be paid to these special groups in order to control sexually transmitted herpes diseases.
Zhang, Yaqiong; Yang, Puyu; Yao, Fangyi; Liu, Jie; Yu, Liangli Lucy
2018-02-01
The data presented here are related to the research article entitled "Synthesis and characterization of alkylated caseinate, and its structure-curcumin loading property relationship in water" (Zhang et al., 2018) [1]. This data article reports the detailed spectra information for 1 H NMR, 13 C NMR and UPLC-Q-TOF MS of the N-succinimidyl fatty acid esters with various alkyl chain lengths (Cn-NHSs, n = 8, 12, 14 and 16). 1 H NMR, 13 C NMR and UPLC-Q-TOF MS spectra for C16-NHS are shown as an example. Then the stacked 1 H NMR spectra of the obtained alkylated caseinates (Cn-caseinates, n = 8, 12, 14 and 16) are provided. The surface hydrophobicity index (S 0 ) of Cn-caseinates with different substitution degrees (SD) of alkyl groups is shown. Additionally, Visual appearances for the formed aqueous dispersions of curcumin-loaded native caseinate (NaCas) and Cn-caseinates self-assemblies are shown. X-ray diffraction patterns of curcumin, C16-caseinate, its physical mixture and curcumin-loaded C16-caseinate self-assemblies are examined. The re-dispersibility and short-term storage stability of the curcumin-loaded NaCas and C16-caseinate self-assemblies are also studied.
Neutrino and antineutrino charge-exchange reactions on 12C
International Nuclear Information System (INIS)
Samana, A. R.; Krmpotic, F.; Paar, N.; Bertulani, C. A.
2011-01-01
We extend the formalism of weak interaction processes, obtaining new expressions for the transition rates, which greatly facilitate numerical calculations, for both neutrino-nucleus reactions and muon capture. Explicit violation of the conserved vector current hypothesis by the Coulomb field, as well as development of a sum-rule approach for inclusive cross sections, has been worked out. We have done a thorough study of exclusive (ground-state) properties of 12 B and 12 N within the projected quasiparticle random phase approximation (PQRPA). Good agreement with experimental data achieved in this way put into evidence the limitations of the standard RPA and QRPA models, which come from the inability of the RPA to open the p 3/2 shell and from the nonconservation of the number of particles in the QRPA. The inclusive neutrino/antineutrino (ν/ν-tilde) reactions 12 C(ν,e - ) 12 N and 12 C(ν-tilde,e + ) 12 B are calculated within both the PQRPA and the relativistic QRPA. It is found that (i) the magnitudes of the resulting cross sections are close to the sum-rule limit at low energy, but significantly smaller than this limit at high energies, for both ν and ν-tilde; (ii) they increase steadily when the size of the configuration space is augmented, particularly for ν/ν-tilde energies >200 MeV; and (iii) they converge for sufficiently large configuration space and final-state spin. The quasi-elastic 12 C(ν,μ - ) 12 N cross section recently measured in the MiniBooNE experiment is briefly discussed. We study the decomposition of the inclusive cross section based on the degree of forbiddenness of different multipoles. A few words are dedicated to the ν/ν-tilde- 12 C charge-exchange reactions related to astrophysical applications.
Humphreys, Keith
1998-01-01
Discusses the potential of self-help/mutual-aid groups as a way to reduce the demand for professional substance-abuse treatment and proposes a model that combines the two approaches for cost-effective and therapeutically effective networks of services. (SLD)
Palmer, S; Terry, R; Rimes, K A; Clark, C; Simmonds, J; Horwood, J
2016-03-01
To develop an understanding of patient and health professional views and experiences of physiotherapy to manage joint hypermobility syndrome (JHS). An explorative qualitative design. Seven focus groups were convened, audio recorded, fully transcribed and analysed using a constant comparative method to inductively derive a thematic account of the data. Four geographical areas of the U.K. 25 people with JHS and 16 health professionals (14 physiotherapists and two podiatrists). Both patients and health professionals recognised the chronic heterogeneous nature of JHS and reported a lack of awareness of the condition amongst health professionals, patients and wider society. Diagnosis and subsequent referral to physiotherapy services for JHS was often difficult and convoluted. Referral was often for acute single joint injury, failing to recognise the long-term multi-joint nature of the condition. Health professionals and patients felt that if left undiagnosed, JHS was more difficult to treat because of its chronic nature. When JHS was treated by health professionals with knowledge of the condition patients reported satisfactory outcomes. There was considerable agreement between health professionals and patients regarding an 'ideal' physiotherapy service. Education was reported as an overarching requirement for patients and health care professionals. Physiotherapy should be applied holistically to manage JHS as a long-term condition and should address injury prevention and symptom amelioration rather than cure. Education for health professionals and patients is needed to optimise physiotherapy provision. Further research is required to explore the specific therapeutic actions of physiotherapy for managing JHS. Copyright © 2015 Chartered Society of Physiotherapy. Published by Elsevier Ltd. All rights reserved.
First-principles study on Ca8Cn (n≤12) and CamC12 (m≤8) metal carbides
International Nuclear Information System (INIS)
Chen Gang; Peng Qi; Kawazoe, Yoshiyuki
2011-01-01
We performed an extensive structure optimization for small Ca 8 C n (n≤12) and Ca m C 12 (m≤8) clusters by using density functional theory. The structure would gain CaC 2 bulk characters for Ca 8 C n with n≥7 and Ca m C 12 with m≥6, respectively. Two cage-like structures were found and their structural stability was evaluated by molecular dynamics simulations. The Ca 4s valence electrons are donated to the π orbitals of dicarbon and part of the donated electrons is back donated to the Ca 3d split orbitals. Both Ca and C atoms contribute to the magnetic properties. The net charge on Ca analyzed with Bader technique is about +1.4e.
Energy Technology Data Exchange (ETDEWEB)
Nguyen, Ngoc Uyen Nhi; Liang, Vincent Roderick; Wang, Hao-Ven, E-mail: hvwang@mail.ncku.edu.tw
2014-09-26
Highlights: • Palladin is involved in myogenesis in vitro. • Palladin knockdown by siRNA increases myoblast proliferation, viability and differentiation. • Palladin knockdown decreases C2C12 myoblast migration ability. - Abstract: The actin-associated protein palladin has been shown to be involved in differentiation processes in non-muscle tissues. However, but its function in skeletal muscle has rarely been studied. Palladin plays important roles in the regulation of diverse actin-related signaling in a number of cell types. Since intact actin-cytoskeletal remodeling is necessary for myogenesis, in the present study, we pursue to investigate the role of actin-associated palladin in skeletal muscle differentiation. Palladin in C2C12 myoblasts is knocked-down using specific small interfering RNA (siRNA). The results show that down-regulation of palladin decreased migratory activity of mouse skeletal muscle C2C12 myoblasts. Furthermore, the depletion of palladin enhances C2C12 vitality and proliferation. Of note, the loss of palladin promotes C2C12 to express the myosin heavy chain, suggesting that palladin has a role in the modulation of C2C12 differentiation. It is thus proposed that palladin is required for normal C2C12 myogenesis in vitro.
International Nuclear Information System (INIS)
Nguyen, Ngoc Uyen Nhi; Liang, Vincent Roderick; Wang, Hao-Ven
2014-01-01
Highlights: • Palladin is involved in myogenesis in vitro. • Palladin knockdown by siRNA increases myoblast proliferation, viability and differentiation. • Palladin knockdown decreases C2C12 myoblast migration ability. - Abstract: The actin-associated protein palladin has been shown to be involved in differentiation processes in non-muscle tissues. However, but its function in skeletal muscle has rarely been studied. Palladin plays important roles in the regulation of diverse actin-related signaling in a number of cell types. Since intact actin-cytoskeletal remodeling is necessary for myogenesis, in the present study, we pursue to investigate the role of actin-associated palladin in skeletal muscle differentiation. Palladin in C2C12 myoblasts is knocked-down using specific small interfering RNA (siRNA). The results show that down-regulation of palladin decreased migratory activity of mouse skeletal muscle C2C12 myoblasts. Furthermore, the depletion of palladin enhances C2C12 vitality and proliferation. Of note, the loss of palladin promotes C2C12 to express the myosin heavy chain, suggesting that palladin has a role in the modulation of C2C12 differentiation. It is thus proposed that palladin is required for normal C2C12 myogenesis in vitro
Ma, Yiming; Fu, Shaoting; Lu, Lin; Wang, Xiaohui
2017-07-15
To detect the effects of androgen receptor (AR) on cyclic mechanical stretch-modulated proliferation of C2C12 myoblasts and its pathways: roles of IGF-1, PI3K and MAPK. C2C12 were randomly divided into five groups: un-stretched control, six or 8 h of fifteen percent stretch, and six or 8 h of twenty percent stretch. Cyclic mechanical stretch of C2C12 were completed using a computer-controlled FlexCell Strain Unit. Cell proliferation and IGF-1 concentration in medium were detected by CCK8 and ELISA, respectively. Expressions of AR and IGF-1R, and expressions and activities of PI3K, p38 and ERK1/2 in stretched C2C12 cells were determined by Western blot. ①The proliferation of C2C12 cells, IGF-1 concentration in medium, expressions of AR and IGF-1R, and activities of PI3K, p38 and ERK1/2 were increased by 6 h of fifteen percent stretch, while decreased by twenty percent stretch for six or 8 h ②The fifteen percent stretch-increased proliferation of C2C12 cells was reversed by AR inhibitor, Flutamide. ③The increases of AR expression, activities of PI3K, p38 and ERK1/2 resulted from fifteen percent stretch were attenuated by IGF-1 neutralizing antibody, while twenty percent stretch-induced decreases of the above indicators were enhanced by recombinant IGF-1. ④Specific inhibitors of p38, ERK1/2 and PI3K all decreased the expression of AR in fifteen percent and twenty percent of stretched C2C12 cells. Cyclic mechanical stretch modulated the proliferation of C2C12 cells, which may be attributed to the alterations of AR via IGF-1-PI3K/Akt and IGF-1-MAPK (p38, ERK1/2) pathways in C2C12 cells. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Ramadan, S.; Metawei, Z.
1995-01-01
The values of the opacities for 12 C- 12 C reaction are calculated at different incident ion kinetic energy. The exact multiple scattering series for the scattering of two heavy ions which was derived by wilson is used to calculate the abrasion and absorption cross sections of 16 O- 9 Be and 16 O- 16 O collisions, considering a harmonic oscillator matter density for both target and projectiles as spherical nuclei. The effect of including the pauli correlation is considered. The case of deformed target is also investigated. Our results are compared with other calculations as well as with the experimental results
Experimental study on enriching 12C by centrifuge method
International Nuclear Information System (INIS)
Xiao Huaxian
1994-07-01
The diamond made from the highly enriched 12 C, whose thermal conductivity and electric insulativity are much better than that of natural diamond, has widely uses in new and high technology. In many enriching 12 C methods, the gas centrifuge method is superior to others. After selecting the appropriate process gas and solving key problems, such as feed and extract, the separation experiments are performed by a single stage of centrifuge. To increase the separation capacity of single machine, various parameters in the centrifugal separation are optimized, and appropriate mechanical drive, thermal drive, hold-up and process parameters are selected. The optimal operating condition of single machine is also obtained in the cascade. Thus, highly enriched 12 C is produced in the centrifuge cascade
Measurement of charged pions in {sup 12}C+{sup 12}C collisions at 1A GeV and 2A GeV with HADES
Energy Technology Data Exchange (ETDEWEB)
Agakishiev, G.; Destefanis, M.; Gilardi, C.; Kirschner, D.; Kuehn, W.; Lange, J.S.; Metag, V.; Novotny, R.; Pechenov, V.; Pechenova, O.; Perez Cavalcanti, T.; Spataro, S.; Spruck, B. [Justus Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); Agodi, C.; Coniglione, R.; Finocchiaro, P.; Maiolino, C.; Piattelli, P.; Sapienza, P. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Balanda, A.; Kozuch, A.; Przygoda, W. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Panstwowa Wyzsza Szkola Zawodowa, Nowy Sacz (Poland); Bellia, G. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Universita di Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); Belver, D.; Cabanelas, P.; Duran, I.; Garzon, J.A.; Lamas-Valverde, J.; Marin, J. [University of Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Zanevsky, Y. [Joint Institute of Nuclear Research, Dubna (Russian Federation); Bielcik, J.; Braun-Munzinger, P.; Galatyuk, T.; Gonzalez-Diaz, D.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Muench, M.; Palka, M.; Pietraszko, J.; Rustamov, A.; Schroeder, C.; Schwab, E.; Simon, R.S.; Traxler, M.; Yurevich, S.; Zumbruch, P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Blanco, A.; Lopes, L.; Mangiarotti, A. [LIP-Laboratorio de Instrumentacao e Fisica Experimental de Particulas, Coimbra (Portugal); Bortolotti, A.; Michalska, B. [Sezione di Milano, Istituto Nazionale di Fisica Nucleare, Milano (Italy); Boyard, J.L.; Hennino, T.; Moriniere, E.; Ramstein, B.; Roy-Stephan, M.; Sudol, M. [CNRS/IN2P3 - Universite Paris Sud, Institut de Physique Nucleaire, Orsay Cedex (France); Christ, T.; Eberl, T.; Fabbietti, L.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R. [and others
2009-04-15
We present the results of a study of charged-pion production in {sup 12}C+{sup 12}C collisions at incident beam energies of 1A GeV and 2A GeV using the HADES spectrometer at GSI. The main emphasis of the HADES program is on the dielectron signal from the early phase of the collision. Here, however, we discuss the data with respect to the emission of charged hadrons, specifically the production of {pi}{sup {+-}} mesons, which are related to neutral pions representing a dominant contribution to the dielectron yield. We have performed the first large-angular-range measurement of the distribution of {pi}{sup {+-}} mesons for the {sup 12}C+{sup 12}C collision system covering a fairly large rapidity interval. The pion yields, transverse-mass and angular distributions are compared with calculations done within a transport model, as well as with existing data from other experiments. The anisotropy of pion production is systematically analyzed. (orig.)
K-theory for group C*-algebras and semigroup C*-algebras
Cuntz, Joachim; Li, Xin; Yu, Guoliang
2017-01-01
This book gives an account of the necessary background for group algebras and crossed products for actions of a group or a semigroup on a space and reports on some very recently developed techniques with applications to particular examples. Much of the material is available here for the first time in book form. The topics discussed are among the most classical and intensely studied C*-algebras. They are important for applications in fields as diverse as the theory of unitary group representations, index theory, the topology of manifolds or ergodic theory of group actions.
The C-12/C-13 abundance ratio in Comet Halley
International Nuclear Information System (INIS)
Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.
1989-01-01
The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs
International Nuclear Information System (INIS)
Hagarman, Andrew; Schweitzer-Stenner, Reinhard; Wallace, Carmichael; Laberge, Monique
2008-01-01
We measured the low-frequency polarized resonance Raman spectra of horse heart, chicken, and yeast(C102T) ferrocytochromes c with Soret excitation. We examined the out-of-plane deformations of the heme groups by determining the relative intensities and depolarization ratios of a variety of out-of-plane and in-plane Raman active bands. Analysis of relative Raman intensities shows differences in non-planarity of the heme groups of yeast(C102T), horse heart and chicken cytochrome c. Cytochrome c has been shown to have a dominant ruffling (B 1u ) deformation by means of normal coordinate structural decomposition (NSD) analysis of the heme group in crystal structures. The presence and intensity of B 1u modes, γ 10 -γ 12 , support the indication of ruffling being the major contribution to the non-planar deformations in cytochrome c. Other types of non-planar deformations like doming (A 2U ) and waving (E g ) can be deduced from the Raman activity of γ 5 (A 2u ), γ 21 and γ 22 (E g ). The depolarization ratios of γ 5 , γ 10 , γ 11 and γ 12 are larger than 0.125, indicating the presence of other deformations such as saddling (B 2u ) and propellering (A 1u ), which is again in agreement with the crystal structures of horse heart and yeast ferrocytochrome c. An analysis of the intensities and depolarization ratios of out-of-plane modes revealed that ruffling is comparable in yeast and horse heart cytochrome c, saddling is larger and doming as well as propellering are lower in yeast cytochrome c. With respect to doming and ruffling our results contradict values obtained from the NSD analysis of the corresponding crystal structures. With respect to saddling, our data are in agreement with the crystal structure. The NSD analysis of heme structures resulting from MD simulations did not correlate very well with the spectroscopically obtained results concerning the ruffling and doming coordinate, whereas a qualitative agreement was again obtained for saddling.
Quasi-free K+ photo-production in 12C
International Nuclear Information System (INIS)
Maeda, K.; Yamazaki, H.; Asano, S.; Emura, T.; Endo, I.; Endo, S.; Ito, S.; Itoh, H.; Ifuku, K.; Konno, O.; Koike, M.; Maruyama, K.; Niki, K.; Niwa, K.; Okuno, H.; Sakaguchi, A.; Sasaki, T.; Suda, T.; Sumi, Y.; Takeya, M.; Terasawa, T.; Uchida, H.; Yamashita, H.; Yoshida, K.
1994-01-01
Quasi-free K + photo-production in the 12 C(γ,K + ) reaction has been investigated in a photon energy range of 0.7-1.1GeV. Differential cross sections for the quasi-free process of the 12 C(γ,K + ) reaction have been obtained and they are compared with a calculation of a quasi-free K + photo-production. The effective proton number Z eff =4.2±0.6 obtained from the experiment was in good agreement with a calculation of a semi-classical attenuation model. ((orig.))
International Nuclear Information System (INIS)
Roche, G.; Koontz, R.; Mulera, T.; Pugh, H.G.; Schroeder, L.S.; Hallman, T.; Madansky, L.; Carroll, J.; Chang, C.C.; Kirk, P.N.; Krebs, G.; Vicente, J.
1985-01-01
A particle-gamma coincidence experiment has been performed with a 2.1 GeV per nucleon 12 C beam from the Bevalac. Data were taken with C and Pb targets. The γ-ray spectra are almost independent of the energy or the kind of charged particles detected in coincidence, mainly protons and deuterons. These γ-ray spectra are interpreted as resulting from π 0 decay, and are consistent with known π 0 production rates. A search for a possible decay of singly-charged anomalons into a gamma and a deuteron (or unbound proton-neutron system) has been done by studying the γp and γd invariant mass distributions. The upper limits for such a process are found to be 2 to 20% of the deuteron production rate, for anomalon masses for 200 to 400 MeV above the deuteron mass, with an anomalon mean lifetime of up to 10 -9 s, depending on which kind of decay process is considered. (orig.)
Veronese, Guido; Pepe, Alessandro
2015-06-18
The present study aims to test whether sense of coherence (SOC) acts as a determinant of positive psychological functioning in aid workers directly exposed to warfare. Specifically, we performed multiple regression analyses to compare different groups of aid workers in terms of the effects of SOC and cumulative trauma on their psychological distress. Palestinian helpers, both professional and non-professional (N = 159) completed three self-reported measures: the General Health questionnaire, Sense of Coherence Scale, and Impact of Events Scale. The findings bear out the predictive power of SOC and posttraumatic stress disorder (PTSD) in relation to mental health across different professional groups. In particular, volunteers without a specific professional profile, psychiatrists, medical doctors, and less markedly counselors seemed to protect their mental health through a SOC. Clinical implications and recommendations for training and supervision are discussed. © The Author(s) 2015.
Directory of Open Access Journals (Sweden)
Renan Renato Cruz dos Santos
2014-09-01
Full Text Available Football is characterized as a predominately aerobic modality, however, during a match; the most important actions performed by the players are in short duration and high intensity. In addition, this sport presents to have some particularities, such as, highlights differences of each tactical position. Thus, this study aimed to compare the anaerobic power of professional football players grouped by different tactical positions. Thirty professional football players separated in three groups, goal¬keep¬ers+fullbacks, sideways+DMF (defensive middlefields and OMF (offensive middlefields+forwards, performed two anaerobic po¬wer tests, Running anaerobic sprint test and Sargent jump test Goalkeepers+fullbacks showed higher values of body mass index and absolute anaerobic power (w, using Sargent jump test than the others, but when analyzed the RAST results, this same group presented lower values (p<0.05 of relative AP (w∙kg-1. OMF+forwards showed to have the best Pmed and Pmax values (p<0.05, when compared with defensive players. These results suggest the use of running anaerobic sprint test and sargent jump test toge¬ther when is proposed to measure the anaerobic power of football players, and also a anthropometric evaluation, so the training can be more specific e efficient to each tactical position and athlete.
Sub-coulombian fusion of 12 C + 12 C measured with the γ rays improved technique
International Nuclear Information System (INIS)
Rosales M, P.
2005-01-01
In this work we report the measurements carried out in the National Institute of Nuclear Research of Mexico (ININ) for the absolute section of fusion of the system 12 C + 12 C in an interval of energy of E c.m. 4.5-6.5 MeV with fine steps of 75 keV. The objective of measuring in fine steps is to register all the existent resonances. To be able to obtain an absolute normalization of the cross section, it was applied a method that allows to measure simultaneously the one number of projectiles that arrive to the target, as well as the numbers of nuclei in the target, even when this doesn't stay constant. In the chapter 2 the experimental procedure it is described, it is carried out with detail the analysis of the data and the results are shown. Later on the chapter 3 it is described with detail the method used for the absolute normalization, that is to say the form of obtaining the quantities N p and η T of the equation is explained and the obtained results are presented. Additionally in the chapter 4 it was carried out a theoretical analysis applying models as that of barrier penetration and the optical model combined with the Breit-Wigner theory with the purpose of being able to reproduce the resonances of the excitation function. In the chapter 5 the concept of S-Astrophysicist factor it is introduced and this value is calculated for our data. Finally in the chapter 6 the conclusions of this work are presented. (Author)
C-MORE Professional Development Training Program for Graduate Students and Post-Docs
Bruno, B. C.; DeLeo, F.; Bottjer, D.; Jungbluth, S.; Burkhardt, B.; Hawco, N.; Boiteau, R.
2012-12-01
The Center for Microbial Oceanography: Research and Education (C-MORE) is a National Science Foundation-sponsored Science and Technology Center. C-MORE comprises six partner institutions: University of Hawaii (headquarters), Massachusetts Institute of Technology, Woods Hole Oceanographic Institution, Oregon State University, University of California at Santa Cruz and Monterey Bay Aquarium Research Institute. C-MORE's Professional Development Training Program is aimed at equipping graduate students and post-docs at all six institutions with the skills and experiences needed to maximize their potential and succeed in their professional careers. This program is administered through the C-MORE Education Office and was developed in close collaboration with graduate students, post-docs, and faculty. This program has formal but flexible requirements. There is only one required module (Outreach). The seven optional modules include: Science Communication, Leadership, Mentoring, Teaching, Research Exchange, Diversity and Proposal Writing. Masters students choose three optional modules; Ph.D. students and post-docs choose five. Most modules consist of a training component, followed by a practical component. All participants will are expected to complete program evaluations. Below are some examples of program offerings: Science Communication Module In partnership with the Communication Partnership for Science and the Sea, C-MORE organized three Science Communication workshops at the University of Hawaii, Monterey Bay Aquarium Research Institute and Massachusetts Institute of Technology. These workshops train participants to distill their research into language that is free of jargon and accessible to a general audience. After the training, participants are asked to produce a communication product based on their research, such as a magazine article, press release, podcast or a blog. Diversity Module To date, C-MORE has organized three teleconferences on diversity, attended by
Krzowski, Bartosz; Płatek, Anna E; Szymański, Filip M; Ryś, Anna; Semczuk-Kaczmarek, Karolina; Adamkiewicz, Karolina; Kotkowski, Marcin; Filipiak, Krzysztof J
2018-01-01
Professional drivers are a group exposed to many cardiovascular risk factors. Non-systematic working hours, prolonged stress, low physical activity, along with irregular, and in most cases, unhealthy meals are common aspects of the normal working schedule of most of the professional drivers. These translate into high risk of cardiovascular disease (CVD). The aim of the current analysis was to establish the prevalence of dyslipidaemia in a group of continuous professional drivers. The RACER (Risk of Adverse Cardiovascular Events among professional dRivers in Poland - Ambulatory Blood Pressure Monitoring) study is a prospective study focused on assessing cardiovascular risk factors in professional drivers. Patients included in the study were screened for classical and non-classical cardiovascular risk factors and had an ambulatory blood pressure monitoring (ABPM) performed. Out of the whole RACER study population, 144 drivers were included into the RACER-ABPM study. Out of this group 135 (95.7%) were male, and the mean age was 50.2 ± 9.3 years, and mean body mass index was 32.3 ± 3.0 kg/m². A family history of CVD was noted in 21.3% of patients, 28.1% were current smokers, and 2.9% had diabetes mellitus. Out of those patients, 72.2% had low-density lipoprotein cholesterol (LDL-C) level > 115 mg/dL, 85.5% had LDL-C > 100 mg/dL, and 96.7% had LDL-C > 70 mg/dL. High-density lipoprotein cholesterol 150 mg/dL were found in 28.9% of cases. In conclusion, dyslipidaemia is highly prevalent in professional drivers. Obesity is one of the major contributors to the cardiovascular risk, and dyslipidaemia along with other risk factors highly prevalent in this subgroup accounts for poorer prognosis.
International Nuclear Information System (INIS)
Martini, V. P.; Glogauer, A.; Iulek, J.; Souza, E. M.; Pedrosa, F. O.; Krieger, N.
2012-01-01
The preliminary X-ray analysis of LipC12, the first lipase isolated through a metagenomics approach to be crystallized, is reported. LipC12, a true lipase from family I.1 of bacterial lipases which was previously isolated through a metagenomics approach, contains 293 amino acids. Among lipases of known three-dimensional structure, it has a sequence identity of 47% to the lipase from Pseudomonas aeruginosa PAO1. Recombinant N-terminally His 6 -tagged LipC12 protein was expressed in Escherichia coli, purified in a homogenous form and crystallized in several conditions, with the best crystals being obtained using 2.0 M sodium formate and 0.1 M bis-tris propane pH 7.0. X-ray diffraction data were collected to 2.70 Å resolution. The crystals belonged to the tetragonal space group P4 1 22, with unit-cell parameters a = b = 58.62, c = 192.60 Å
Rahmat, M.; Modarres, M.
2018-03-01
The averaged effective two-body interaction (AEI), which can be generated through the lowest order constrained variational (LOCV) method for symmetric nuclear matter (SNM) with the input [Reid68, Ann. Phys. 50, 411 (1968), 10.1016/0003-4916(68)90126-7] nucleon-nucleon potential, is used as the effective nucleon-nucleon potential in the folding model to describe the heavy-ion (HI) elastic scattering cross sections. The elastic scattering cross sections of 12C-12C and 16O-16O systems are calculated in the above framework. The results are compared with the corresponding calculations coming from the fitting procedures with the input finite range D D M 3 Y 1 -Reid potential and the available experimental data at different incident energies. It is shown that a reasonable description of the elastic 12C-12C and 16O-16O scattering data at the low and medium energies can be obtained by using the above LOCV AEI, without any need to define a parametrized density-dependent function in the effective nucleon-nucleon potential, which is formally considered in the typical D D M 3 Y 1 -Reid interactions.
Non-observation of 12C cluster decay of 114Ba
International Nuclear Information System (INIS)
Guglielmetti, A.; Bonetti, R.; Poli, G.; Collatz, R.; Hu, Z.; Kirchner, R.; Roeckl, E.; Gunn, N.; Price, P.B.; Weaver, B.A.; Westphal, A.; California Univ., Berkeley, CA; Szerypo, J.
1997-10-01
By means of the on-line mass separator at Gesellschaft fuer Schwerionenforschung, Darmstadt, we produced 114 Ba through the 58 Ni( 58 Ni,2n) reaction, separated it as a 114 Ba 19 F + beam, and implanted it into a stopper foil positioned in the center of an array of track detectors, which were used to search for 12 C radioactivity of 114 Ba. A total number of (5.4±1.7).10 4 114 Ba atoms were implanted. No 12 C event was found after a total exposure time of 116 hours, corresponding to a 58 Ni beam dose of 1.3.10 17 . The resulting upper limit of 3.4.10 -5 (84% c. 1.) for the branching ratio for 12 C decay of 114 Ba is considerably lower than the limits obtained in previous experiments, which represents an inconsistency at levels of more than 90%. A semiempirical estimate of 19.3 MeV for the upper limit of the Q-value for 12 C decay of 114 Ba is derived. (orig.)
Reaction 12C(16O,α)24Mg leading to nuclear molecular resonances
International Nuclear Information System (INIS)
Nagatani, K.; Shimoda, T.; Tanner, D.; Tribble, R.; Yamaya, T.
1979-01-01
The reactions 12 C( 16 O,α) 24 Mg and 13 C( 16 O,α) 25 Mg were investigated at an incident energy of 145 MeV. In the reaction with the 12 C target, broad peaks are observed at forward angles which correspond to the molecular resonance states of the 12 C+ 12 C system, while the spectra with 13 C target show only a smooth continuum
First intron of nestin gene regulates its expression during C2C12 myoblast ifferentiation
Institute of Scientific and Technical Information of China (English)
Hua Zhong; Zhigang Jin; Yongfeng Chen; Ting Zhang; Wei Bian; Xing Cui; Naihe Jing
2008-01-01
Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031, China Nestin is an intermediate filament protein expressed in neural progenitor cells and in developing skeletal muscle. Nestin has been widely used as a neural progenitor cell marker. It is well established that the specific expression of the nestin gene in neural progenitor cells is conferred by the neural-specific enhancer located in the second intron of the nestin gene. However, the transcriptional mechanism of nestin expression in developing muscle is still unclear. In this study, we identified a muscle cell-specific enhancer in the first intron of mouse nestin gene in mouse myoblast C2C12 cells.We localized the core enhancer activity to the 291-661 region of the first intron, and showed that the two E-boxes in the core enhancer region were important for enhancer activity in differentiating C2C12 cells. We also showed that MyoD protein was involved in the regulation of nestin expression in the myogenic differentiation of C2C12 cells.
Directory of Open Access Journals (Sweden)
Yaqiong Zhang
2018-02-01
Full Text Available The data presented here are related to the research article entitled “Synthesis and characterization of alkylated caseinate, and its structure-curcumin loading property relationship in water” (Zhang et al., 2018 [1]. This data article reports the detailed spectra information for 1H NMR, 13C NMR and UPLC-Q-TOF MS of the N-succinimidyl fatty acid esters with various alkyl chain lengths (Cn-NHSs, n = 8, 12, 14 and 16. 1H NMR, 13C NMR and UPLC-Q-TOF MS spectra for C16-NHS are shown as an example. Then the stacked 1H NMR spectra of the obtained alkylated caseinates (Cn-caseinates, n = 8, 12, 14 and 16 are provided. The surface hydrophobicity index (S0 of Cn-caseinates with different substitution degrees (SD of alkyl groups is shown. Additionally, Visual appearances for the formed aqueous dispersions of curcumin-loaded native caseinate (NaCas and Cn-caseinates self-assemblies are shown. X-ray diffraction patterns of curcumin, C16-caseinate, its physical mixture and curcumin-loaded C16-caseinate self-assemblies are examined. The re-dispersibility and short-term storage stability of the curcumin-loaded NaCas and C16-caseinate self-assemblies are also studied. Keywords: Caseinate, Alkylated caseinate, Self-assembly, Curcumin-loading property
THE GALACTIC R CORONAE BOREALIS STARS: THE C2 SWAN BANDS, THE CARBON PROBLEM, AND THE 12C/13C RATIO
International Nuclear Information System (INIS)
Hema, B. P.; Pandey, Gajendra; Lambert, David L.
2012-01-01
Observed spectra of R Coronae Borealis (RCB) and hydrogen-deficient carbon (HdC) stars are analyzed by synthesizing the C 2 Swan bands (1, 0), (0, 0), and (0, 1) using our detailed line list and the Uppsala model atmospheres. The (0, 1) and (0, 0) C 2 bands are used to derive the 12 C abundance, and the (1, 0) 12 C 13 C band to determine the 12 C/ 13 C ratios. The carbon abundance derived from the C 2 Swan bands is about the same for the adopted models constructed with different carbon abundances over the range 8.5 (C/He = 0.1%) to 10.5 (C/He = 10%). Carbon abundances derived from C I lines are about a factor of four lower than the carbon abundance of the adopted model atmosphere over the same C/He interval, as reported by Asplund et al., who dubbed the mismatch between adopted and derived C abundance as the 'carbon problem'. In principle, the carbon abundances obtained from C 2 Swan bands and that assumed for the model atmosphere can be equated for a particular choice of C/He that varies from star to star. Then, the carbon problem for C 2 bands is eliminated. However, such C/He ratios are in general less than those of the extreme helium stars, the seemingly natural relatives to the RCB and HdC stars. A more likely solution to the C 2 carbon problem may lie in a modification of the model atmosphere's temperature structure. The derived carbon abundances and the 12 C/ 13 C ratios are discussed in light of the double degenerate and the final flash scenarios.
Directory of Open Access Journals (Sweden)
Enard, Thierry
1996-04-01
Full Text Available Trans polyunsaturated fatty acids are produced in vegetable oils during heat treatment (240-250 °C.ln order to study the metabolic pathway of 9c, 12t and 9t, 12c linoleic acid and 9c, 12c, 15t and 9t, 12c, 15c linolenic acid, these products were prepared labelled with carbon 14 in the carboxylic position. 5c, 8c, 11c, 14t-Arachidonic acid was also labelled on the carboxylic position with carbon 14 in order to study its physiological effects. To introduce the labelling (E-bromo precursors with a 17 carbons chain or a 19 carbon chain were needed. The different syntheses were done by elongation steps and creation of cis double bonds via highly stereospecific Wittig reactions. The radioactive carbon atom was introduced from [14C]-potassium cyanide. The final radioactive fatty acids had a specific activity greater than 50 mCi/mmol and a radioactive purity better than 99 % for linoleic and linolenic and better than 98.6 % for arachidonic acid.
Differential cross sections for neutrino scattering on 12C
International Nuclear Information System (INIS)
Kolbe, E.
1996-01-01
Differential cross sections for neutrino scattering on 12 C are calculated within the (continuum) random phase approximation model. The charged current (ν e ,e - ) and (ν μ ,μ - ) capture reactions on 12 C are measured by the LSND Collaboration at LAMPF. We investigate and discuss the merits of such studies, especially the information that can be extracted from data for differential neutrino scattering cross sections. copyright 1996 The American Physical Society
Elimination of the 12 C and 16 O in the elastic scattering of 14 C by polarized protons
International Nuclear Information System (INIS)
Avila A, O.L.; Ramirez T, J.J.; Murillo O, G.; Fernandez B, M.
1991-04-01
The study of the elastic scattering of 14 C for polarized protons it provides information on the nuclear structure of 15 N. In the Tandem accelerator of the Nuclear Center in collaboration with the University of Notre Dame is carrying out this study to energy between 5.0 and 9.0 MeV in steps of 10 keV. The measures of differential section and vectorial analyzer power are subjected to shift analysis of phase being able to determine the parameters of the excited levels of 15 N that are it angular momentum, parity, level width and elastic width. The details of this experiment are presented in the ACEL-9102 technical report while in this work it was discussed the way in that contributions of 12 C and 16 O are eliminated that are present as impurities in our target of 14 C. At small angles the elastic components of these impurities are shoveled with the elastic of 14 C. In the experiment carried out in the Nuclear Center were take measures of differential section for 6 angles; 35, 45, 55, 65, 145 and 165 using surface barrier detectors. It is observed that it exists shovels at 35, 45, 55 and 65 while at 145 and 165 the 12 C, the 14 C and the 16 O are totally separate. With the purpose of being able to subtract of the elastic of 14 C the proportion of 12 C, it was decided to bombard a target of 12 C leaving the same geometry that had been used to bombard 14 C. With this also carried out the reaction 12 C (p,p) 12 C between 5.0 and 9.0 MeV in steps of 50 keV. Starting from these spectra are the integration (yield) of the elastic of 12 C. (Author)
Directory of Open Access Journals (Sweden)
Backman Catherine L
2010-05-01
Full Text Available Abstract Background There is worldwide variation in rehabilitation practices after total hip arthroplasty (THA and total knee arthroplasty (TKA and no agreement on which interventions will lead to optimal short and long term patient outcomes. As a first step in the development of clinical practice guidelines for post-acute rehabilitation after THA and TKA, we explored experiences and attitudes about rehabilitation practices and outcomes in groups of individuals identified as key stakeholders. Methods Separate focus groups and interviews were conducted with patients (THA or TKA within past year and three health professional groups: allied health professionals (AHPs, orthopaedic surgeons, and other physicians, in Canada and the United States. Pairs of moderators led the focus groups using a standardized discussion guide. Discussions were audiotaped and transcribed verbatim. A content analysis within and across groups identified key themes. Results Eleven focus groups and eight interviews took place in six sites. Patients (n = 32 varied in age, stage of recovery, and surgical and rehabilitation experiences. Health professionals (n = 44 represented a range of disciplines, practice settings and years of experience. Six key themes emerged: 1 Let's talk (issues related to patient-health professional and inter-professional communication; 2 Expecting the unexpected (observations about unanticipated recovery experiences; 3 It's attitude that counts (the importance of the patient's positive attitude and participation in recovery; 4 It takes all kinds of support (along the continuum of care; 5 Barriers to recovery (at patient, provider and system levels, and 6 Back to normal (reflecting diversity of expected outcomes. Patients offered different, but overlapping views compared to health professionals regarding rehabilitation practices and outcomes following THA and TKA. Conclusion Results will inform subsequent phases of guideline development and ensure
Pion production in 12C-nucleus interactions at 86 MeV/nucleon
International Nuclear Information System (INIS)
Chiavassa, E.; Costa, S.; Dellacasa, G.; De Marco, N.; Gallio, M.; Musso, A.; Aslanides, E.; Fassnacht, P.; Hibou, F.; Bressani, T.; Caria, M.; Serci, S.; Cagliari Univ.; Iazzi, F.; Minetti, B.; Politecnico di Torino
1984-01-01
Inclusive π - spectra due to the ( 12 C, πX) reaction were measured at 0 0 using 12 C ions of 1032 MeV and 6 Li, 12 C, 27 Al, Cd and Pb targets. π + measurements were carried out using a 12 C target. The cross sections show a saturation effect as a function of the target mass. The present results are compared to theoretical predictions of the hard-scattering model and of the statistical model and analysed following the quasi-two-body scaling hypothesis. (orig.)
Mou, Yan; Luo, Haiyu; Mao, Ziling; Shan, Tijiang; Sun, Weibo; Zhou, Kaiyi; Zhou, Ligang
2013-01-07
The influences of eight metal ions (i.e., Na+, Ca2+, Ag+, Co2+, Cu2+, Al3+, Zn2+, and Mn4+) on mycelia growth and palmarumycins C(12) and C(13) production in liquid culture of the endophytic fungus Berkleasmium sp. Dzf12 were investigated. Three metal ions, Ca2+, Cu2+ and Al3+ were exhibited as the most effective to enhance mycelia growth and palmarumycin production. When calcium ion (Ca2+) was applied to the medium at 10.0 mmol/L on day 3, copper ion (Cu2+) to the medium at 1.0 mmol/L on day 3, aluminum ion (Al3+) to the medium at 2.0 mmol/L on day 6, the maximal yields of palmarumycins C(12) plus C(13) were obtained as 137.57 mg/L, 146.28 mg/L and 156.77 mg/L, which were 3.94-fold, 4.19-fold and 4.49-fold in comparison with that (34.91 mg/L) of the control, respectively. Al3+ favored palmarumycin C(12) production when its concentration was higher than 4 mmol/L. Ca2+ had an improving effect on mycelia growth of Berkleasmium sp. Dzf12. The combination effects of Ca2+, Cu2+ and Al3+ on palmarumycin C(13) production were further studied by employing a statistical method based on the central composite design (CCD) and response surface methodology (RSM). By solving the quadratic regression equation between palmarumycin C(13) and three metal ions, the optimal concentrations of Ca2+, Cu2+ and Al3+ in medium for palmarumycin C(13) production were determined as 7.58, 1.36 and 2.05 mmol/L, respectively. Under the optimum conditions, the predicted maximum palmarumycin C(13) yield reached 208.49 mg/L. By optimizing the combination of Ca2+, Cu2+ and Al3+ in medium, palmarumycin C(13) yield was increased to 203.85 mg/L, which was 6.00-fold in comparison with that (33.98 mg/L) in the original basal medium. The results indicate that appropriate metal ions (i.e., Ca2+, Cu2+ and Al3+) could enhance palmarumycin production. Application of the metal ions should be an effective strategy for palmarumycin production in liquid culture of the endophytic fungus Berkleasmium sp. Dzf12.
Directory of Open Access Journals (Sweden)
Botek Michal
2016-12-01
Full Text Available This cross-sectional study compared somatic, endurance performance determinants and heart rate variability (HRV profiles of professional soccer players divided into different age groups: GI (17–19.9 years; n = 23, GII (20–24.9 years; n = 45, GIII (25–29.9 years; n = 30, and GIV (30–39 years; n = 26. Players underwent somatic and HRV assessment and maximal exercise testing. HRV was analyzed by spectral analysis of HRV, and high (HF and low (LF frequency power was transformed by a natural logarithm (Ln. Players in GIV (83 ± 7 kg were heavier (p 25 years showed negligible differences in Pmax unlike the age group differences demonstrated in VO2max. A shift towards relative sympathetic dominance, particularly due to reduced vagal activity, was apparent after approximately 8 years of competing at the professional level.
Wild, Verina; Carina, Fourie; Frouzakis, Regula; Clarinval, Caroline; Fässler, Margrit; Elger, Bernice; Gächter, Thomas; Leu, Agnes; Spirig, Rebecca; Kleinknecht, Michael; Radovanovic, Dragana; Mouton Dorey, Corine; Burnand, Bernard; Vader, John-Paul; Januel, Jean-Marie; Biller-Andorno, Nikola; The IDoC Group
2015-01-01
The starting point of the interdisciplinary project "Assessing the impact of diagnosis related groups (DRGs) on patient care and professional practice" (IDoC) was the lack of a systematic ethical assessment for the introduction of cost containment measures in healthcare. Our aim was to contribute to the methodological and empirical basis of such an assessment. Five sub-groups conducted separate but related research within the fields of biomedical ethics, law, nursing sciences and health services, applying a number of complementary methodological approaches. The individual research projects were framed within an overall ethical matrix. Workshops and bilateral meetings were held to identify and elaborate joint research themes. Four common, ethically relevant themes emerged in the results of the studies across sub-groups: (1.) the quality and safety of patient care, (2.) the state of professional practice of physicians and nurses, (3.) changes in incentives structure, (4.) vulnerable groups and access to healthcare services. Furthermore, much-needed data for future comparative research has been collected and some early insights into the potential impact of DRGs are outlined. Based on the joint results we developed preliminary recommendations related to conceptual analysis, methodological refinement, monitoring and implementation.
Lin, Shu-Ling; Huang, Ching-Ya; Shiu, Shau-Ping; Yeh, Shu-Hui
2015-08-01
Mental health professionals experiencing work-related stress may experience burn out, leading to a negative impact on their organization and patients. The aim of this study was to examine the effects of yoga classes on work-related stress, stress adaptation, and autonomic nerve activity among mental health professionals. A randomized controlled trial was used, which compared the outcomes between the experimental (e.g., yoga program) and the control groups (e.g., no yoga exercise) for 12 weeks. Work-related stress and stress adaptation were assessed before and after the program. Heart rate variability (HRV) was measured at baseline, midpoint through the weekly yoga classes (6 weeks), and postintervention (after 12 weeks of yoga classes). The results showed that the mental health professionals in the yoga group experienced a significant reduction in work-related stress (t = -6.225, p control group revealed no significant changes. Comparing the mean differences in pre- and posttest scores between yoga and control groups, we found the yoga group significantly decreased work-related stress (t = -3.216, p = .002), but there was no significant change in stress adaptation (p = .084). While controlling for the pretest scores of work-related stress, participants in yoga, but not the control group, revealed a significant increase in autonomic nerve activity at midpoint (6 weeks) test (t = -2.799, p = .007), and at posttest (12 weeks; t = -2.099, p = .040). Because mental health professionals experienced a reduction in work-related stress and an increase in autonomic nerve activity in a weekly yoga program for 12 weeks, clinicians, administrators, and educators should offer yoga classes as a strategy to help health professionals reduce their work-related stress and balance autonomic nerve activities. © 2015 The Authors. Worldviews on Evidence-Based Nursing published by Wiley Periodicals, Inc. on behalf of Society for Worldviews on Evidence-Based Nursing.
Structure of 12C and the triple-α process
DEFF Research Database (Denmark)
Fynbo, H.O.U.; Diget, C.Aa.
2014-01-01
We review experiments at IGISOL and associated work at ISOLDE and KVI on the use of the β-decays of 12N and 12B for the study of the structure of 12C and the consequences for the rate of the triple-α reaction in stars.......We review experiments at IGISOL and associated work at ISOLDE and KVI on the use of the β-decays of 12N and 12B for the study of the structure of 12C and the consequences for the rate of the triple-α reaction in stars....
Energy Technology Data Exchange (ETDEWEB)
Rosales M, P
2005-07-01
In this work we report the measurements carried out in the National Institute of Nuclear Research of Mexico (ININ) for the absolute section of fusion of the system {sup 12} C + {sup 12} C in an interval of energy of E{sub c.m.} 4.5-6.5 MeV with fine steps of 75 keV. The objective of measuring in fine steps is to register all the existent resonances. To be able to obtain an absolute normalization of the cross section, it was applied a method that allows to measure simultaneously the one number of projectiles that arrive to the target, as well as the numbers of nuclei in the target, even when this doesn't stay constant. In the chapter 2 the experimental procedure it is described, it is carried out with detail the analysis of the data and the results are shown. Later on the chapter 3 it is described with detail the method used for the absolute normalization, that is to say the form of obtaining the quantities N{sub p} and {eta}{sub T} of the equation is explained and the obtained results are presented. Additionally in the chapter 4 it was carried out a theoretical analysis applying models as that of barrier penetration and the optical model combined with the Breit-Wigner theory with the purpose of being able to reproduce the resonances of the excitation function. In the chapter 5 the concept of S-Astrophysicist factor it is introduced and this value is calculated for our data. Finally in the chapter 6 the conclusions of this work are presented. (Author)
International Nuclear Information System (INIS)
Baktibayev, M.K.; Burminskii, V.P.; Burtebaev, N.; Dzazairov -Kakhramanov, V.; Hassan, S.F.; Satpaev, N.K.; Zazulin, D.M.
2004-01-01
Full text: The fulfillment of planned works on measurements of differential cross sections of elastic scattering of protons on nuclear 12 C at the energy region of 350†1050 keV suggests the preparation of thin self - supporting carbon target. The self - supporting target is necessary in order to perform investigations in the total angular range. In the future last data will be used in order to determine optical potentials and scattering phases for this nuclear in the energy range of astrophysical interest. There was prepared target layer of the 12 C with natural composition of carbon and of thickness of 17.4 μg/cm 2 . The spraying was conducted in the vacuum evaporation installation (VUP - 4) by an electron bombardment method. Carbon was sprayed on a glass plate with previously deposited of layer salt. After a heating during 12 hours at the temperature of 150 o C the film of carbon was floated from glass plate and self - supporting target has been picked up on the specially prepared target frame. In order to determine thickness of target there was used the resonance chamber, installed in the protons channel of the accelerator RAC - 2 - 1 (INP NNC RK), with the help of which there was measured energy loss of the protons beam during the passage through target, disposed in the central chamber. For this purpose there was used the reaction 27 Al(p,γ) 28 Si with narrow resonance with E R = 992 keV and with detection of gamma-quanta with E γ = 1779 keV. On shift of the resonance E R =992 keV in the reaction 27 Al(p,γ) 28 Si, which takes place owing to protons energy loss in the thickness of carbon film, and using table values of brake quantities S(E p )[MeV·cm 2 /g] [1], there was determined thickness of this fine film. Such the method allows to determine thicknesses of films in the interval of (10 † 100) mcg/cm 2 with the accuracy of not worse than 5%. In the present work there were carried out measurements of angular distributions of cross sections of the
NASA Education Activity Training (NEAT): Professional Development for Montana K-12 Teachers
Williamson, Kathryn; McKenzie, D.; Des Jardins, A.; Key, J.; Kanode, C.; Willoughby, S.
2012-05-01
Piloted during the 2011-2012 academic year, the NASA Education Activity Training (NEAT) teacher workshop program has introduced five solar astronomy and space weather activities to over forty Montana K-12 teachers. Because many Montana schools are geographically isolated (40% of Montana students live more than 50 miles from a city) and/or serve traditionally underrepresented groups (primarily Native Americans), professional development for teachers can be costly and time consuming. However, with funding shared by the Atmospheric Imaging Assembly EPO team and the Montana Space Grant Consortium, graduate student specialists are able to host the two-hour NEAT workshops on-site at the schools free of charge, and participating teachers earn two continuing education credits. Leveraging the existing catalogue of research-based NASA activities, the featured NEAT activities were chosen for their ease-of-use and applicability to Montana science standards. These include three advanced activities for older students, such as a paper plate activity for the June 5th, 2012 Transit of Venus, Kinesthetic Astronomy, and the Herschel Infrared experiment, along with two simpler activities for the younger students, such as Solar Cookies and the Electromagnetic War card game. Feedback surveys show that NEAT workshop participants were interested and engaged in the activities and planned on using the activities in their classrooms. With such positive responses, the NEAT program has been a huge success and can serve as a model for other institutions looking to increase their space public outreach and education.
Keane, Sheila; Lincoln, Michelle; Smith, Tony
2012-06-22
Uneven distribution of the medical workforce is globally recognised, with widespread rural health workforce shortages. There has been substantial research on factors affecting recruitment and retention of rural doctors, but little has been done to establish the motives and conditions that encourage allied health professionals to practice rurally. This study aims to identify aspects of recruitment and retention of rural allied health professionals using qualitative methodology. Six focus groups were conducted across rural NSW and analysed thematically using a grounded theory approach. The thirty allied health professionals participating in the focus groups were purposively sampled to represent a range of geographic locations, allied health professions, gender, age, and public or private work sectors. Five major themes emerged: personal factors; workload and type of work; continuing professional development (CPD); the impact of management; and career progression. 'Pull factors' favouring rural practice included: attraction to rural lifestyle; married or having family in the area; low cost of living; rural origin; personal engagement in the community; advanced work roles; a broad variety of challenging clinical work; and making a difference. 'Push factors' discouraging rural practice included: lack of employment opportunities for spouses; perceived inadequate quality of secondary schools; age related issues (retirement, desire for younger peer social interaction, and intention to travel); limited opportunity for career advancement; unmanageable workloads; and inadequate access to CPD. Having competent clinical managers mitigated the general frustration with health service management related to inappropriate service models and insufficient or inequitably distributed resources. Failure to fill vacant positions was of particular concern and frustration with the lack of CPD access was strongly represented by informants. While personal factors affecting recruitment and
Directory of Open Access Journals (Sweden)
Keane Sheila
2012-06-01
Full Text Available Abstract Background Uneven distribution of the medical workforce is globally recognised, with widespread rural health workforce shortages. There has been substantial research on factors affecting recruitment and retention of rural doctors, but little has been done to establish the motives and conditions that encourage allied health professionals to practice rurally. This study aims to identify aspects of recruitment and retention of rural allied health professionals using qualitative methodology. Methods Six focus groups were conducted across rural NSW and analysed thematically using a grounded theory approach. The thirty allied health professionals participating in the focus groups were purposively sampled to represent a range of geographic locations, allied health professions, gender, age, and public or private work sectors. Results Five major themes emerged: personal factors; workload and type of work; continuing professional development (CPD; the impact of management; and career progression. ‘Pull factors’ favouring rural practice included: attraction to rural lifestyle; married or having family in the area; low cost of living; rural origin; personal engagement in the community; advanced work roles; a broad variety of challenging clinical work; and making a difference. ‘Push factors’ discouraging rural practice included: lack of employment opportunities for spouses; perceived inadequate quality of secondary schools; age related issues (retirement, desire for younger peer social interaction, and intention to travel; limited opportunity for career advancement; unmanageable workloads; and inadequate access to CPD. Having competent clinical managers mitigated the general frustration with health service management related to inappropriate service models and insufficient or inequitably distributed resources. Failure to fill vacant positions was of particular concern and frustration with the lack of CPD access was strongly represented by
Embeddings of SU/sup c/3 in unifying gauge groups
International Nuclear Information System (INIS)
Slansky, R.
1978-01-01
Hypothetical models that attempt to unify electromagnetic, weak, and strong interactions into a simple, compact gauge group G are discussed. The problem of embedding the strong group SU 3 /sup c/ in any larger simple group is solved, and a complete classification of theories where the color in some representation is restricted to 1/sup c/, 3/sup c/, and anti 3/sup c/ is given
Chevannes, Mel
2002-08-01
The main aim of the study was to undertake training needs analysis among a multi-professional group for the purpose of improving care for ethnic minority patients and other service users. Evidence from the literature identifies that some of the explanations advanced for the failure of health professionals to meet the needs of ethnic minorities include lack of understanding of cultural diversities, racism, racial stereotyping, lack of knowledge, exclusivity, and ethnocentrism. While these issues have been addressed in different countries, little work has been carried out to examine these from the perspective of health professionals caring for ethnic minorities. This study is therefore an attempt to find out what health professionals know about caring for patients and other service users from minority ethnic groups and their perception of training needs in this area of work. A pre- and post-training design phase structured the qualitative approach. A purposive sample of individuals working across five health service organizations located in a multi-racial city yielded a multi-professional group of participants. Views of 22 participants were obtained by semi-structured interviews at a pretraining phase. Training needs of health professionals drew on Walklin's (1992) six stages used to structure data collection, data analysis and delivery of training. The post-training phase used questionnaires to evaluate immediate learning that based on a 4-week period of reflection and applied to practice. The questionnaires were complemented by a facilitator-lead focus group. The majority of the participants confirmed that no attention was given in their initial education to the health care needs of minority ethnic groups. Instead, participants engaged in self-initiated learning to improve their knowledge and understanding. The issue of communication was viewed with dissatisfaction and seen as affecting the sufficiency of caring for these patients. All participants rated meeting
(Acetylacetonato-κ2O,O′bis[5-methoxy-2-(naphth[1,2-d][1,3]oxazol-2-ylphenyl-κ2C1,N]iridium(III
Directory of Open Access Journals (Sweden)
Yuan-Yuan Zhou
2011-10-01
Full Text Available In the title compound, [Ir(C18H12NO22(C5H7O2], the Ir atom is O,O′-chelated by the acetylacetonate group and C,N-chelated by the 2-arylnaphth[1,2-d]oxazole groups. The six-coordinate metal atom displays a distorted octahedral geometry. Intramolecular C—H...O hydrogen bonds occur. In the crystal, intermolecular C—H...O hydrogen bonds link the molecules into columns parallel to the b axis.
Energy Technology Data Exchange (ETDEWEB)
Plaga, R.; Becker, H.W.; Redder, A.; Rolfs, C.; Trautvetter, H.P.; Langanke, K.
1987-04-06
The elastic scattering of alpha particles from /sup 12/C has been investigated for 35 angles in the range theta/sub lab/ = 22/sup 0/ to 163/sup 0/ and for 51 energies at E/sub ..cap alpha../ = 1.0 to 6.6 MeV. The extracted phase shifts for l=0 to 6 partial waves have been parametrized in terms of the multilevel R-matrix formalism. Information on the deduced parameters of states in /sup 16/O is reported. The data reveal reduced ..cap alpha..-particle widths for the 6.92 and 7.12 MeV subthreshold states consistent with recent work. The implications for the stellar reaction rate of /sup 12/C(..cap alpha..,..gamma..)/sup 16/O are discussed.
K-12 Professional Development at the Harvard Forest LTER
Bennett, K.
2012-12-01
As part of the Long Term Ecological Research (LTER) program, the Harvard Forest in Petersham, Massachusetts seeks to train the next generation of researchers, by involving K-12 grade students and their teachers in hands-on, field-based, ecological research in their own schoolyard and community. Students learn to collect data on important long-term ecological issues and processes. Student data are then shared on the Harvard Forest website. To prepare teachers for project protocols, teachers are given direct access to Harvard ecologists with professional development workshops and on-line resources. With the Harvard Forest Schoolyard LTER program, students can participate in three different research projects focusing on phenology, invasive insects, and vernal pools. Teachers attend the Summer Institute for Teachers to learn project content and methods. They return in fall to participate in one of three levels of data workshops to learn how to input, manage, and analyze project data. In the spring, teachers again meet with the Harvard ecologists about project protocols, and to share, through a series of teacher presentations, the ways these project themes are being integrated into class curricula. These professional development opportunities result in long term collaborative partnerships with local schools and the Harvard Forest LTER. In addition to the LTER Schoolyard Ecology Program, the Harvard Forest has supported a successful Research Experience for Teachers (RET) program for the last six years. Throughout the summer, teachers work on research projects alongside Harvard Forest and affiliated scientists, post-docs, graduate students, and REU's (Research Experience for Undergraduates). The RET program provides teachers with the opportunity to build scientific knowledge, develop an understanding of research methods, and translate their new knowledge and experiences into cutting edge classroom lessons. The past two summers I have worked with Dr. Andrew Richardson
Simulation of 200-400 MeV/u "1"2C + "1"2C elastic scattering on SHARAQ spectrometer
International Nuclear Information System (INIS)
Yu Lei; Zhang Gaolong; Terashima, S.; Le Xiaoyun; Tanihata, I.
2015-01-01
In order to further obtain the information of three-body force (TBF) from 200-400 MeV/u "1"2C + "1"2C elastic scattering, we plan to perform this experiment on a SHARAQ spectrometer. Based on the experimental condition of the Radioactive Ion Beam Factory (RIBF)-SHARAQ facility, a simulation is given to find a compromise between the better energy and angular resolutions, and higher yield by optimizing the target thickness, beam transport mode, beam intensity and angular step. From the simulation, we found that the beam quality mainly limits the improvements of energy and angular resolutions. A beam tracking system as well as a lateral and angular dispersion-matching technique are adopted to reduce the influence of beam quality. According to the two angular settings of SHARAQ as well as the expected cross sections on the basis of the theoretical model, the energy and angular resolutions, and statistical accuracy are estimated. (authors)
Bullington, Jennifer; Cronqvist, Agneta
2018-03-01
In primary health care, efficacious treatment strategies are lacking for these patients, although the most prominent symptoms accounting for consultation in primary care often cannot be related to any biological causes. The aim was to explore whether group supervision from a specific phenomenological theory of psychosomatics could provide healthcare professionals treating patients with psychosomatic health issues within primary care a deeper understanding of these conditions and stimulate profession-specific treatment strategies. Our research questions were as follows: (i) What is the healthcare professionals' understanding of psychosomatics before and after the intervention? (ii) What are the treatment strategies for this group of patients before and after the intervention? The study was an explorative qualitative intervention pilot study. The six participants from a primary healthcare setting in a medium-sized city in Sweden participated in the study. A supervision group was formed, based on a mix of professions, age, gender and years of clinical experience. Supervision consisted of one 75-minutes meeting every month during the course of 6 months. Participants were interviewed before and after the supervision intervention. The study showed two distinct categories emerged from the data. One category of healthcare professionals espoused a psycho-educative approach, while the other lacked a cohesive approach. The supervision improved the second category of healthcare professionals' understanding of psychosomatics. The psycho-educative group did not change their understanding of psychosomatics, although they felt strengthened in their approach by the supervision. Profession-specific strategies were not developed. This pilot study indicates that a relatively short supervision intervention can aid clinicians in their clinical encounters with these patients; however, further research is necessary to ascertain the value of the specific phenomenologically based
Liao, Jiunn-Wang; Kang, Jaw-Jou; Jeng, Chian-Ren; Chang, Shao-Kuang; Kuo, Ming-Jang; Wang, Shun-Cheng; Liu, Michael R S; Pang, Victor Fei
2006-02-15
Our previous study has demonstrated that instead of neuromuscular blockage cartap, an organonitrogen insecticide, could cause a marked irreversible Ca2+-dependent contracture in both isolated mouse and rabbit phrenic nerve-diaphragms. We further examined the potential of direct myocytotoxicity of cartap and the possible roles of calcium ion and oxidative stress on cartap-induced muscle cell injury using the mouse myoblast cell line, C2C12. Cartap exerted a dose- and time-dependent cytotoxic effect in C2C12 cells measured by MTT colorimetric assay and trypan blue dye exclusion. The extracellular activities of both creatine kinase (CK) and lactate dehydrogenase (LDH) were elevated in the cartap-treated groups at or greater than 100 microM. The isoenzymatic profiles showed that the elevations were mainly due to CK-3, LDH-3, and LDH-4. Following the addition of 0.5-2.5mM EGTA, a Ca2+ chelator, or 30-100 microM verapamil, an L-type Ca2+ channel blocker, the cartap-induced reduction in MTT metabolic rate of C2C12 cells was significantly restored in a dose-dependent manner in both EGTA and verapamil-treated cells. Furthermore, EGTA could significantly reduce the cartap-induced elevation in the levels of total extracellular CK and LDH activities. Additionally, cartap significantly increased the level of endogenous reactive oxygen species (ROS) in C2C12 cells in a dose- and time-dependent manner. The cartap-induced ROS generation could be significantly inhibited by antioxidants, including Vitamins C and E, catalase, and superoxide dismutase, with catalase the most effective. EGTA could significantly inhibit cartap-induced ROS generation in a dose-dependent manner. The results suggested that cartap could induce ROS generation in C2C12 cells via a Ca2+-dependent mechanism resulting in subsequent cytotoxicity, at least partially, to C2C12 cells. It is speculated that both Ca2+ and Ca2+-induced ROS may also play the central role on the myogenic contracture and myofiber injury
International Nuclear Information System (INIS)
Sanchez, R. M.; Vano, E.; Fernandez, J. M.; Goicolea Ruigomez, J.; Pifarre, X.; Escaned, J.; Rovira, J. J.; Garcia del Blanco, B.; Carrera, F.; Diaz, J. F.; Ordiales, J. M.; Nogales, J. M.; Hernandez, J.; Bosa, F.; Rosales, F.; Saez, J. R.; Soler, M. M.; Romero, M. A.
2013-01-01
The multidisciplinary group and multicenter DOCCACI (dosimetry and quality assurance in interventional cardiology), sponsored by the section of haemodynamics of the Spanish society of Cardiology, is intended to propose reference levels to doses received by patients in interventional cardiology procedures such as recommended by the International Commission on radiological protection It also investigates the doses received by professionals, in particular dose in Crystallyne whose recommended limit dose has been reduced recently from 150 to 20 mSv/year. (Author)
International Nuclear Information System (INIS)
Denhoefer, G.
1980-01-01
In this thesis different aspects of the reaction 12 C + 12 C were studied. The first part deals with high spin states in the mirror nucki 23 Na and 23 Mg experially with the states resonantly populated at Esub(cm) = 19.3 MeV. For the state at 9.80 MeV in 23 Na with (p,γ) angular correlation measurements a spin of 17/2 + and by Doppler form analysis a lifetime of (21 +- 9)fs was found. The probably analogous state at 9.61 MeV in 23 Mg decays both under p-emission to 22 Na and under γ-emission. Because of the p-decay probabilities to 3 + and 4 + of 22 Na, which were observed in (p,n) coincidence measurements, it has also the spin 17/2 + . In the second part of this thesis it was studied whether the reaction 12 C + 12 C at incident energies between 26 MeV and 42 MeV can be described using the statistical model. (orig./HSI) [de
Directory of Open Access Journals (Sweden)
Ali Reza Ashrafi
2016-09-01
Full Text Available Darafsheh and Assari in [Normal edge-transitive Cayley graphs onnon-abelian groups of order 4p, where p is a prime number,Sci. China Math. {bf 56} (1 (2013 213$-$219.] classified the connected normal edge transitive and$frac{1}{2}-$arc-transitive Cayley graph of groups of order$4p$. In this paper we continue this work by classifying theconnected Cayley graph of groups of order $2pq$, $p > q$ areprimes. As a consequence it is proved that $Cay(G,S$ is a$frac{1}{2}-$edge-transitive Cayley graph of order $2pq$, $p> q$ if and only if $|S|$ is an even integer greater than 2, $S =T cup T^{-1}$ and $T subseteq { cba^{i} | 0 leq i leq p- 1}$ such that $T$ and $T^{-1}$ are orbits of $Aut(G,S$ andbegin{eqnarray*}G &=& langle a, b, c | a^p = b^q = c^2 = e, ac = ca, bc = cb, b^{-1}ab = a^r rangle,G &=& langle a, b, c | a^p = b^q = c^2 = e, c ac = a^{-1}, bc = cb, b^{-1}ab = a^r rangle,end{eqnarray*}where $r^q equiv 1 (mod p$.
Morténius, Helena; Twetman, Svante
2017-12-29
Despite the availability of contemporary research advances, only a limited fraction is implemented into dental practice. One possible way to facilitate this process is to stimulate the research and development (R&D) awareness and interest with aid of strategic communication. The aim of the study was to analyse the role of a strategic communication in R&D awareness and interest among dental care professionals (DCP) over a 12-year period. A second aim was to compare the findings with those from primary care professionals (PCP). The project had a prospective design and the intervention was conducted through established oral, written and digital channels. The outcome was captured by two validated questionnaires submitted after 7 and 12 years, respectively. An additional Questionnaire file shows the details [see Additional file 1]. The material consisted of 599 health care professionals (205 DCP; 394 PCP) that responded to the first questionnaire and 526 individuals (195 DCP; 331 PCP) who responded to the second. All were employed by the primary care organization of Region Halland located in southwest of Sweden. The majority were women (≥ 85%) and the mean age at the first questionnaire was 49 years (SD 8.5). Longitudinal analyses were applied to those individuals that responded to both surveys after 7 and 12 years (n = 248). Comparisons between DCP's and PCP's were processed with Chi-square and Fischer's exact tests. Strategic communication contributed to increase the R&D awareness and interest among the dental personnel. The created interest was reported stronger among the DCP when compared with PCP at both surveys (p Strategic communication can be employed as a scientific tool that may contribute to the creation of a long-term R&D awareness and interest among dental care professionals.
2018-01-01
Implementation of evidence-based practice (EBP) is a complex task. This study, conducted in an acute geriatric setting, aims to compare self-reported capability beliefs on EBP between health professionals and students, and to compare the use of EBP between health professional groups. Occupational therapists, physicians, physiotherapists and registered nurses with three or more months’ employment, and all students from the occupational therapy, medical, physiotherapy and nursing programs, who had conducted workplace learning at the department, were invited. Data on capability beliefs and use of EBP were collected using the Evidence-based Practice Capabilities Beliefs Scale assessing six activities of EBP: formulate questions; search databases; search other sources; appraise research reports; participate in implementation in practice; and participate in evaluation. Descriptive and inferential statistics were used. Capability beliefs on EBP: The health professionals (n = 101; response rate 80%) reported high on search other sources but less on appraise research reports. The students (n = 124; response rate 73%) reported high on all EBP activities. The health professionals reported significantly higher on search other sources than the students. The students reported significantly higher on formulate questions and appraise research reports than the health professionals. No significant differences were identified between the health professional groups or between the student groups. Use of EBP: Health professionals reported wide-ranging use from several times each month to once every six months. The physicians reported significantly more frequent use than registered nurses and occupational therapists. Health professionals supervising students reported more frequent use of appraise research reports than the non-supervising group. There is a need for improving the use of EBP, particularly among registered nurses and occupational therapists. Supervision of students might
Directory of Open Access Journals (Sweden)
Anne-Marie Boström
Full Text Available Implementation of evidence-based practice (EBP is a complex task. This study, conducted in an acute geriatric setting, aims to compare self-reported capability beliefs on EBP between health professionals and students, and to compare the use of EBP between health professional groups. Occupational therapists, physicians, physiotherapists and registered nurses with three or more months' employment, and all students from the occupational therapy, medical, physiotherapy and nursing programs, who had conducted workplace learning at the department, were invited. Data on capability beliefs and use of EBP were collected using the Evidence-based Practice Capabilities Beliefs Scale assessing six activities of EBP: formulate questions; search databases; search other sources; appraise research reports; participate in implementation in practice; and participate in evaluation. Descriptive and inferential statistics were used. Capability beliefs on EBP: The health professionals (n = 101; response rate 80% reported high on search other sources but less on appraise research reports. The students (n = 124; response rate 73% reported high on all EBP activities. The health professionals reported significantly higher on search other sources than the students. The students reported significantly higher on formulate questions and appraise research reports than the health professionals. No significant differences were identified between the health professional groups or between the student groups. Use of EBP: Health professionals reported wide-ranging use from several times each month to once every six months. The physicians reported significantly more frequent use than registered nurses and occupational therapists. Health professionals supervising students reported more frequent use of appraise research reports than the non-supervising group. There is a need for improving the use of EBP, particularly among registered nurses and occupational therapists. Supervision of
Non commutative geometry methods for group C{sup *}-algebras
Energy Technology Data Exchange (ETDEWEB)
Diep, Do Ngoc
1996-09-01
This book is intended to provide a quick introduction to the subject. The exposition is scheduled in the sequence, as possible for more understanding for beginners. The author exposed a K-theoretic approach to study group C{sup *}-algebras: started in the elementary part, with one example of description of the structure of C{sup *}-algebra of the group of affine transformations of the real straight line, continued then for some special classes of solvable and nilpotent Lie groups. In the second advanced part, he introduced the main tools of the theory. In particular, the conception of multidimensional geometric quantization and the index of group C{sup *}-algebras were created and developed. (author). Refs.
Jung, Jung-Il; Park, Kyeong-Yong; Lee, Yura; Park, Mira; Kim, Jiyeon
2018-03-15
Vitamin C-linker-conjugated Ala-His-Lys tripeptide (Vit C-AHK) is a derivative of Vitamin C-conjugated tripeptides, which were originally developed as a component of a product for collagen synthesis enhancement or human dermal fibroblast growth. Here, we investigated the effect of Vit C-AHK on bone morphogenetic protein (BMP)-2-induced osteoblast differentiation in a cell culture model. Vit C-AHK enhanced proliferation of C2C12 cells and induction of BMP-2-induced alkaline phosphatase, a typical marker of osteoblast differentiation. Vit C-AHK also stimulated the phosphorylation and translocation of Smad1/5/8 to the nucleus and phosphorylation of mitogen-activated protein kinases (MAPKs) including ERK1/2 and p38. In addition, Vit C-AHK enhanced the BMP-2-induced mRNA expression of osteoblast differentiation-related genes such as ALP, BMP-2, Osteocalcin, and Runx2. Our results suggest that Vit C-AHK exerts an enhancing effect on osteoblast proliferation and differentiation through activation of Smad1/5/8 and MAPK ERK1/2 and p38 signaling and without significant cytotoxicity. These results provide important data for the development of peptide-based bone-regenerative agents and treatment of bone-related disorders. Copyright © 2018 International Society of Differentiation. Published by Elsevier B.V. All rights reserved.
C-12/C-13 isotope ratio of the interstellar medium in the neighborhood of the sun
International Nuclear Information System (INIS)
Hawkins, I.; Jura, M.
1987-01-01
Data from observations of Xi Per, P Cyg, 20 Tau, and 23 Tau, obtained at 4232 and 3957 A using a coude spectrograph and a 1872-element reticon on the 3-m Shane telescope at Lick Observatory during 1984-1985, are combined with data on Zeta Oph (Hawkins et al., 1985) and used to estimate the C isotope ratio of the ISM near the sun. The results are presented in extensive tables and graphs and characterized in detail. The (C-12)H(+)/(C-13)H(+) abundance ratios toward the five stars are found to agree to within 12 percent and shown to be representative of the C-12/C-13 ratios in the gas, strongly indicating that the local ISM is homogeneous. The difference between the ISM ratio (43 + or - 4) and the solar-system value (89) is attributed to the chemical evolution of the ISM in the 4.9 Gyr since the formation of the sun. 78 references
Wang, Heng; Castillo, Álvaro; Bozzelli, Joseph W
2015-07-23
Enthalpies of formation for 14 C2–C4 fluorinated hydrocarbons were calculated with nine popular ab initio and density functional theory methods: B3LYP, CBS-QB3, CBS-APNO, M06, M06-2X, ωB97X, G4, G4(MP2)-6X, and W1U via several series of isodesmic reactions. The recommended ideal gas phase ΔHf298° (kcal mol(–1)) values calculated in this study are the following: −65.4 for CH3CH2F; −70.2 for CH3CH2CH2F; −75.3 for CH3CHFCH3; −75.2 for CH3CH2CH2CH2F; −80.3 for CH3CHFCH2CH3; −108.1 for CH2F2; −120.9 for CH3CHF2; −125.8 for CH3CH2CHF2; −133.3 for CH3CF2CH3; −166.7 for CHF3; −180.5 for CH3CF3; −185.5 for CH3CH2CF3; −223.2 for CF4; and −85.8 for (CH3)3CF. Entropies (S298° in cal mol(–1) K(–1)) were estimated using B3LYP/6-31+G(d,p) computed frequencies and geometries. Rotational barriers were determined and hindered internal rotational contributions for S298°, and Cp(T) were calculated using the rigid rotor harmonic oscillator approximation, with direct integration over energy levels of the intramolecular rotation potential energy curve. Thermochemical properties for the fluorinated carbon groups C/C/F/H2, C/C2/F/H, C/C/F2/H, C/C2/F2, and C/C/F3 were derived from the above target fluorocarbons. Previously published enthalpies and groups for 1,2-difluoroethane, 1,1,2-trifluoroethane, 1,1,2,2-tetrafluoroethane, 1,1,1,2-tetrafluoroethane, 1,1,1,2,2-pentafluoroethane, 2-fluoro-2-methylpropane that were previously determined via work reaction schemes are revised using updated reference species values. Standard deviations are compared for the calculation methods.
Professional Parallel Programming with C# Master Parallel Extensions with NET 4
Hillar, Gastón
2010-01-01
Expert guidance for those programming today's dual-core processors PCs As PC processors explode from one or two to now eight processors, there is an urgent need for programmers to master concurrent programming. This book dives deep into the latest technologies available to programmers for creating professional parallel applications using C#, .NET 4, and Visual Studio 2010. The book covers task-based programming, coordination data structures, PLINQ, thread pools, asynchronous programming model, and more. It also teaches other parallel programming techniques, such as SIMD and vectorization.Teach
Zhou, Hong; Shi, Lu; Mao, Yuping; Tang, Juan; Zeng, Yu
2014-01-01
The Sichuan "5.12" Earthquake in 2008 occurred in a relatively underdeveloped area in China. The rainy weather, the mountainous environment and the local languages all posed major challenges to the dissemination of information and services after the disaster. By adopting a communication perspective, this study applies the diffusion of innovations theory to investigate how healthcare professionals diffused health technologies, health information and services during the rescue and relief operation. The authors conducted three focus group sessions with the health professionals who had attended to the rescue and relief work of the Sichuan "5.12" Earthquake in 2008. A range of questions regarding the diffusion of innovations were asked during these sessions. The health professionals used their cell phones to communicate with other healthcare providers, disseminated knowledge of health risks and injuries to affected residents with pamphlets and posters and attended daily meetings at the local government offices. They reported on the shortage of maritime satellite cell phones and large-size tents for medical use, and the absence of fully equipped ambulances. Volunteers, local health professionals and local officials provided health information and services in different ways. However, the diffusion of health information and services was less likely to reach those living next to transportation centers, in remote areas and in disaster areas neglected by the media. New communication devices such as cell phones and the mobile Internet enabled medical professionals to coordinate the rescue and relief work after this major natural disaster, at a time when the country's emergency response system still had plenty of room for improvement. In future, the mobile Internet should be used as a means of collecting bottom-up disaster reports so that the media will not neglect any disaster areas as they did during the Sichuan Earthquake. Rescue relief work would have been substantially
11 CFR 100.11 - State (2 U.S.C. 431(12)).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...
Visser, Ryan D.; Evering, Lea Calvert; Barrett, David E.
2014-01-01
This mixed-methods study explores how K-12 teachers use Twitter. An online survey was disseminated via Twitter to gauge their usage of, access to, and perceptions of Twitter. The results indicated that teachers highly value Twitter as a means of self-directed professional development. Respondents who reported using Twitter multiple times a day…
Leucine Modulates Mitochondrial Biogenesis and SIRT1-AMPK Signaling in C2C12 Myotubes
Directory of Open Access Journals (Sweden)
Chunzi Liang
2014-01-01
Full Text Available Previous studies from this laboratory demonstrate that dietary leucine protects against high fat diet-induced mitochondrial impairments and stimulates mitochondrial biogenesis and energy partitioning from adipocytes to muscle cells through SIRT1-mediated mechanisms. Moreover, β-hydroxy-β-methyl butyrate (HMB, a metabolite of leucine, has been reported to activate AMPK synergistically with resveratrol in C2C12 myotubes. Therefore, we hypothesize that leucine-induced activation of SIRT1 and AMPK is the central event that links the upregulated mitochondrial biogenesis and fatty acid oxidation in skeletal muscle. Thus, C2C12 myotubes were treated with leucine (0.5 mM, alanine (0.5 mM, valine (0.5 mM, EX527 (SIRT1 inhibitor, 25 μM, and Compound C (AMPK inhibitor, 25 μM alone or in combination to determine the roles of AMPK and SIRT1 in leucine-modulation of energy metabolism. Leucine significantly increased mitochondrial content, mitochondrial biogenesis-related genes expression, fatty acid oxidation, SIRT1 activity and gene expression, and AMPK phosphorylation in C2C12 myotubes compared to the controls, while EX527 and Compound C markedly attenuated these effects. Furthermore, leucine treatment for 24 hours resulted in time-dependent increases in cellular NAD+, SIRT1 activity, and p-AMPK level, with SIRT1 activation preceding that of AMPK, indicating that leucine activation of SIRT1, rather than AMPK, is the primary event.
Study of the interactionπ+p at 1.2 GeV/c π+ laboratory momentum
International Nuclear Information System (INIS)
Ladron de Guevara, P.
1973-01-01
We present the main results of a 0.33 events/urban experiment of π + interactions in hydrogen at 1.2 GeV/c, using the 80 cm Saclay bubble chamber. the partial cross sections of the different reactions and the elastic differential cross section are computed by normalizing to the total cross section obtained by other groups. (Author) 34 refs
Phase-shift-analysis approach to elastic neutron scattering from 12C between 9 and 12 MeV
International Nuclear Information System (INIS)
Tornow, W.
1985-01-01
The excitation energy, spin and parity of levels in 13 C have been determined for excitation energies between 13 and 16 MeV via a phase-shift analysis of the measured total cross section, elastic differential cross section and analysing power for n + 12 C in the neutron energy range from 8.9 to 12.0 MeV. New analysing power measurements are reported for this energy range. The present and previous experimental data are well described by the phase shifts obtained. The non-elastic cross section for n + 12 C predicted from the phase shifts is in good agreement with the ENDF/B-V evaluation. The need for further experimental data is pointed out. (author)
Fusion hindrance for the positive Q -value system 12C+30Si
Montagnoli, G.; Stefanini, A. M.; Jiang, C. L.; Hagino, K.; Galtarossa, F.; Colucci, G.; Bottoni, S.; Broggini, C.; Caciolli, A.; Čolović, P.; Corradi, L.; Courtin, S.; Depalo, R.; Fioretto, E.; Fruet, G.; Gal, A.; Goasduff, A.; Heine, M.; Hu, S. P.; Kaur, M.; Mijatović, T.; Mazzocco, M.; Montanari, D.; Scarlassara, F.; Strano, E.; Szilner, S.; Zhang, G. X.
2018-02-01
Background: The fusion reaction 12C+30Si is a link between heavier cases studied in recent years, and the light heavy-ion systems, e.g., 12C+12C , 16O+16O that have a prominent role in the dynamics of stellar evolution. 12C+30Si fusion itself is not a relevant process for astrophysics, but it is important to establish its behavior below the barrier, where couplings to low-lying collective modes and the hindrance phenomenon may determine the cross sections. The excitation function is presently completely unknown below the barrier for the 12C+30Si reaction, thus no reliable extrapolation into the astrophysical regime for the C+C and O+O cases can be performed. Purpose: Our aim was to carry out a complete measurement of the fusion excitation function of 12C+30Si from well below to above the Coulomb barrier, so as to clear up the consequence of couplings to low-lying states of 30Si, and whether the hindrance effect appears in this relatively light system which has a positive Q value for fusion. This would have consequences for the extrapolated behavior to even lighter systems. Methods: The inverse kinematics was used by sending 30Si beams delivered from the XTU Tandem accelerator of INFN-Laboratori Nazionali di Legnaro onto thin 12C (50 μ g /cm2 ) targets enriched to 99.9 % in mass 12. The fusion evaporation residues (ER) were detected at very forward angles, following beam separation by means of an electrostatic deflector. Angular distributions of ER were measured at Ebeam=45 , 59, and 80 MeV, and they were angle integrated to derive total fusion cross sections. Results: The fusion excitation function of 12C+30Si was measured with high statistical accuracy, covering more than five orders of magnitude down to a lowest cross section ≃3 μ b . The logarithmic slope and the S factor have been extracted and we have convincing phenomenological evidence of the hindrance effect. These results have been compared with the calculations performed within the model that
Energy Technology Data Exchange (ETDEWEB)
Milner, E.C.
1985-12-01
The observation of ..lambda..-hypernuclear levels in /sub ..lambda..//sup 12/C by associated production through the (..pi../sup +/,K/sup +/) reaction is reported. Spectrometers used in the measurements are discussed. The /sub ..lambda..//sup 12/C excitation energy spectra were recorded at laboratory scattering angles of 5.6/sup 0/, 10.3/sup 0/, and 15.2/sup 0/. The spectra show two major peaks - one attributed to the ground state, and one about 11 MeV higher in excitation. The peak near 11 MeV excitation energy is believed to be almost entirely composed of a multiplet of three J/sup ..pi../ = 2/sup +/ states. Relativistic DWBA calculations imply support for the expectation that higher spin states are preferentially populated in the (..pi../sup +/,K/sup +/) reaction, compared to the (K/sup -/,..pi../sup -/) reaction in which lower spin states are excited. 29 refs., 40 figs.
Effects of strong electron correlations in Ti8C12 Met-Car
International Nuclear Information System (INIS)
Varganov, Sergey A.; Gordon, Mark S.
2006-01-01
The results of multireference configuration interaction (MRCI) with single and double excitations and single reference coupled cluster (CCSD(T)) calculations on Ti 8 C 12 metallocarbohedryne (Met-Car) are reported. The distortions of the T d structure to D 2d and C 3v structures due to the Jahn-Teller effect are studied. It is shown that the Ti 8 C 12 wave function has significant multireference character. The choice of the active space for multireference self-consistent field (MCSCF) calculations is discussed. The failure of multireference perturbation theory with a small active space is attributed to multiple intruder states. A new, novel type of MCSCF calculation, ORMAS (occupation restricted multiple active spaces) with a large active space are carried out for several electronic states of Ti 8 C 12 . The Jahn-Teller distorted D 2d 1 A 1 (nearly T d ) structure is predicted to be the Ti 8 C 12 ground state. Predictions of the Ti 8 C 12 ionization potential with different ab initio methods are presented
The analyzing power Asub(y)[(theta) for 12C(n,nsub(0,1))12C betwen 8.9 and] 14.9 MeV neutron energy
International Nuclear Information System (INIS)
Woye, E.; Tornow, W.; Mack, G.; Clegg, T.B.; Wylie, W.
1983-01-01
The analyzing power Asub(#betta#)(theta) for 12 C(n,n) 12 C elastic scattering and for inelastic scattering to the first excited state (Jsup(π) = 2 + , Q = -4.44 MeV) of 12 C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the 2 H(d vector,n vector) 3 He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(#betta#) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved. (orig.)
Milberg, Anna; Torres, Sandra; Ågård, Pernilla
2016-01-01
The academic debate on cross-cultural interaction within the context of end-of-life care takes for granted that this interaction is challenging. However, few empirical studies have actually focused on what health care professionals think about this interaction. This study aimed to explore health care professionals' understandings of cross-cultural interaction during end-of-life care. Sixty end-of-life care professionals were recruited from eleven care units in Sweden to take part in focus group interviews. These interviews were analyzed using qualitative content analysis. The health care professionals interviewed talked about cross-cultural interaction in end-of-life care as interaction that brings about uncertainty, stress and frustration even though they had limited experience of this type of interaction. The focus group discussions brought attention to four specific challenges that they expected to meet when they care for patients with migrant backgrounds since they took for granted that they would have an ethno-cultural background that is different to their own. These challenges had to do with communication barriers, 'unusual' emotional and pain expressions, the expectation that these patients' families would be 'different' and the anticipation that these patients and their families lack knowledge. At the core of the challenges in question is the idea that cross-cultural interaction means meeting "the unknown". In addition, the end-of-life care professionals interviewed talked about patients whose backgrounds they did not share in homogenizing terms. It is against this backdrop that they worried about their ability to provide end-of-life care that is individualized enough to meet the needs of these patients. The study suggests that end-of-life care professionals who regard cross-cultural interaction in this manner could face actual challenges when caring for patients whose backgrounds they regard as "the unknown" since they anticipate a variety of challenges
Directory of Open Access Journals (Sweden)
Anna Milberg
Full Text Available The academic debate on cross-cultural interaction within the context of end-of-life care takes for granted that this interaction is challenging. However, few empirical studies have actually focused on what health care professionals think about this interaction. This study aimed to explore health care professionals' understandings of cross-cultural interaction during end-of-life care.Sixty end-of-life care professionals were recruited from eleven care units in Sweden to take part in focus group interviews. These interviews were analyzed using qualitative content analysis.The health care professionals interviewed talked about cross-cultural interaction in end-of-life care as interaction that brings about uncertainty, stress and frustration even though they had limited experience of this type of interaction. The focus group discussions brought attention to four specific challenges that they expected to meet when they care for patients with migrant backgrounds since they took for granted that they would have an ethno-cultural background that is different to their own. These challenges had to do with communication barriers, 'unusual' emotional and pain expressions, the expectation that these patients' families would be 'different' and the anticipation that these patients and their families lack knowledge. At the core of the challenges in question is the idea that cross-cultural interaction means meeting "the unknown". In addition, the end-of-life care professionals interviewed talked about patients whose backgrounds they did not share in homogenizing terms. It is against this backdrop that they worried about their ability to provide end-of-life care that is individualized enough to meet the needs of these patients.The study suggests that end-of-life care professionals who regard cross-cultural interaction in this manner could face actual challenges when caring for patients whose backgrounds they regard as "the unknown" since they anticipate a variety
Lee, Yee Ming; Kwon, Junehee; Sauer, Kevin
2014-01-01
Purpose/Objectives: The purpose of this study was to explore child nutrition professionals' (CNPs) attitudes about food allergies, current practices of food allergy training, and operational issues related to food allergy training in school foodservice operations. Methods: Three focus groups were conducted with 21 CNPs with managerial…
Directory of Open Access Journals (Sweden)
Tomas K. Tong
2016-01-01
Full Text Available This field study investigated the influences of exposure to natural low altitude on endurance training-induced alterations of redox homeostasis in professional adolescent runners undergoing 12-week off-season conditioning program at an altitude of 1700 m (Alt, by comparison with that of their counterparts completing the program at sea-level (SL. For age-, gender-, and Tanner-stage-matched comparison, 26 runners (n=13 in each group were selected and studied. Following the conditioning program, unaltered serum levels of thiobarbituric acid reactive substances (TBARS, total antioxidant capacity (T-AOC, and superoxide dismutase accompanied with an increase in oxidized glutathione (GSSG and decreases of xanthine oxidase, reduced glutathione (GSH, and GSH/GSSG ratio were observed in both Alt and SL groups. Serum glutathione peroxidase and catalase did not change in SL, whereas these enzymes, respectively, decreased and increased in Alt. Uric acid (UA decreased in SL and increased in Alt. Moreover, the decreases in GSH and GSH/GSSG ratio in Alt were relatively lower compared to those in SL. Further, significant interindividual correlations were found between changes in catalase and TBARS, as well as between UA and T-AOC. These findings suggest that long-term training at natural low altitude is unlikely to cause retained oxidative stress in professional adolescent runners.
Tong, Tomas K; Kong, Zhaowei; Lin, Hua; He, Yeheng; Lippi, Giuseppe; Shi, Qingde; Zhang, Haifeng; Nie, Jinlei
2016-01-01
This field study investigated the influences of exposure to natural low altitude on endurance training-induced alterations of redox homeostasis in professional adolescent runners undergoing 12-week off-season conditioning program at an altitude of 1700 m (Alt), by comparison with that of their counterparts completing the program at sea-level (SL). For age-, gender-, and Tanner-stage-matched comparison, 26 runners (n = 13 in each group) were selected and studied. Following the conditioning program, unaltered serum levels of thiobarbituric acid reactive substances (TBARS), total antioxidant capacity (T-AOC), and superoxide dismutase accompanied with an increase in oxidized glutathione (GSSG) and decreases of xanthine oxidase, reduced glutathione (GSH), and GSH/GSSG ratio were observed in both Alt and SL groups. Serum glutathione peroxidase and catalase did not change in SL, whereas these enzymes, respectively, decreased and increased in Alt. Uric acid (UA) decreased in SL and increased in Alt. Moreover, the decreases in GSH and GSH/GSSG ratio in Alt were relatively lower compared to those in SL. Further, significant interindividual correlations were found between changes in catalase and TBARS, as well as between UA and T-AOC. These findings suggest that long-term training at natural low altitude is unlikely to cause retained oxidative stress in professional adolescent runners.
Nano-jewellery: C5Au12--a gold-plated diamond at molecular level.
Naumkin, F
2006-06-07
A mixed carbon-metal cluster is designed by combining the tetrahedral C(5) radical (with a central atom-the skeleton of the C(5)H(12) molecule) and the spherical Au(12) layer (the external atomic shell of the Au(13) cluster). The C(5)Au(12) cluster and its negative and positive ionic derivatives, C(5)Au(12)(+/-), are investigated ab initio (DFT) in terms of optimized structures and relative energies of a few spin-states, for the icosahedral-like and octahedral-like isomers. The cluster is predicted to be generally more stable in its octahedral shape (similar to C(5)H(12)) which prevails for the negative ion and may compete with the icosahedral shape for the neutral system and positive ion. Adiabatic ionization energies (AIE) and electron affinities (AEA) of C(5)Au(12), vertical electron-detachment (VDE) energies of C(5)Au(12)(-), and vertical ionization and electron-attachment energies (VIE, VEA) of C(5)Au(12) are calculated as well, and compared with those for the corresponding isomers of the Au(13) cluster. The AIE and VIE values are found to be close for the two systems, while the AEA and VDE values are significantly reduced for the radical-based species. A simple fragment-based model is proposed for the decomposition of the total interaction into carbon-gold and gold-gold components.
Directory of Open Access Journals (Sweden)
Neeti Christian
2017-06-01
Full Text Available Background: Headache is a common condition which physiotherapists have to deal with in clinical practice.Headaches which arise from the cervical spine are termed as Cervicogenic headaches (CGH, and these types of headaches are common form of a chronic and recurrent headache.The diagnostic criteria for CGH are outlined by the IHS (International Headache Society. The upper cervical joints, namely the occiput-C1 and C1-C2 segments are the most common origin of pain. Office and computer workers have the highest incidence of neck disorders than other occupations; the prevalence of neck disorders is above 50% among them. The purpose of this study is to find the effectiveness of Mulligan’s SNAG technique (C1-C2 and Maitland’s technique (C1-C2 in CGH and to compare these manual therapy techniques (Mulligan’s SNAG technique and Maitland’s technique with a control group. Methods: 30 subjects were selected for the study among them 23 subjects completed the study. The subjects were randomly allocated to 3 groups. The range of motion (ROM and severity of a headache were assessed pre and post intervention using FRT and HDI respectively. Result: The comparison revealed that SNAG group had a greater increase in cervical rotation (p<0.01 range than the Maitland’s technique and control groups. The mean value between pre-post differences shows a decrease in severity of a headache among all three groups. The significant difference between 3 groups was found through Tukey’s post hoc test using ANOVA method (Group A versus Group C; p<0.01 and Group B versus Group C; p<0.05. Conclusion: The present study suggested that C1-C2 SNAG technique showed statistically significant improvement in reducing headache and disability when compared to the Maitland’s mobilization technique among cervicogenic headache subjects
MicroRNA, miR-374b, directly targets Myf6 and negatively regulates C2C12 myoblasts differentiation
Energy Technology Data Exchange (ETDEWEB)
Ma, Zhiyuan; Sun, Xiaorui; Xu, Dequan; Xiong, Yuanzhu; Zuo, Bo, E-mail: zuobo@mail.hzau.edu.cn
2015-11-27
Myogenesis is a complex process including myoblast proliferation, differentiation and myotube formation and is controlled by myogenic regulatory factors (MRFs), MyoD, MyoG, Myf5 and Myf6 (also known as MRF4). MicroRNA is a kind of ∼22 nt-long non-coding small RNAs, and act as key transcriptional or post-transcriptional regulators of gene expression. Identification of miRNAs involved in the regulation of muscle genes could improve our understanding of myogenesis process. In this study, we investigated the regulation of Myf6 gene by miRNAs. We showed that miR-374b specifically bound to the 3'untranslated region (UTR) of Myf6 and down-regulated the expression of Myf6 gene at both mRNA and protein level. Furthermore, miR-374b is ubiquitously expressed in the tissues of adult C57BL6 mouse, and the mRNA abundance increases first and then decreases during C2C12 myoblasts differentiation. Over-expression of miR-374b impaired C2C12 cell differentiation, while inhibiting miR-374b expression by 2′-O-methyl antisense oligonucleotides promoted C2C12 cell differentiation. Taken together, our findings identified miR-374b directly targets Myf6 and negatively regulates myogenesis. - Highlights: • MiR-374b directly targets 3′UTR of Myf6. • MiR-374b negatively regulates Myf6 in C2C12 cells. • MiR-374b abundance significiently changes during C2C12 cells differentiation. • MiR-374b negatively regulates C2C12 cells differentiation.
A lower limit on the surface C-12/C-13 ratio in Alpha Orionis
Gautier, T. N., III; Fink, U.; Larson, H. P.; Thompson, R. I.
1976-01-01
The second overtone CO bands near 1.6 microns were analyzed in Alpha Ori using synthetic spectra. No firm identification of (C-13)O was made, which allowed a lower limit of 20 to be set on the C-12/C-13 ratio. A rather low microturbulent velocity of 2 km/s was found to match the spectrum of Alpha Ori best.
CO2 and 12C:13C Isotopic Ratios on Phoebe and Iapetus
Clark, R. N.; Brown, R. H.; Cruikshank, D. P.
2016-12-01
Cassini VIMS has obtained spatially resolved 0.35 to 5.1 micron reflectance spectra of Saturn's satellites beginning with the Phoebe fly-by in 2004 and a close fly-by of Iapetus in 2007. Both surfaces contain relatively abundant CO2. The new (2016 RC19) calibration of VIMS has provided a significant increase in the data quality, such that isotopic absorption bands in CO2 are now well defined. CO2 on Saturn's icy satellites is trapped (Cruikshank et al., 2010, Icarus v206 p561; Pinilla-Alonso et al. 2011, Icarus v211, p75i), predominantly in the dark material (Clark et al. 2012, Icarus v218 p831). Clark et al. modeled the CO2 abundance as 2.8% on Iapetus and 3.7% on Phoebe. The main 12CO2 band in VIMS spectra on Iapetus occurs at 4.253 microns and Phoebe at 4.266 microns. The 13CO2 absorption is strong on Phoebe at 4.367 microns and weak on Iapetus at 4.387 microns. Converting the Phoebe, Iapetus, and a lab reflectance spectrum (of trace H2O-CO2 mixture on a diffuse substrate), we derive preliminary values for the ratio of the equivalent widths of the 12C and 13C absorptions as 19±2 on Phoebe, 82±8 on Iapetus, and 98±10 for the laboratory spectrum. These ratios are related to the 12C/13C ratio, but there may be effects due to intra-molecular and inter-molecular coupling that will contribute to systematic errors in the isotopic abundances derived using equivalent-width measurements that we've yet to quantify. We Believe the effects are small, and will be attempting to quantify them in the future. For comparison, the terrestrial value of the 12C/13C ratio is 90.17, and vibrational coupling may explain the slightly high lab mixture result. The local interstellar medium is 69±15 (Boogert et al., 2000, A&A). Because the CO2 bands on Phoebe and Iapetus dark material have different positions, and because the observed 13C absorption strengths are so different, the surface evolutions must be different. The large enrichment in 13C on Phoebe argues for significant
Study of the excited levels of 11C and 12C by the analysis of protons induced reactions
International Nuclear Information System (INIS)
Rihet, Y.
1984-07-01
The present work is a study of 11 and 12 C excited states by reactions of non polarised protons on 10 B and 11 B. R-matrix analysis of the 10 B excitation curves in the range E p = 0 to 8 MeV was used to establish parameters of 41 levels in 11 C. Isobaric multiplets of T = 1/2 and T = 3/2 states in A = 11 nuclei are deduced. Analysis of 11 B excitation curves in the E p = 0.5 to 7.4 MeV range led to parameter values of 60 levels in 12 C. T = 1 states in A = 12 isobaric nuclei are discussed [fr
Synthesis of 14C analogue of 1,2-diaryl-[2-14C]-pyrroles
International Nuclear Information System (INIS)
Saemian, N.; Shirvani, G.; Matloubi, H.
2007-01-01
Three 1,2-diaryl pyrroles selective COX-2 inhibitors, 2-(4-fluorophenyl)-5-methyl-1-(4-methylsulfonyl-phenyl)-1H pyrrole, 2-(4-fluorophenyl)-1- [4-(methylsulfonyl) phenyl]-1H-pyrrole and 4-[2-(4-fluorophenyl)-1H-pyrrol-1-yl]benzenesulfon-amide, all three labeled with 14 C in the 2-position were prepared from para-fluoro-benzaldehyde-[carbonyl- 14 C]. (author)
Henning, Marcus A; Hawken, Susan; MacDonald, Joanna; McKimm, Judy; Brown, Menna; Moriarty, Helen; Gasquoine, Sue; Chan, Kwong; Hilder, Jo; Wilkinson, Tim
2017-09-01
To establish the most effective approach and type of educational intervention for health professional students, to enable them to maintain a professionally safe online presence. This was a qualitative, multinational, multi-institutional, multiprofessional study. Practical considerations (availability of participants) led us to use a combination of focus groups and individual interviews, strengthening our findings by triangulating our method of data collection. The study gathered data from 57 nursing, medical and paramedical students across four sites in three countries (Aotearoa/New Zealand, Australia and Wales). A content analysis was conducted to clarify how and why students used Facebook and what strategies they thought might be useful to ensure professional usage. A series of emergent codes were examined and a thematic analysis undertaken from which key themes were crystallized. The results illuminated the ways in which students use social networking sites (SNS). The three key themes to emerge from the data analysis were negotiating identities, distancing and risks. Students expressed the wish to have material about professional safety on SNS taught to them by authoritative figures to explain "the rules" as well as by peers to assist with practicalities. Our interactive research method demonstrated the transformative capacity of the students working in groups. Our study supports the need for an educational intervention to assist health professional students to navigate SNS safely and in a manner appropriate to their future roles as health professionals. Because health professional students develop their professional identity throughout their training, we suggest that the most appropriate intervention incorporate small group interactive sessions from those in authority, and from peers, combined with group work that facilitates and enhances the students' development of a professional identity.
Okumoto, K.; Shimozawa, N.; Kawai, A.; Tamura, S.; Tsukamoto, T.; Osumi, T.; Moser, H.; Wanders, R. J.; Suzuki, Y.; Kondo, N.; Fujiki, Y.
1998-01-01
Rat PEX12 cDNA was isolated by functional complementation of peroxisome deficiency of a mutant CHO cell line, ZP109 (K. Okumoto, A. Bogaki, K. Tateishi, T. Tsukamoto, T. Osumi, N. Shimozawa, Y. Suzuki, T. Orii, and Y. Fujiki, Exp. Cell Res. 233:11-20, 1997), using a transient transfection assay and
STEM professional volunteers in K-12 competition programs: Educator practices and impact on pedagogy
Zintgraff, Alfred Clifton
This mixed methods dissertation study explored how secondary school educators in specific K-12 competition programs recruited and deployed STEM professional volunteers. The study explored which practices were viewed as most important, and how practices related to constructivist pedagogy, all from the viewpoint of educators. The non-positivist approach sought new knowledge without pursuing generalized results. Review of the literature uncovered extensive anecdotal information about current practices, and suggested that large investments are made in engaging volunteers. One National Science Foundation-sponsored study was identified, and its recommendations for a sustained research agenda were advanced. Three study phases were performed, one to explore practices and operationalize definitions, a second to rate practice's importance and their relation to pedagogy, and a third to seek explanations. Educators preferred recruiting local, meaning recruiting parents and former students, versus from industry or other employers. Most educators preferred volunteers with mentoring skills, and placing them in direct contact with students, versus deploying volunteers to help with behind-the-scenes tasks supporting the educator. Relationships were identified between the highest-rated practices and constructivism in programs. In STEM professional volunteers, educators see affordances, in the same way a classroom tool opens affordances. A model is proposed which shows educators considering practicality, pedagogy, knowledge and skills, and rapport when accessing the affordances opened by STEM professional volunteers. Benefits are maximized when programs align with strong industry clusters in the community.
HeLa DNA damage response induced by 12C6+ ions
International Nuclear Information System (INIS)
Chen Jidong; Li Ning; Zhang Hong; Wu Zhenhua
2009-01-01
The aim of this study is to explore the DNA damage response of HeLa irradiated by 12 C 6+ beam and the mechanism of the p53 activation change in this response.In our present study, double strands break(DSB)of HeLa cells irradiated with 12 C 6+ beam were detected through neutral single cell gel electrophoresis, and AO/EB staining was used to detect the apoptosis of irradiated HeLa in 24h irradiation. Moreover, HeLa was pre-treated with caffeine (ATM and ATR inhibiting) or wormannin with certain concentrations (20 μmol/L, ATM and DNA-PK inhibiting) and irradiated with 1Gy of 12 C 6+ beam,and the expression of p53 was detected with Western blot analysis. The results show that DSB of HeLa caused by 12 C 6+ beam increases with absorbed doses and decreases with the time after irradiation. The apoptosis percentage of irradiated HeLa increases with absorbed doses. It has been found that the p53 expression increases after irradiation, but has not significant increment with caffeine or wortmannin pre-treatment in cells.It can be deduced that the p53 activation is ATM-dependent, but not ATR and DNA-PK-dependent in HeLa DNA damage response induced by 12 C 6+ beam. (authors)
Energy and macronutrient intakes of professional football (soccer) players.
Maughan, R J
1997-01-01
OBJECTIVE: To examine the dietary habits of professional soccer players at two Scottish Premier League clubs during the competitive season. METHODS: A study of the dietary intake of 51 professional soccer players with two different clubs was carried out by the seven day weighed intake method. RESULTS: Physical characteristics of the two groups of players were similar, with only small differences in age and body mass but no difference in height and body fat. Mean (SD) daily energy intake for c...
Energy Technology Data Exchange (ETDEWEB)
Roche, G.; Koontz, R.; Mulera, T.; Pugh, H.G.; Schroeder, L.S. (Lawrence Berkeley Lab., CA (USA)); Hallman, T.; Madansky, L. (Johns Hopkins Univ., Baltimore, MD (USA)); Carroll, J. (California Univ., Los Angeles (USA)); Chang, C.C. (Maryland Univ., College Park (USA)); Kirk, P.N.
1985-06-24
A particle-gamma coincidence experiment has been performed with a 2.1 GeV per nucleon /sup 12/C beam from the Bevalac. Data were taken with C and Pb targets. The ..gamma..-ray spectra are almost independent of the energy or the kind of charged particles detected in coincidence, mainly protons and deuterons. These ..gamma..-ray spectra are interpreted as resulting from ..pi../sup 0/ decay, and are consistent with known ..pi../sup 0/ production rates. A search for a possible decay of singly-charged anomalons into a gamma and a deuteron (or unbound proton-neutron system) has been done by studying the ..gamma..p and ..gamma..d invariant mass distributions. The upper limits for such a process are found to be 2 to 20% of the deuteron production rate, for anomalon masses for 200 to 400 MeV above the deuteron mass, with an anomalon mean lifetime of up to 10/sup -9/ s, depending on which kind of decay process is considered.
Current and Future Tests of the Algebraic Cluster Model of12C
Gai, Moshe
2017-07-01
A new theoretical approach to clustering in the frame of the Algebraic Cluster Model (ACM) has been developed. It predicts, in12C, rotation-vibration structure with rotational bands of an oblate equilateral triangular symmetric spinning top with a D 3h symmetry characterized by the sequence of states: 0+, 2+, 3-, 4±, 5- with a degenerate 4+ and 4- (parity doublet) states. Our newly measured {2}2+ state in12C allows the first study of rotation-vibration structure in12C. The newly measured 5- state and 4- states fit very well the predicted ground state rotational band structure with the predicted sequence of states: 0+, 2+, 3-, 4±, 5- with almost degenerate 4+ and 4- (parity doublet) states. Such a D 3h symmetry is characteristic of triatomic molecules, but it is observed in the ground state rotational band of12C for the first time in a nucleus. We discuss predictions of the ACM of other rotation-vibration bands in12C such as the (0+) Hoyle band and the (1-) bending mode with prediction of (“missing 3- and 4-”) states that may shed new light on clustering in12C and light nuclei. In particular, the observation (or non observation) of the predicted (“missing”) states in the Hoyle band will allow us to conclude the geometrical arrangement of the three alpha particles composing the Hoyle state at 7.6542 MeV in12C. We discuss proposed research programs at the Darmstadt S- DALINAC and at the newly constructed ELI-NP facility near Bucharest to test the predictions of the ACM in isotopes of carbon.
Hepatitis C treatment among racial and ethnic groups in the IDEAL trial.
Muir, A J; Hu, K-Q; Gordon, S C; Koury, K; Boparai, N; Noviello, S; Albrecht, J K; Sulkowski, M S; McCone, J
2011-04-01
Previous studies of chronic hepatitis C virus (HCV) treatment have demonstrated variations in response among racial and ethnic groups including poorer efficacy rates among African American and Hispanic patients. The individualized dosing efficacy vs flat dosing to assess optimaL pegylated interferon therapy (IDEAL) trial enrolled 3070 patients from 118 United States centres to compare treatment with peginterferon (PEG-IFN) alfa-2a and ribavirin (RBV) and two doses of PEG-IFN alfa-2b and RBV. This analysis examines treatment response among the major racial and ethnic groups in the trial. Overall, sustained virologic response (SVR) rates were 44% for white, 22% for African American, 38% for Hispanic and 59% for Asian American patients. For patients with undetectable HCV RNA at treatment week 4, the positive predictive value of SVR was 86% for white, 92% for African American, 83% for Hispanic and 89% for Asian American patients. The positive predictive values of SVR in those with undetectable HCV RNA at treatment week 12 ranged from 72% to 81%. Multivariate regression analysis using baseline characteristics demonstrated that treatment regimen was not a predictor of SVR. Despite wide-ranging SVR rates among the different racial and ethnic groups, white and Hispanic patients had similar SVR rates. In all groups, treatment response was largely determined by antiviral activity in the first 12 weeks of treatment. Therefore, decisions regarding HCV treatment should consider the predictive value of the early on-treatment response, not just baseline characteristics, such as race and ethnicity. © 2010 Blackwell Publishing Ltd.
Involving Practicing Scientists in K-12 Science Teacher Professional Development
Bertram, K. B.
2011-12-01
The Science Teacher Education Program (STEP) offered a unique framework for creating professional development courses focused on Arctic research from 2006-2009. Under the STEP framework, science, technology, engineering, and math (STEM) training was delivered by teams of practicing Arctic researchers in partnership with master teachers with 20+ years experience teaching STEM content in K-12 classrooms. Courses based on the framework were offered to educators across Alaska. STEP offered in-person summer-intensive institutes and follow-on audio-conferenced field-test courses during the academic year, supplemented by online scientist mentorship for teachers. During STEP courses, teams of scientists offered in-depth STEM content instruction at the graduate level for teachers of all grade levels. STEP graduate-level training culminated in the translation of information and data learned from Arctic scientists into standard-aligned lessons designed for immediate use in K-12 classrooms. This presentation will focus on research that explored the question: To what degree was scientist involvement beneficial to teacher training and to what degree was STEP scientist involvement beneficial to scientist instructors? Data sources reveal consistently high levels of ongoing (4 year) scientist and teacher participation; high STEM content learning outcomes for teachers; high STEM content learning outcomes for students; high ratings of STEP courses by scientists and teachers; and a discussion of the reasons scientists indicate they benefited from STEP involvement. Analyses of open-ended comments by teachers and scientists support and clarify these findings. A grounded theory approach was used to analyze teacher and scientist qualitative feedback. Comments were coded and patterns analyzed in three databases. The vast majority of teacher open-ended comments indicate that STEP involvement improved K-12 STEM classroom instruction, and the vast majority of scientist open-ended comments
Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.
Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf
2016-01-01
Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for
Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups
Directory of Open Access Journals (Sweden)
Carol Melody
2016-09-01
Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2
Indiana University High Energy Physics Group, Task C
International Nuclear Information System (INIS)
Heinz, R.M.; Mufson, S.L.; Musser, J.
1991-01-01
The Indiana University High Energy Physics Group, Task C has been actively involved in the MACRO experiment at Gran Sasso and the SSC experiment L during the current contract year. MACRO is a large US-Italian Monopole, Astrophysics, and Cosmic Ray Observatory being built under the Gran Sasso Mountain outside of Rome. Indiana University is in charge of organizing the United States software effort. We have built a state-of-the-art two-meter spectrophotometer for the MACRO liquid scintillator. We are in charge of ERP, the Event Reconstruction Processor online trigger processor for muons and stellar collapse. We are designing an air Cerenkov array to be placed on top of the Gran Sasso. Our other activity involves participation in the SSC experiment L. As long-standing members of L we have done proposal writing and have worked on important L planning and organization matters. We are now doing development work on the L Central Tracker straw drift tubes, including gas optimization, readout, and Monte Carlos. 12 refs., 20 figs., 1 tab
Indiana University High Energy Physics Group, Task C
Energy Technology Data Exchange (ETDEWEB)
Heinz, R.M.; Mufson, S.L.; Musser, J.
1991-01-01
The Indiana University High Energy Physics Group, Task C has been actively involved in the MACRO experiment at Gran Sasso and the SSC experiment L during the current contract year. MACRO is a large US-Italian Monopole, Astrophysics, and Cosmic Ray Observatory being built under the Gran Sasso Mountain outside of Rome. Indiana University is in charge of organizing the United States software effort. We have built a state-of-the-art two-meter spectrophotometer for the MACRO liquid scintillator. We are in charge of ERP, the Event Reconstruction Processor online trigger processor for muons and stellar collapse. We are designing an air Cerenkov array to be placed on top of the Gran Sasso. Our other activity involves participation in the SSC experiment L. As long-standing members of L we have done proposal writing and have worked on important L planning and organization matters. We are now doing development work on the L Central Tracker straw drift tubes, including gas optimization, readout, and Monte Carlos. 12 refs., 20 figs., 1 tab.
Teachers' Professional Development: The Case of WhatsApp
Cansoy, Ramazan
2017-01-01
In this study, the kinds of shares made by science teachers in a WhatsApp group as an online community of practice to support professional development were examined. The netnographic research method, one of the qualitative research methods, was used in the study. The messages shared by 12 science teachers, who worked at a private school between…
Phase-shift-analysis approach to elastic neutron scattering from /sup 12/C between 9 and 12 MeV
Energy Technology Data Exchange (ETDEWEB)
Tornow, W. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Walter, R.L.; Byrd, R.C. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))
1985-03-01
The excitation energy, spin and parity of levels in /sup 13/C have been determined for excitation energies between 13 and 16 MeV via a phase-shift analysis of the measured total cross section, elastic differential cross section and analysing power for n + /sup 12/C in the neutron energy range from 8.9 to 12.0 MeV. New analysing power measurements are reported for this energy range. The present and previous experimental data are well described by the phase shifts obtained. The non-elastic cross section for n + /sup 12/C predicted from the phase shifts is in good agreement with the ENDF/B-V evaluation. The need for further experimental data is pointed out.
Changes in vegetation phenology are not reflected in atmospheric CO2 and 13 C/12 C seasonality.
Gonsamo, Alemu; D'Odorico, Petra; Chen, Jing M; Wu, Chaoyang; Buchmann, Nina
2017-10-01
Northern terrestrial ecosystems have shown global warming-induced advances in start, delays in end, and thus increased lengths of growing season and gross photosynthesis in recent decades. The tradeoffs between seasonal dynamics of two opposing fluxes, CO 2 uptake through photosynthesis and release through respiration, determine the influence of the terrestrial ecosystem on the atmospheric CO 2 and 13 C/ 12 C seasonality. Here, we use four CO 2 observation stations in the Northern Hemisphere, namely Alert, La Jolla, Point Barrow, and Mauna Loa Observatory, to determine how changes in vegetation productivity and phenology, respiration, and air temperature affect both the atmospheric CO 2 and 13 C/ 12 C seasonality. Since the 1960s, the only significant long-term trend of CO 2 and 13 C/ 12 C seasonality was observed at the northern most station, Alert, where the spring CO 2 drawdown dates advanced by 0.65 ± 0.55 days yr -1 , contributing to a nonsignificant increase in length of the CO 2 uptake period (0.74 ± 0.67 days yr -1 ). For Point Barrow station, vegetation phenology changes in well-watered ecosystems such as the Canadian and western Siberian wetlands contributed the most to 13 C/ 12 C seasonality while the CO 2 seasonality was primarily linked to nontree vegetation. Our results indicate significant increase in the Northern Hemisphere soil respiration. This means, increased respiration of 13 C depleted plant materials cancels out the 12 C gain from enhanced vegetation activities during the start and end of growing season. These findings suggest therefore that parallel warming-induced increases both in photosynthesis and respiration contribute to the long-term stability of CO 2 and 13 C/ 12 C seasonality under changing climate and vegetation activity. The summer photosynthesis and the soil respiration in the dormant seasons have become more vigorous which lead to increased peak-to-through CO 2 amplitude. As the relative magnitude of the increased
12 CFR Appendix C to Part 360 - Deposit File Structure
2010-01-01
.... • STATE = State government. • COMM = Commercial. • CORP = Corporate. • BANK = Bank Owned. • DUE TO = Other... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Deposit File Structure C Appendix C to Part 360... RESOLUTION AND RECEIVERSHIP RULES Pt. 360, App. C Appendix C to Part 360—Deposit File Structure This is the...
Measurement of the natural variation of 13C/12C isotope ratio in organic samples
International Nuclear Information System (INIS)
Ducatti, C.
1977-01-01
The isotopic ratio analysis for 13 C/ 12 C by mass spectrometry using a 'Working standard' allows the study of 13 C natural variation in organic material, with a total analytical error of less than 0,2%. Equations were derived in order to determine 13 C/ 12 C and 18 O/ 16 O ratios related to the 'working standard' CENA-std and to the international standard PDB. Isotope ratio values obtained with samples prepared in two different combustion apparatus were compared; also the values obtained preparing samples by acid decomposition of carbonaceous materials were compared with the values obtained in different international laboratories. Utilizing the methodology proposed, several leaves collected at different heights of different vegetal species, found 'inside' and 'outside' of the Ducke Forest Reserve, located in the Amazon region, are analysed. It is found that the 13 C natural variation depends upon metabolic process and environmental factors, both being factors which may be qualified as parcial influences on the CO 2 cycle in the forest. (author) [pt
Vassbotn, F S; Skar, R; Holmsen, H; Lillehaug, J R
1992-09-01
The effect of platelet-derived growth factor (PDGF) on c-fos mRNA transcription was studied in the immortalized mouse embryo fibroblast C3H/10T1/2 Cl 8 (10T1/2) cells and the chemically transformed, tumorigenic subclone C3H/10T1/2 Cl 16 (Cl 16). In the 10T1/2 cells as well as the Cl 16 subclone, the dose-dependent PDGF stimulation of c-fos mRNA synthesis was similar in both logarithmically growing and confluent cultures. c-fos mRNA was induced severalfold by 12-O-tetradecanoylphorbol-13-acetate (TPA) in both 10T1/2 and Cl 16. Down-regulation of protein kinase C (PKC) activity by TPA pretreatment inhibited PDGF-stimulated c-fos mRNA expression in Cl 16 cells but did not affect this induction in the 10T1/2 cells. This inhibition was not a general phenomenon of 3-methylcholanthrene-mediated transformation of 10T1/2 cells since experiments with another transformed 10T1/2 cell clone, C3H/10T1/2 TPA 482, gave qualitatively the same results as the 10T1/2 cells. Receptor binding experiments showed that the nontransformed and transformed cells had a comparable number of PDGF receptors, 1.3 x 10(5) and 0.7 x 10(5) receptors per cell, respectively. Furthermore, cAMP-induced c-fos expression induced by forskolin is formerly shown to be independent of PKC down-regulation. In our experiments, forskolin induced c-fos expression in both clones. However, PKC down-regulation inhibited the forskolin-induced c-fos expression in Cl 16 cells. This apparently demonstrates cross talk between PKC and PKA in the c-fos induction pathway. The present results provide evidence for an impaired mechanism for activating c-fos expression through PKC-independent, PDGF-induced signal transduction in the chemically transformed Cl 16 fibroblasts compared to that in nontransformed 10T1/2 cells.
Katritzky, Alan R; Jain, Ritu; Xu, Yong-Jiang; Steel, Peter J
2002-11-15
Condensation reactions of benzotriazole and 2-(pyrrol-1-yl)-1-ethylamine (1) with formaldehyde and glutaric dialdehyde, respectively, afforded intermediates 2 and 6. Subsequent nucleophilic substitutions of the benzotriazole group in 2 and 6 with Grignard reagents, sodium cyanide, and sodium borohydride gave 1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazines 3a-e, 4, 5 and 5,6,9,10,11,11a-hexahydro-8H-pyrido[1,2-a]pyrrolo[2,1-c]pyrazines 7a-c, 8, 9, respectively, in good yields.
Crippen, Kent J.; Ellis, Shari; Dunckel, Betty A.; Hendy, Austin J. W.; MacFadden, Bruce J.
2016-01-01
This study sought to define the attributes and practices of organized fossil groups (e.g., clubs, paleontological societies) as amateur paleontologists, as well as those of professional paleontologists, and explore the potential for these two groups to work collaboratively as a formalized community. Such an investigation is necessary to develop…
Counseling Group Curriculum for Parents on Bullying
Lamanna, John; Shillingford, M. Ann; Parrish, Mary-Frances; Sheffield, Rebecca
2010-01-01
This article discusses the impact of bullying on K-12 students and the importance of collaborative partnerships between home and school in decreasing the dramatic effects of student bullying behaviors. The authors present a six-week, research-based, small group curriculum specifically developed for professional school counselors to support parents…
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Energy Technology Data Exchange (ETDEWEB)
Burnereau, N
1975-01-01
The /sup 16/O+/sup 12/C..-->../sup 12/C+..cap alpha..+/sup 12/C reaction is studied mainly at 46MeV (at this energy a state of /sup 28/Si is presumably formed with a spin value of 14/sup +/; resonance of 19.7MeV c.m.). The motivation is to detect an ..cap alpha.. particle with a negligible energy in the c.m. system. This is the signature of the preformation of three aligned clusters in which the average location of the ..cap alpha.. particle is in between the two /sup 12/C's at the center of symmetry of the system. Such a detection is performed by detecting two /sup 12/C's in coincidence at specific angles. The data are understood by three-body calculations with a coupling of relative angular momenta governed by an unique J value. Experimentally, an ..cap alpha.. energy of 200keV is measured with good statistics, supporting the idea of aligned clusters as /sup 28/Si intrinsic shape, related to some highly excited states.
Ahmadi-Motamayel, Fatemeh; Vaziri-Amjad, Samaneh; Goodarzi, Mohammad Taghi; Poorolajal, Jalal
2017-01-01
Saliva is a complex oral biologic fluid secreted by major and minor salivary glands. Saliva has immunological, enzymatic and antioxidant defense mechanisms. Infection with human immunodeficiency virus (HIV) is a life-threatening disease. The aim of this study was to evaluate salivary vitamin C and catalase levels in HIV-positive patients in comparison to a healthy control group. Forty-nine HIV-infected individuals and 49 healthy subjects were selected. Five mL of unstimulated saliva was collected in 5 minutes using a sterilized Falcon tube with Navazesh method. Catalase and vitamin C levels were assessed by spectrophotometric assay. Data were analyzed with STATA 12. Salivary catalase levels were 7.99±2.40 and 8.37±1.81 in the case and control groups, respectively. Catalase level was lower in the case group but the difference was not statistically significant (P=0.380). Salivary vitamin C levels in the case and control groups were 3.76±1.92 and 4.87±2.20, respectively (P=0.009). HIV can alter salivary antioxidant capacity as well as vitamin C and catalase levels. Saliva may reflect serum antioxidative changes in these patients. Therefore, further research is necessary on salivary and serum oxidants and the antioxidant changes. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
Oracle database 12c the complete reference
Bryla, Bob
2014-01-01
Maintain a scalable, highly available enterprise platform and reduce complexity by leveraging the powerful new tools and cloud enhancements of Oracle Database 12c. This authoritative Oracle Press guide offers complete coverage of installation, configuration, tuning, and administration. Find out how to build and populate Oracle databases, perform effective queries, design applications, and secure your enterprise data
Delta Electroproduction in 12-C
Energy Technology Data Exchange (ETDEWEB)
McLauchlan, Steven [Univ. of Glasgow, Scotland (United Kingdom)
2003-01-01
The Δ-nucleus potential is a crucial element in the understanding of the nuclear system. Previous electroexcitation measurements in the delta region reported a Q2 dependence of the Δ mass indicating that this potential is dependent on the momentum of the Δ. Such a dependence is not observed for protons and neutrons in the nuclear medium. This thesis presents the experimental study of the electroexcitation of the Δ resonance in 12C, performed using the high energy electron beam at the Thomas Jefferson National Accelerator Facility, and the near 4π acceptance detector CLAS that enables the detection of the full reaction final state. Inclusive, semi inclusive, and exclusive cross sections were measured with an incident electron beam energy of 1.162GeV over the Q2 range 0.175-0.475 (GeV/c)2. A Q2 dependence of the Δ mass was only observed in the exclusive measurements indicating that the Δ-nucleus potential is affected by the momentum of the Δ.
Recombinant myostatin reduces highly expressed microRNAs in differentiating C2C12 cells
Directory of Open Access Journals (Sweden)
Zachary A. Graham
2017-03-01
Full Text Available Myostatin is small glycopeptide that is produced and secreted by skeletal muscle. It is a potent negative regulator of muscle growth that has been associated with conditions of frailty. In C2C12 cells, myostatin limits cell differentiation. Myostatin acts through activin receptor IIB, activin receptor-like kinase (ALK and Smad transcription factors. microRNAs (miRNA are short, 22 base pair nucleotides that bind to the 3′ UTR of target mRNA to repress translation or reduce mRNA stability. In the present study, expression in differentiating C2C12 cells of the myomiRs miR-1 and 133a were down-regulated following treatment with 1 µg of recombinant myostatin at 1 d post-induction of differentiation while all myomiRs (miR-1, 133a/b and 206 were upregulated by SB431542, a potent ALK4/5/7 inhibitor which reduces Smad2 signaling, at 1 d and all, with the exception of miR-206, were upregulated by SB431542 at 3 d. The expression of the muscle-enriched miR-486 was greater following treatment with SB431542 but not altered by myostatin. Other highly expressed miRNAs in skeletal muscle, miR-23a/b and 145, were altered only at 1 d post-induction of differentiation. miR-27b responded differently to treatments at 1 d, where it was upregulated, as compared to 3 d, where it was downregulated. Neither myostatin nor SB431542 altered cell size or cell morphology. The data indicate that myostatin represses myomiR expression in differentiating C2C12 cells and that inhibition of Smad signaling with SB431542 can result in large changes in highly expressed miRNAs in differentiating myoblasts.
Pérez Andrés, Cristina; Alameda Cuesta, Almudena; Albéniz Lizarraga, Carmen
2002-01-01
In the nursing schools, the contrast between what is taught in the classrooms and what is practiced at the health care centers usually creates a great deal of confusion on the part of the students. The objective of this research is to ascertain the opinion of the students and of the professionals at the health care centers where they are doing their training with regard thereto in order to detect their problems and see what differences exist between primary and specialized care. This research was conducted throughout the first half of 2000 employing qualitative methodology, by means of four discussion groups comprised of students, former students, primary care training advisors and nursing professionals at the hospitals where the students of the school in question are doing their nursing training. The initial involvement employed was indirect. The comments of the nursing students and of their training advisors with regard to the practice nursing during the diploma studies reveal dissatisfaction on the part of both of these groups. In all of the groups point out anxiety as the leading factor involved in their teaching as well as learning activities and during professional training. The lack of identification as a group of professionals seems to be related to the lack of recognition on the part of the others, the demand for a degree being granted for their college studies and for the setting up of specialities would contribute to their social recognition and, as a result thereof, to their identification as a professional group. Until a solution is provided to the anxiety which the nursing professionals feel with regard to their professional practice, which they pass on to their students during nursing training, it will not be possible to achieve a higher degree of satisfaction with nursing training experiences either on the part of the training advisors or on the part of the students.
Finkelstein, Keely; Hemenway, Mary Kay; Sneden, Chris; Lacy, John; Richter, Matthew J.; EXES Teacher Associates
2018-01-01
The Astronomy Department and McDonald Observatory at the University of Texas at Austin has and continues to offer a suite of different astronomy based K-12 teacher professional development programs. One of our longest running, and most successful programs, is reaching its 20th anniversary, the EXES Teacher Associate Program, which was started in 1998. The EXES Teacher Associate program features sustained and continued professional development opportunities for K-12 science and math educators. It consists of 6 times per year day-long meetings, coupled with other professional development opportunities provided at various times. In total, there are approximately 30 active members of the group currently, but more than 90 teachers have participated in this group over its 20 year history. The program has had astronomy education as its focus throughout its history, but different partnerships and collaborations with other programs have supported the group and have allowed for a variety of professional development opportunities and themes for educators to engage in. We will give an overview of this program, present evaluation data and teacher feedback related to program success and student impact, and highlight a few specific program opportunities that are unique and have been shown to be most impactful for participants.
Energy Technology Data Exchange (ETDEWEB)
Woye, E.; Tornow, W.; Mack, G. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Floyd, C.E.; Guss, P.P.; Murphy, K.; Byrd, R.C.; Wender, S.A.; Walter, R.L. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))
1983-02-01
The analyzing power Asub(..gamma..)(theta) for /sup 12/C(n,n)/sup 12/C elastic scattering and for inelastic scattering to the first excited state (Jsup(..pi..) = 2/sup +/, Q = -4.44 MeV) of /sup 12/C was measured in the energy range from 8.9 to 14.9 MeV in 1 MeV steps. A pulsed polarized neutron beam was produced via the /sup 2/H(d vector,n vector)/sup 3/He polarization transfer reaction. Monte Carlo simulations were used to correct the data for finite geometry and multiple scattering effects. The Asub(..gamma..) data, together with publsihed cross-section data, were analyzed in the framework of the spherical optical model and in the coupled-channels formalism. A good description of the data has been achieved.
Hadavi, Mahvash; Hasannia, Sadegh; Faghihi, Shahab; Mashayekhi, Farhad; Homazadeh, Homayoun; Mostofi, Seyed Behrooz
2018-01-26
Zein nanoparticles as a carrier system for BMP6-derived peptide were prepared by liquid-liquid phase separation procedure and characterized with SEM, DLS, FTIR and thermogravimetric methods. After peptide encapsulation, nanoparticle size increased from 236.3 ± 92.2 nm to 379.4 ± 116.8 nm. The encapsulation efficiency of peptide was 72.6% and the release of peptide from Zein nanoparticles was partly sustained in trypsin containing phosphate buffered saline (pH 7.4) for up to 14 days. Peptide-loaded nanoparticles showed similar cell viability compared with blank ones. ALP activity of C2C12 cells treated with peptide-loaded nanoparticles (500 µg/mL) was evaluated 7, 14, 21 and 28 days after culture. In peptide-loaded nanoparticles, ALP activity was significantly higher (p < .05) compared with other groups at day 14. Alizarin Red S staining showed, C2C12 cells behind peptide-loaded nanoparticles had significantly (p < .05) higher calcium deposition at day 21. The results of RT-qPCR show that the BMP-6 peptide activated expression of RUNX2 as a transcription factor. In turn, RUNX2 regulates SPP1 and BGLAP gene expression, as osteogenic marker genes. The results confirm that the peptide-loaded Zein nanoparticles, as osteoinductive material, may be used to repair small area of bone defects, with low load bearing.
Research Award: Policy and Planning Group (PPG) Deadline: 12 ...
International Development Research Centre (IDRC) Digital Library (Canada)
Jean-Claude Dumais
2012-09-12
Sep 12, 2012 ... mentorship in research, research management, and grant administration allows research awardees to pursue their research goals in a dynamic team environment in one of the world's leaders in generating new knowledge to meet global challenges. The Policy and Planning Group (PPG) is responsible for ...
International Nuclear Information System (INIS)
Kulakov, B.A.; Karachuk, J.; Gelovani, L.K.; Gridnev, T.G.; Sosnin, A.N.; Brandt, R.
1998-01-01
Energetic secondary fragments produced in the interaction of (41-44) GeV 12 C ions with copper exhibit experimentally a broader angular distribution as compared to energetic secondary fragments produced in the interactions at a lower 12 C-energy (15-25) GeV when studied with radiochemical techniques. Such a different experimental behaviour of secondary fragments produced by 12 C ions of the same two energy groups is not observed, when these secondary fragments are investigated with a propane bubble chamber. Separation of secondary particles is described
Chemistry of group 9 dimetallaborane analogues of octaborane(12).
Barik, Subrat Kumar; Roy, Dipak Kumar; Ghosh, Sundargopal
2015-01-14
We report the synthesis, isolation and structural characterization of several moderately air stable nido-metallaboranes that represent boron rich open cage systems. The reaction of [Cp*CoCl]2, (Cp* = η(5)-C5Me5), with [BH3·thf] in toluene at ice cold temperature, followed by thermolysis in boiling toluene produced [(Cp*Co)B9H13], 1 [(Cp*Co)2B8H12], 2 and [(Cp*Co)2B6H10] 3. Building upon our earlier reactivity studies on rhodaboranes, we continue to explore the reactivity of dicobalt analogues of octaborane(12) cluster 3 with [Fe2(CO)9] and [Ru3(CO)12] at ambient conditions that yielded novel fused clusters [Fe2(CO)6(Cp*Co)2B6H10], 4 and [Ru4(CO)11(Cp*Co)2B3H3], 5 respectively. In an attempt to synthesize a heterometallic metallaborane compound we performed the reaction of [(Cp*Rh)2B6H10], 6 with [Cp*IrH4] that yielded a Ir-Ir double bonded compound [(Cp*Ir)2H3][B(OH)4], 7. All the new compounds have been characterized by IR, (1)H, (11)B, (13)C NMR spectroscopy, and the molecular structures were unambiguously established by X-ray diffraction analysis.
12 CFR 614.4267 - Professional association membership; competency.
2010-01-01
.... 614.4267 Section 614.4267 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM LOAN POLICIES AND OPERATIONS Collateral Evaluation Requirements § 614.4267 Professional association membership... real, personal, or intangible property taken as collateral in connection with extensions of credit must...
Directory of Open Access Journals (Sweden)
Friedmann Theodore
2009-08-01
Full Text Available Abstract Although much is known about signal transduction downstream of insulin-like growth factor-1 (IGF-1, relatively little is known about the global changes in protein expression induced by this hormone. In this study, the acute effects of IGF-1 on the proteome of murine C2C12 cells were examined. Cells were treated with IGF-1 for up to 24 hours, lysed, and fractionated into cytosolic, nuclear, and insoluble portions. Proteins from the cytosolic fraction were further separated using a new batch ion-exchange chromatography method to reduce sample complexity, followed by two-dimensional (2D electrophoresis, and identification of selected proteins by mass spectrometry. PDQuest software was utilized to identify and catalogue temporal changes in protein expression during IGF-1 stimulation. In response to IGF-1 stimulation, expression of 23 proteins increased at least three-fold and expression of 17 proteins decreased at least three-fold compared with control un-stimulated C2C12 cells. Changes in expression of selected proteins from each group, including Rho-GDI, cofillin, RAD50, enolase, IκB kinase b (IκBKb and Hsp70 were confirmed by Western blotting. Additionally, the position of 136 'landmark' proteins whose expression levels and physicochemical properties did not change appreciably or consistently during IGF-1 treatment were mapped and identified. This characterization of large-scale changes in protein expression in response to growth factor stimulation of C2C12 cells will further help to establish a comprehensive understanding of the networks and pathways involved in the action of IGF-1.
Amemiya, Kei; Meyers, Jennifer L; Trevino, Sylvia R; Chanh, Tran C; Norris, Sarah L; Waag, David M
2006-02-27
We evaluated the effect of interleukin (IL)-12 on the immune response to Burkholderia mallei in BALB/c mice. Mice were vaccinated with non-viable B. mallei cells with or without IL-12. There was a seven- to nine-fold increase in IgG2a levels, and a significant increase in the proliferative response and interferon (IFN)-gamma production by splenocytes from mice that received B. mallei and IL-12. We saw an increase in survivors in the groups of mice that received B. mallei and IL-12 when challenged, compared to mice that received only B. mallei or IL-12. The results suggest that IL-12 can enhance the Th1-like immune response to B. mallei and mediate limited protection from a lethal challenge.
Reflective practice as a tool to teach digital professionalism.
Kung, Justin W; Eisenberg, Ronald L; Slanetz, Priscilla J
2012-11-01
Digital professionalism is increasingly being integrated into postgraduate medical education. We developed a small-group, reflective practice-based session incorporating radiology-specific cases to heighten residents' awareness about digital professionalism. Case-based, radiology-specific scenarios were created for a small-group, reflective practice-based session on digital professionalism. Anonymous pre- and postsession surveys evaluating residents' use of social media and their thoughts about the session were administered to the radiology residents. Twenty-five of 38 (66%) residents responded to the presession survey with 40% (10/25) reporting daily social media use; 50% (12/24) witnessing an unprofessional posting on Facebook; and 8% (2/25) posting something unprofessional themselves. Of the 21 residents who attended the session, 13 (62%) responded to the postsession survey. Residents reported that the session added to their understanding of professionalism 3.92, 95% CI (3.57-4.27). As a result of the session, residents stated that they were more aware of protecting patient privacy and confidentiality on social media sites 3.92, 95% CI (3.47-4.37), and would take a more active role in ensuring professional use of social media as it relates to patient care 4.00, 95% CI (3.66-4.34). Residents favorably viewed the reflective case-based session on digital professionalism as a means to be more aware of ways to avoid unprofessional interactions on the internet. Our results suggest that such reflective sessions are an effective method to educate residents on key concepts regarding digital professionalism. Copyright © 2012 AUR. Published by Elsevier Inc. All rights reserved.
Functional aspects of dexamethasone upregulated nicotinic acetylcholine receptors in C2C12 myotubes
Maestrone, E; Lagostena, L; Henning, RH; DenHertog, A; Nobile, M
Three days of treatment with the glucocorticoid dexamethasone (1 nM-mu M) induced a concentration-dependent up-regulation of muscle nicotinic acetylcholine receptor (nAChR) in C2C12 mouse myotubes (EC(50)=10+/-7.3 nM), as assessed by [H-3]alpha-BuTx binding. The maximum increase in binding amounted
12 CFR 563c.3 - Qualification of public accountant.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Qualification of public accountant. 563c.3... REQUIREMENTS Form and Content of Financial Statements § 563c.3 Qualification of public accountant. (See also 17 CFR 210.2-01.) The term “qualified public accountant” means a certified public accountant or licensed...
Hutschemaekers, G.J.M.; Tiemens, B.G.; Kaasenbrood, A.J.A.
2005-01-01
Background Professional boundaries between psychiatrists and other mental health professionals are difficult to set. Empirical evidence for the distribution of diagnostic and treatment tasks among professionals is lacking. Aims This study examines the ‘collective sense of the profession’ about the
Spectroscopic information from (3He, 7Be) reaction on 12C and 24Mg
International Nuclear Information System (INIS)
Rahman, Md.A.; Sen Gupta, H.M.
1986-01-01
The reaction ( 3 He, 7 Be) on 12 C and 24 Mg has been analysed using four discrete potential families for 7 Be channel and one discrete potential family for 3 He channel to extract alpha spectroscopic factors. It is shown that the relative spectroscopic factors are reliable if they are calculated staying within one potential family (S( 24 Mg/ 12 C) approx. 0.12). But, changing the potential family between 12 C and 24 Mg, one obtains the extreme cases, such as S( 24 Mg/ 12 C) = 0.025 and 0.51, i.e. 1:20
Schneider, Lawrence J.; And Others
1979-01-01
Investigates community college students' perceptions of help-givers' characteristics and services. Student perceptions of professional helpers' characteristics and of professionals whom students were likely to consult concerning educational-vocational choices, intrapersonal concerns, and interpersonal problems varied in several ways. (Author)
The question of caution in professional medium
International Nuclear Information System (INIS)
Godard, O.
2006-01-01
Contrived in Europe to tackle the environment protection policies and management of natural resources, the principle of caution has seen since 1990 its interest developed towards the fields of food safety and public health. The importance and the relevance of questions have lead the national institute of research and safety to constitute a working group to explore the problems and the potentialities that could be linked to the explicit introduction of this principle and this in the field of the prevention of professional risks. This work tackles several aspects of the question of caution in professional medium such history, concepts, evolution...as well as cases judged exemplary ones. (N.C.)
7 CFR 3401.12 - Establishment and operation of peer review groups.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Establishment and operation of peer review groups... GRANTS PROGRAM Scientific Peer Review of Research Applications for Funding § 3401.12 Establishment and operation of peer review groups. Subject to § 3401.7, the Administrator will adopt procedures for the...
Physical fitness profile of professional Italian firefighters: differences among age groups.
Perroni, Fabrizio; Cignitti, Lamberto; Cortis, Cristina; Capranica, Laura
2014-05-01
Firefighters perform many tasks which require a high level of fitness and their personal safety may be compromised by the physiological aging process. The aim of the study was to evaluate strength (bench-press), power (countermovement jump), sprint (20 m) and endurance (with and without Self Contained Breathing Apparatus - S.C.B.A.) of 161 Italian firefighters recruits in relation to age groups (profile for each parameter and to assess differences (p < 0.05) among age groups. Anthropometric values showed an age-effect for height and BMI, while performances values showed statistical differences for strength, power, sprint tests and endurance test with S.C.B.A. Wearing the S.C.B.A., 14% of all recruits failed to complete the endurance test. We propose that the firefighters should participate in an assessment of work capacity and specific fitness programs aimed to maintain an optimal fitness level for all ages. Copyright © 2013 Elsevier Ltd and The Ergonomics Society. All rights reserved.
Independent AMP and NAD signaling regulates C2C12 differentiation and metabolic adaptation.
Hsu, Chia George; Burkholder, Thomas J
2016-12-01
The balance of ATP production and consumption is reflected in adenosine monophosphate (AMP) and nicotinamide adenine dinucleotide (NAD) content and has been associated with phenotypic plasticity in striated muscle. Some studies have suggested that AMPK-dependent plasticity may be an indirect consequence of increased NAD synthesis and SIRT1 activity. The primary goal of this study was to assess the interaction of AMP- and NAD-dependent signaling in adaptation of C2C12 myotubes. Changes in myotube developmental and metabolic gene expression were compared following incubation with 5-aminoimidazole-4-carboxamide ribonucleotide (AICAR) and nicotinamide mononucleotide (NMN) to activate AMPK- and NAD-related signaling. AICAR showed no effect on NAD pool or nampt expression but significantly reduced histone H3 acetylation and GLUT1, cytochrome C oxidase subunit 2 (COX2), and MYH3 expression. In contrast, NMN supplementation for 24 h increased NAD pool by 45 % but did not reduce histone H3 acetylation nor promote mitochondrial gene expression. The combination of AMP and NAD signaling did not induce further metabolic adaptation, but NMN ameliorated AICAR-induced myotube reduction. We interpret these results as indication that AMP and NAD contribute to C2C12 differentiation and metabolic adaptation independently.
Wästberg, Birgitta A; Sandström, Boel; Gunnarsson, Anna Birgitta
2018-02-01
There is a need for various types of interventions when meeting needs of clients with psychiatric disabilities and complementary interventions may also influence their well-being. The Culture and Health project, based on complementary interventions with 270 clients, was created in a county in Sweden for clients with psychiatric disabilities and for professionals to carry out the interventions. The aim of this study was to investigate the professionals' expectations regarding the project and their clients' possibilities for participating, and to investigate the professionals' experiences of the project after its completion. Focus group data with a total of 30 professionals participating were collected. A qualitative content analysis revealed four categories of the professionals' expectations before entering the project: "Clients' own possibilities and limitations for their development and independence", "Professionals' possibilities for supporting the clients", "Societal prerequisites", and "Expectations of a new way of working". Furthermore, the analysis regarding professionals' experiences after working with the project revealed three categories: "Adopting the challenges", "Having ways of working that function - prerequisites and possibilities", and "Meeting the future - an ambition to continue". Working in the Culture and Health project together with the clients in group-based activities was perceived as beneficial, although challenges arose. When implementing cultural activities, support from stakeholder organisations is needed. © 2017 Australian College of Mental Health Nurses Inc.
2010-01-01
... operating exclusively through the Internet. 7.5009 Section 7.5009 Banks and Banking COMPTROLLER OF THE... under 12 U.S.C. 85 of national banks operating exclusively through the Internet. For purposes of 12 U.S.C. 85, the main office of a national bank that operates exclusively through the Internet is the...
de Jong, Catharina C; Ros, Wynand Jg; van Leeuwen, Mia; Schrijvers, Guus
2016-11-24
Home-dwelling elderly patients with multimorbidity are at risk of fragmentation of care because of the many different professionals involved and a potentially unclear level of communication. Multidisciplinary communication seems to occur incidentally. Mutual feedback is needed for a professional team to provide consistent care and adequate support to the patient system. eHealth technology can improve outcomes. The aim of this study was to evaluate the use of a tool, Congredi, for electronic communication by professionals for the care of home-dwelling elderly patients. The research group was recruited through general practices and home care organizations. Congredi, a tool designed for multidisciplinary communication, was made available for professionals in primary care. It consists of a care plan and a communication channel (secure emailing). Professionals opened Congredi records for elderly patients who had 2 or more professionals involved. The records were the unit of analysis. Data were gathered from the Congredi system over a period of 42 weeks. An inclusion rate of 21.4% (203/950) was achieved; nearly half of the participants were nurses. During the study, professionals were active in 448 patient records; female professionals were prevalent. In the patient records, 3 types of actions (care activities, emailing, and process activities) were registered. Most activities occurred in the multidisciplinary records (mean 12.2), which had twice the number of activities of monodisciplinary records (6.35), and solo records had a mean of 3.43 activities. Most activities were care activities (mean 9.14), emailing had a mean of 0.89 activities, and process activities had a mean of 0.29. An e-communication tool (Congredi) was usable for improving multidisciplinary communication among professionals. It even seemed to yield results for 40% of the professionals who used the e-care plan on their own. The content of the tool provided an active communication practice, with
Integral measurement of the $^{12}$C(n,p)$^{12}$B reaction up to 10 GeV
Žugec, P; Bosnar, D; Ventura, A; Mengoni, A; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Brugger, M; Calviani, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Cortés, G; Cortés-Giraldo, M.A; Cosentino, L; Diakaki, M; Domingo-Pardo, C; Dressler, R; Duran, I; Eleftheriadis, C; Ferrari, A; Finocchiaro, P; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Guerrero, C; Gunsing, F; Gurusamy, P; Heinitz, S; Jenkins, D G; Jericha, E; Käppeler, F; Karadimos, D; Kivel, N; Kokkoris, M; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Meo, S Lo; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P; Mastromarco, M; Mendoza, E; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Musumarra, A; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T
2016-01-01
The integral measurement of the $^{12}$C(n,p)$^{12}$B reaction was performed at the neutron time of flight facility n_TOF at CERN. The total number of $^{12}$B nuclei produced per neutron pulse of the n_TOF beam was determined using the activation technique in combination with a time of flight technique. The cross section is integrated over the n_TOF neutron energy spectrum from reaction threshold at 13.6 MeV to 10 GeV. Having been measured up to 1 GeV on basis of the $^{235}$U(n,f) reaction, the neutron energy spectrum above 200 MeV has been reevaluated due to the recent extension of the cross section reference for this particular reaction, which is otherwise considered a standard up to 200 MeV. The results from the dedicated GEANT4 simulations have been used to evaluate the neutron flux from 1 GeV up to 10 GeV. The experimental results related to the $^{12}$C(n,p)$^{12}$B reaction are compared with the evaluated cross sections from major libraries and with the predictions of different GEANT4 models, which m...
Ahmed, Fathima
2018-03-07
The ever-evolving nature of nursing requires professionals to keep their knowledge up to date and uphold the Nursing and Midwifery Council (NMC) Code by engaging themselves in ongoing personal and professional development (PPD). This article aims to highlight the importance of good leadership and management in healthcare and to explore the literature surrounding leadership and management, such as the current NHS healthcare leadership model ( NHS Leadership Academy 2013 ), the Leading Change, Adding Value Framework underpinned by the 10 commitments and 6Cs ( NHS England 2016 ) and the NMC Code ( NMC 2015a ) in relation to PPD. It examines how nurses can be supported in their PPD by their team leader and or managers using examples experienced in a clinical setting while caring for children and young people (CYP). Furthermore, the importance of team working and group processes in the context of leadership will be deliberated, using examples of formative group work to illustrate principles described in the literature. Finally, reflections will be discussed on how learning from this experience can influence future practice when caring for CYP. ©2018 RCN Publishing Company Ltd. All rights reserved. Not to be copied, transmitted or recorded in any way, in whole or part, without prior permission of the publishers.
[Views of professionals and patients on the introduction of computer science into the consultation].
Roig Buscató, C; Erra Yuste, N; Seguer Toirán, A; Belda Díaz, S; Juncosa Font, S
2005-09-15
To compare the views of professionals and patients on the computerisation of consultations. Cross-sectional. Rural health district in the province of Barcelona, with a population of about 15,000. Consecutive sampling of people seen in the health district and the group of health professionals working in it. Two anonymous self-filled questionnaires with closed questions aimed at health professionals and a sample of patients (accuracy, 0.05; confidence, 95%; prevalence, 50%). The mean age of the 407 patients was 48.4 (SD, 17.2), with 63.6% women. 21 questionnaires were filled in by the professionals (91%), 12 by doctors, and 9 by nurses. Their mean age was 43.9 (SD, 7.5), and 71.4% were women. For common questions, 54.3% of patients were keen on seeing the screen, while professionals calculated this figure at 11%. 5.6% of patients thought computerisation had changed the relationship, whereas 31.6% of professionals did. 12.6% of patients thought it had made the visit longer, whereas 38.1% of the professionals thought it had. 10.6% of patients and 47.4% of professionals thought it had led to loss of confidentiality. The introduction of computers into consultations was accepted well. Professionals were more worried than patients about possible loss of confidentiality, and thought that there had been bigger changes in the doctor-patient relationship and that visits had become longer.
Directory of Open Access Journals (Sweden)
Teemu Smura
Full Text Available Genetic recombination is considered to be a very frequent phenomenon among enteroviruses (Family Picornaviridae, Genus Enterovirus. However, the recombination patterns may differ between enterovirus species and between types within species. Enterovirus C (EV-C species contains 21 types. In the capsid coding P1 region, the types of EV-C species cluster further into three sub-groups (designated here as A-C. In this study, the recombination pattern of EV-C species sub-group B that contains types CVA-21, CVA-24, EV-C95, EV-C96 and EV-C99 was determined using partial 5'UTR and VP1 sequences of enterovirus strains isolated during poliovirus surveillance and previously published complete genome sequences. Several inter-typic recombination events were detected. Furthermore, the analyses suggested that inter-typic recombination events have occurred mainly within the distinct sub-groups of EV-C species. Only sporadic recombination events between EV-C species sub-group B and other EV-C sub-groups were detected. In addition, strict recombination barriers were inferred for CVA-21 genotype C and CVA-24 variant strains. These results suggest that the frequency of inter-typic recombinations, even within species, may depend on the phylogenetic position of the given viruses.
What do nurses do in professional Facebook groups and how can we explain their behaviours?
Ryan, Gemma Sinead
2017-01-01
AIMTo explore and explain the causal (mechanisms) relationships between nurse’s actions and behaviours in Facebook groups.BACKGROUNDOnline Social Networks such as Facebook have rapidly diffused through the nursing profession with an estimated 60% using social media every day. There have been a range of concerns linked to unprofessional behaviours on Facebook despite professional guidance being in place. However, there is little evidence that explores the causal and influencing factors that le...
Stenberg, Jenny; Henriksson, Catrin; Lindberg, Magnus; Furuland, Hans
2018-05-23
Inadequate volume control may be a main contributor to poor survival and high mortality in hemodialysis patients. Bioimpedance measurement has the potential to improve fluid management, but several dialysis centers lack an agreed fluid management policy, and the method has not yet been implemented. Our aim was to identify renal care professionals' perceived barriers and facilitators for use of bioimpedance in clinical practice. Qualitative data were collected through four focus group interviews with 24 renal care professionals: dieticians, nephrologists and nurses, recruited voluntarily from a nation-wide selection of hemodialysis centers, having access to a bioimpedance-device. The participants were connected to each other and a moderator via equipment for telemedicine and the sessions were recorded. The interviews were semi-structured, focusing on the participants' perceptions of use of bioimpedance in clinical practice. Thematic content analysis was performed in consecutive steps, and data were extracted by employing an inductive, interactive, comparative process. Several barriers and facilitators to the use of bioimpedance in clinical practice were identified, and a multilevel approach to examining barriers and incentives for change was found to be applicable to the ideas and categories that arose from the data. The determinants were categorized on five levels, and the different themes of the levels illustrated with quotations from the focus groups participants. Determinants for use of bioimpedance were identified on five levels: 1) the innovation itself, 2) the individual professional, 3) the patient, 4) the social context and 5) the organizational context. Barriers were identified in the areas of credibility, awareness, knowledge, self-efficacy, care processes, organizational structures and regulations. Facilitators were identified in the areas of the innovation's attractiveness, advantages in practice, and collaboration. Motivation, team processes and
Different Erythromycin Resistance Mechanisms in Group C and Group G Streptococci
Kataja, Janne; Seppälä, Helena; Skurnik, Mikael; Sarkkinen, Hannu; Huovinen, Pentti
1998-01-01
Different mechanisms of erythromycin resistance predominate in group C and G streptococcus (GCS and GGS, respectively) isolates collected from 1992 to 1995 in Finland. Of the 21 erythromycin-resistant GCS and 32 erythromycin-resistant GGS isolates, 95% had the mefA or mefE drug efflux gene and 94% had the ermTR methylase gene, respectively.
Double-step processes in the 12C(p,d)11C reaction at 45 MeV
International Nuclear Information System (INIS)
Couvert, Pierre.
1974-01-01
12 C(p,d) 11 C pick-up reaction was performed with a 45 MeV proton beam. A 130keV energy resolution was obtained and angular distributions of nine of the ten first levels of 11 C have been extracted within a large angular range. Assuming only neutron direct transfert, the strong relative excitation of high spin levels cannot be reproduced by a DWBA analysis. The double-step process assumption seems to be verified by a systematical analysis of the (p,d) reaction mechanisms. This analysis is done in the coupled-channel formalism for the five first negative parity states of 11 C. The 3/2 - ground state is essentially populated by the direct transfer of a Psub(3/2) neutron. The contribution of a double-step process, via the 2 + inelastic excitation of 12 C, is important for the four other states. A mechanism which assumes a deuteron inelastic scattering on the 11 C final nucleus after the neutron transfer cannot be neglected and improves the fits when it is taken into account [fr
Widmark, Catarina; Tishelman, Carol; Gustafsson, Helena; Sharp, Lena
2012-07-23
Radiotherapy (RT) units are high-tech nursing environments. In Sweden, RT registered nurses (RNs) provide and manage RT in close collaboration with other professional groups, as well as providing nursing care for patients with cancer. Communication demands on these RNs are thus particularly complex. In this study, we aimed to better understand problems, strengths and change needs related to professional communication with and within the RT department, as a basis for developing a situation-specific intervention. Focus groups discussions (FGDs) were conducted with different professional (RNs, assistant nurses, physicians, engineers and physicists) and user stakeholders. Transcripts of the FGDs were inductively analyzed by a team of researchers, to generate clinically relevant and useful data. These findings give insight into RT safety climate and are presented under three major headings: Conceptualization of professional domains; Organization and leadership issues; and Communication forms, strategies and processes. The impact of existing hierarchies, including how they are conceptualized and acted out in practice, was noted throughout these data. Despite other differences, participating professionals agreed about communication problems related to RT, i.e. a lack of systems and processes for information transfer, unclear role differentiation, a sense of mutual disrespect, and ad hoc communication taking place 'on the fly'. While all professional groups recognized extensive communication problems, none acknowledged the potential negative effects on patient safety or care described in the FGD with patient representatives. While RNs often initially denied the existence of a hierarchy, they placed themselves on a hierarchy in their descriptions, describing their own role as passive, with a sense of powerlessness. Potential safety hazards described in the FGDs include not reporting medical errors and silently ignoring or actively opposing new guidelines and regulations
Study of 12C second 0+ state based on the α-particle condensation picture
International Nuclear Information System (INIS)
Funaki, Yasuro
2011-01-01
Structural studies of 12 C(0 2 + ) based on the model wave functions of α-particle condensation are reviewed. The structure of 12 C(0 2 + ) has drawn much attention since the establishment of theoretical models of nuclear synthesis and shell structure. Three α-particle cluster models, i.e., 3αRGM (Resonating Group Method), 3αGCM(Generating Coordinate Method) and 3αOCM(Orthogonality Condition Model), have been developed to explain 12 C(0 + ) successfully. On the other hand, α-particle condensation has been studied in the infinite nuclear matter systems, and even in finite ones. It has come to be considered that there exists condensation-like structure in general. In the present review, the approach based on RGM is explained at first, then THSR(Tohsaki-Horiuch-Schuck-Roepke) α-cluster wave function of α-particle condensate type is described. Calculated results of the binding energies, nuclear radii and monopole transition matrix elements of 0 + states by both THRS wave function and 3αRGM reproduces experiments well and both results almost coincide. Since THRS wave function is included in RGM in principle, this result is natural but noticeable difference of 0 2 + radii between them suggests marked 3α-cluster in THRS. Form factors measured by electron inelastic scattering and energy surface are discussed. THRS wave function gives a new picture of phase transition into the α-particle gas state from the liquid-like ground state. Applications of this concept to 2-α and 4-α cases are discussed finally. (S. Funahashi)
The interprofessional team as a small group.
Kane, R A
1975-01-01
Conflicts in interprofessional teamwork may be as much explained by group process considerations as by the interaction of professional roles and statuses. This paper examines the interprofessional team as a small group, using a synthesis of sources from social psychology, social group work, T-group literature, management theory, and health team research. Eight issues are considered in relation to the team as a small group, namely, (a) the individual in the group, (b) team size, (c) group norms, (d) democracy, (e) decision making and conflict resolution, (f) communication and structure, (g) leadership, and (h) group harmony and its relationship to group productivity.
Neutron yield of thick {sup 12}C and {sup 13}C targets with 20 and 30 MeV deuterons
Energy Technology Data Exchange (ETDEWEB)
Lhersonneau, G.; Fadil, M. [GANIL, Caen (France); Malkiewicz, T. [CSC - IT Center for Science Ltd., Espoo (Finland); Gorelov, D.; Sorri, J.; Trzaska, W.H. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Jones, P.; Ngcobo, P.Z. [iThemba Laboratory for Accelerator Based Science, Western Cape (South Africa)
2016-12-15
The neutron yield of thick targets of carbon, natural and enriched in {sup 13}C, bombarded by deuterons of 20 and 30 MeV has been measured by the activation method. The gain with respect to a {sup 12}C target is the same as with protons beams. The yield ratio is about 1.2 only and hardly can justify the use of a {sup 13}C target with deuteron beams. The data, apart from being of interest for the design of facilities where secondary neutron beams are used, provide a test case for calculations where both beam and target have a weakly bound neutron. The MCNPx code version 2.6.0, despite failing to reproduce some details of the experimental distributions, describes their global properties fairly well, especially the relative yields of the {sup 12}C and {sup 13}C targets. (orig.)
Possible Involvement of Hydrosulfide in B12-Dependent Methyl Group Transfer
Directory of Open Access Journals (Sweden)
John I. Toohey
2017-04-01
Full Text Available Evidence from several fields of investigation lead to the hypothesis that the sulfur atom is involved in vitamin B12-dependent methyl group transfer. To compile the evidence, it is necessary to briefly review the following fields: methylation, the new field of sulfane sulfur/hydrogen sulfide (S°/H2S, hydrosulfide derivatives of cobalamins, autoxidation of hydrosulfide radical, radical S-adenosylmethionine methyl transfer (RSMT, and methionine synthase (MS. Then, new reaction mechanisms for B12-dependent methyl group transfer are proposed; the mechanisms are facile and overcome difficulties that existed in previously-accepted mechanisms. Finally, the theory is applied to the effect of S°/H2S in nerve tissue involving the “hypomethylation theory” that was proposed 50 years ago to explain the neuropathology resulting from deficiency of vitamin B12 or folic acid. The conclusions are consistent with emerging evidence that sulfane sulfur/hydrogen sulfide may be beneficial in treating Alzheimer’s disease.
Energy Technology Data Exchange (ETDEWEB)
Ma Xiaofei [Department of Heavy Ion Radiation Biology and Medicine, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Gansu Province, Lanzhou 730000 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Zhang Hong, E-mail: zhangh@impac.ac.cn [Department of Heavy Ion Radiation Biology and Medicine, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Gansu Province, Lanzhou 730000 (China); Wang Zhenhua; Min Xianhua; Liu Yang; Wu Zhenhua [Department of Heavy Ion Radiation Biology and Medicine, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Gansu Province, Lanzhou 730000 (China); Sun Chao [Department of Heavy Ion Radiation Biology and Medicine, Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Chinese Academy of Sciences, Lanzhou 730000 (China); Key Laboratory of Heavy Ion Radiation Medicine of Gansu Province, Lanzhou 730000 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Hu Bitao [School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China)
2011-11-01
Highlights: {yields} 220 MeV/u {sup 12}C{sup 6+} ions is 1.5 times more effective than X-rays in inducing chromosomal aberration in bone marrow cell. {yields} The ratio of dose averaged liner energy transfer is approach the RBE. {yields} {sup 12}C{sup 6+} ions could induce severe mitosis delay. {yields} The cell cycle is not recovered 72 h following irradiation. - Abstract: The whole bodies of 6-week-old male Kun-Ming mice were exposed to different doses of {sup 12}C{sup 6+} ions or X-rays. Chromosomal aberrations of the bone marrow (gaps, terminal deletions and breaks, fragments, inter-chromosomal fusions and sister-chromatid union) were scored in metaphase 9 h after exposure, corresponding to cells exposed in the G{sub 2}-phase of the first mitosis cycle. Dose-response relationships for the frequency of chromosomal aberrations were plotted both by linear and linear-quadratic equations. The data showed that there was a dose-related increase in the frequency of chromosomal aberrations in all treated groups compared to controls. Linear-quadratic equations were a good fit for both radiation types. The compound theory of dual radiation action was applied to decipher the bigger curvature (D{sup 2}) of the dose-response curves of X-rays compared to those of {sup 12}C{sup 6+} ions. Different distributions of the five types of aberrations and different degrees of homogeneity were found between {sup 12}C{sup 6+} ion and X-ray irradiation and the possible underlying mechanism for these phenomena were analyzed according to the differences in the spatial energy deposition of both types of radiation.
Bradley, Stacy; Drapeau, Martin; Destefano, Jack
2012-01-01
Continuing education is one of the means by which professionals maintain and increase their level of competence. However, the relationship between continuing education and the professional's sense of personal competence and other practice-related variables remains unclear. This study examined practicing psychologists' continuing education activities and how these relate to feelings of perceived competence, professional value, and professional support. Psychologists (n = 418) licensed to practice in Quebec were surveyed by pencil-and-paper mail-in survey concerning their continuing education activities, as well as their perceptions of their competence in practice, and their feelings of being professionally valued and professionally supported. Results indicated that feelings of competence in practice were related to professional reading, taking courses/workshops, years being licensed, and attending psychology conferences/conventions. Feelings of professional value were related to age and participating in psychology networking groups, and feelings of professional support were related to participating in case discussion groups, supervision groups, and psychology networking groups. The results showcase the complexity of professional development. Although relationships were found between continuing education activities and the 3 factors of interest, these relationships were moderate. Findings are discussed in the context of their value to individual psychologists, as well as to psychology licensing and regulatory boards, such as promoting participation in those activities related to feelings of competence and support. Copyright © 2012 The Alliance for Continuing Education in the Health Professions, the Society for Academic Continuing Medical Education, and the Council on CME, Association for Hospital Medical Education.
ZZ CAD, 51 Neutron-Group, 25 Gamma-Group Albedo Data for 4 Materials from DOT Flux
International Nuclear Information System (INIS)
1992-01-01
A - Description of problem or function: Format: BREESE tape-writing program, MORSE; Number of groups: 51 neutron, 25 gamma-ray group albedo data. Nuclides: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. (O, Ca, Al, C, Si, H, K, Mg, Fe, Na, Mn); Origin: DOT angular flux tape. CAD is a set of 51 neutron, 25 gamma-ray group albedo data for the following four materials: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. The differential angular albedos are a function of the five incident polar directions and 30 reflected directions. B - Method of solution: The data has been generated from a DOT angular flux tape using the code CARP (abstract PSR-0131). C - Restrictions on the complexity of the problem: Since the amount of data is so large, it is necessary to run CARP, using the group reduction option, in order to run a problem on most computers
Total reaction cross section and foward glory for 12C + 16O
International Nuclear Information System (INIS)
Villari, A.C.C.; Lepine-Szily, A.; Lichtenthaler Filho, R.; Portezan Filho, O.; Obuti, M.M.
1988-12-01
A model-independent method is proposed for the determination of the total reaction cross section from elastic angular distributions. This method based on the generalized optical theorem, was applied to 16 complete elastic angular distributions of the system 12 C + 16 O at energies between E CM =8.55 MeV and E CM = 26.74 MeV. Some of the angular distributions were measured at the Sao Paulo Pelletron Laboratory. Angular distributions measured by the Erlangen and Saclay groups were also used. The reaction cross section is compared with fusion measurements and with σ R obtained by indirect methods. The existence and conditions for the observation of the nuclear forward glory scattering are investigated. (author) [pt
Macroscopic folded form factors for 12C + 12C inelastic scattering
International Nuclear Information System (INIS)
Rickertsen, L.D.; Satchler, G.R.; Stokstad, R.G.; Wieland, R.M.
1976-01-01
The angular distributions for the scattering of carbon-12 from carbon-12 at 117.1 MeV are shown as is also the result of coupled-channel calculations for the elastic and inelastic scattering using these folded form factors
12C(3He,3He n)11C cross section at 910 MeV
International Nuclear Information System (INIS)
Aslanides, E.; Fassnacht, P.; Dellacasa, G.; Gallio, M.; Tuyn, J.W.N.
1981-01-01
The 12 C( 3 He, 3 He n) 11 C cross section at 910 MeV was measured by using a Ge(Li) gamma spectrometer to determine the disintegration rate and measuring the incident flux by means of a scintillator telescope. Cross sections for the production of 7 Be in C and Al and for the production of 24 Na in Al are then determined using the measured cross section as a monitor
Chromatin plasticity as a differentiation index during muscle differentiation of C2C12 myoblasts
International Nuclear Information System (INIS)
Watanabe, Tomonobu M.; Higuchi, Sayaka; Kawauchi, Keiko; Tsukasaki, Yoshikazu; Ichimura, Taro; Fujita, Hideaki
2012-01-01
Highlights: ► Change in the epigenetic landscape during myogenesis was optically investigated. ► Mobility of nuclear proteins was used to state the epigenetic status of the cell. ► Mobility of nuclear proteins decreased as myogenesis progressed in C2C12. ► Differentiation state diagram was developed using parameters obtained. -- Abstract: Skeletal muscle undergoes complicated differentiation steps that include cell-cycle arrest, cell fusion, and maturation, which are controlled through sequential expression of transcription factors. During muscle differentiation, remodeling of the epigenetic landscape is also known to take place on a large scale, determining cell fate. In an attempt to determine the extent of epigenetic remodeling during muscle differentiation, we characterized the plasticity of the chromatin structure using C2C12 myoblasts. Differentiation of C2C12 cells was induced by lowering the serum concentration after they had reached full confluence, resulting in the formation of multi-nucleated myotubes. Upon induction of differentiation, the nucleus size decreased whereas the aspect ratio increased, indicating the presence of force on the nucleus during differentiation. Movement of the nucleus was also suppressed when differentiation was induced, indicating that the plasticity of chromatin changed upon differentiation. To evaluate the histone dynamics during differentiation, FRAP experiment was performed, which showed an increase in the immobile fraction of histone proteins when differentiation was induced. To further evaluate the change in the histone dynamics during differentiation, FCS was performed, which showed a decrease in histone mobility on differentiation. We here show that the plasticity of chromatin decreases upon differentiation, which takes place in a stepwise manner, and that it can be used as an index for the differentiation stage during myogenesis using the state diagram developed with the parameters obtained in this study.
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
Energy Technology Data Exchange (ETDEWEB)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan [Hospital for Sick Children, Diagnostic Imaging, Toronto (Canada); Clarke, Howard [Hospital for Sick Children, Plastic Surgery, Toronto (Canada); Weksberg, Rosanna [Hospital for Sick Children, Clinical and Metabolic Genetics, Toronto (Canada)
2008-07-15
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
International Nuclear Information System (INIS)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan; Clarke, Howard; Weksberg, Rosanna
2008-01-01
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
Sertich, Sally Krause
2013-01-01
This study used a conceptual framework of professional development theory to identify characteristics of effective learning activities specific to 259 Minnesota K-12 public school physical education and developmental adapted physical education (PE/DAPE) teachers during 2012-2013. Study results confirmed that as PE/DAPE teacher participation in…
CESAME: Providing High Quality Professional Development in Science and Mathematics for K-12 Teachers
Hickman, Paul
2002-04-01
It is appropriate that after almost half a century of Science and Mathematics education reform we take a look back and a peek forward to understand the present state of this wonderfully complex system. Each of the components of this system including teaching, professional development, assessment, content and the district K-12 curriculum all need to work together if we hope to provide quality science, mathematics and technology education for ALL students. How do the state and national standards drive the system? How do state policies on student testing and teacher licensure come into play? How do we improve the preparation, retention and job satisfaction of our K-12 teachers? What initiatives have made or are making a difference? What else needs to be done? What can the physics community do to support local efforts? This job is too big for any single organization or individual but we each can contribute to the effort. Our Center at Northeastern University, with support from the National Science Foundation, has a sharply defined focus: to get high quality, research-based instructional materials into the hands of K-12 classroom teachers and provide the support they need to use the materials effectively in their classrooms.
Cluster Structure of 12C and 11Be
International Nuclear Information System (INIS)
Freer, M.; Fujita, H.; Buthelezi, Z.; Carter, J.; Fearick, R.W.; Foertsch, S.V.; Neveling, R.; Perez, S.M.; Papka, P.; Smit, F.D.; Swartz, J.A.; Usman, I.; Haigh, P.J.; Ashwood, N.I.; Bloxham, T.; Curtis, N.; McEwan, P.; Bohlen, H.G.; Dorsch, T.; Kokalova, Tz.
2010-01-01
The structure of the nucleus 12 C is discussed, in particular the spectrum of states above the α-decay threshold. A search for the 2 + excitation of the Hoyle-state is reported. The structural link between halo-like states and molecular states is explored in the case of 11 Be.
Energy dependence of the 16O + 12C potential of interaction
Directory of Open Access Journals (Sweden)
O. A. Ponkratenko
2013-09-01
Full Text Available The 16O + 12C scattering data originating from various measurements in the energy range from 1 to 100 MeV/nucleon have been analyzed within optical model (OM. As a result the global energy dependent 16O + 12C - OM-potential has been obtained. Satisfactory description of experimental data is achieved. While analyzing differential cross sections of the elastic scattering and fusion cross sections were calculated using var-ious types of optical potentials.
The effect of BW12C on radiosensitivity and necrosis of murine tissues and tumours
International Nuclear Information System (INIS)
Stevens, G.; Hill, S.A.; Joiner, M.C.; Joiner, B.; Johns, H.; Williams, K.; Denekamp, J.
1994-01-01
BW12C is a drug that has the potential to induce normal tissue and tumour hypoxia by binding to haemoglobin, increasing its affinity for oxygen and thereby reducing oxygen availability to tissues. Initial results suggested that BW12C administration caused significant radioprotection of normal tissues and induced tumour necrosis, but variable results have been reported subsequently. This work was carried to extend the range of observations concerning the ability of BW12C to radioprotect normal tissues and tumours and to induce necrosis of tumours of the mouse. BW12C was administered as 70 mg/kg intravenous 15 min before irradiation of jejunum in CBA mice and of foot skin in WHT mice with single doses of 240 kVp X-rays while mice breathed gases of varying oxygen tensions. The radiosensitivities of these tissues were assessed by the crypt survival assay and the acute skin reaction, respectively. The radiosensitivity of CaNT tumours to single fraction irradiation was assessed by the regrowth delay assay following administration of single or multiple does of BW12C at varying times to air-breathing CBA mice. The radiation response was compared to the radiosensitivity of clamped tumours. The effect of BW12C alone on tumours was assessed by regrowth delay and histological examination for necrosis. Single or multiple doses of BW12C did not influence the radiosensitivity of CaNT tumours, although marked radioprotection could be induced by clamping the tumours during irradiation. Multiple doses of BW12C alone led to a slight increase in necrosis of the CaNT tumour but did not alter its growth rate. BW12C alone did not induce necrosis of the murine JT lymphoma. The results shown that BW12C did not have a significant effect as a radioprotective or necrotizing agent in these experimental systems. The reported differences in the radiomodifying effects of BW12C are probably tissue-specific and relate to complex biochemical and physiological interactions. 18 refs., 4 figs
Supporting students in professional socialisation: Guidelines for professional nurses and educators
Hester Cathrina (Rina) de Swardt; Gisela H. van Rensburg; M.J. Oosthuizen
2017-01-01
Professional socialisation of nursing students involves learning skills, attitudes, behaviour and professional roles, largely in the clinical area. During clinical accompaniment and reflective discussions with a group of undergraduate Baccalaureate nursing students in South Africa, students reported negative professional socialisation experiences, primarily in the clinical area. Such experiences could influence the quality of patient care. The objective of this study was to develop and valida...
Are professional drivers less sleepy than non-professional drivers?
Anund, Anna; Ahlström, Christer; Fors, Carina; Åkerstedt, Torbjörn
2018-01-01
Objective It is generally believed that professional drivers can manage quite severe fatigue before routine driving performance is affected. In addition, there are results indicating that professional drivers can adapt to prolonged night shifts and may be able to learn to drive without decreased performance under high levels of sleepiness. However, very little research has been conducted to compare professionals and non-professionals when controlling for time driven and time of day. Method The aim of this study was to use a driving simulator to investigate whether professional drivers are more resistant to sleep deprivation than non-professional drivers. Differences in the development of sleepiness (self-reported, physiological and behavioral) during driving was investigated in 11 young professional and 15 non-professional drivers. Results Professional drivers self-reported significantly lower sleepiness while driving a simulator than non-professional drivers. In contradiction, they showed longer blink durations and more line crossings, both of which are indicators of sleepiness. They also drove faster. The reason for the discrepancy in the relation between the different sleepiness indicators for the two groups could be due to more experience to sleepiness among the professional drivers or possibly to the faster speed, which might unconsciously have been used by the professionals to try to counteract sleepiness. Conclusion Professional drivers self-reported significantly lower sleepiness while driving a simulator than non-professional drivers. However, they showed longer blink durations and more line crossings, both of which are indicators of sleepiness, and they drove faster.
Kukreja, Sunil; Kalakoti, Piyush; Murray, Richard; Nixon, Menarvia; Missios, Symeon; Guthikonda, Bharat; Nanda, Anil
2015-04-01
Incidence of C-2 fracture is increasing in elderly patients. Patient age also influences decision making in the management of these fractures. There are very limited data on the national trends of incidence, treatment interventions, and resource utilization in patients in different age groups with isolated C-2 fractures. The aim of this study is to investigate the incidence, treatment, complications, length of stay, and hospital charges of isolated C-2 fracture in patients in 3 different age groups by using the Nationwide Inpatient Sample (NIS) database. The data were obtained from NIS from 2002 to 2011. Data on patients with closed fractures of C-2 without spinal cord injury were extracted using ICD-9-CM diagnosis code 805.02. Patients with isolated C-2 fractures were identified by excluding patients with other associated injuries. The cohort was divided into 3 age groups: 80 years. Incidence, treatment characteristics, inpatient/postoperative complications, and hospital charges (mean and total annual charges) were compared between the 3 age groups. A total of 10,336 patients with isolated C-2 fractures were identified. The majority of the patients were in the very elderly age group (> 80 years; 42.3%) followed by 29.7% in the 65- to 80-year age group and 28% in age group. From 2002 to 2011, the incidence of hospitalization significantly increased in the 65- to 80-year and > 80-year age groups (p age group (p = 0.287). Overall, 21% of the patients were treated surgically, and 12.2% of the patients underwent nonoperative interventions (halo and spinal traction). The rate of nonoperative interventions significantly decreased over time in all age groups (p age groups had a greater risk of inpatient/postoperative complications, nonroutine discharges, and longer hospitalization. The mean hospital charges were significantly higher in older age groups (p age groups. Simultaneously, there has been a steadily decreasing trend in the preference for nonoperative
Development of the Professional Self-Care Scale.
Dorociak, Katherine E; Rupert, Patricia A; Bryant, Fred B; Zahniser, Evan
2017-04-01
In recent years, there has been an increased emphasis on the importance of self-care for psychologists and other mental health professionals. With the growth of positive psychology and preventive medicine, self-care is an emerging topic, promulgated as a means of avoiding the adverse effects of stress and promoting professional functioning and well-being. However, the research on self-care is limited because of the lack of an empirically based, psychometrically sound measure of this construct. Thus, the purpose of this project was to develop a measure of professional self-care. Professional psychologists were the focus of study, with the goal being to develop a measure that can be used in this population and similar groups of professionals. Based on expert feedback and a preliminary study of 422 licensed psychologists in Illinois, a 5-factor, 21-item scale was created. Factor analysis identified the following self-care factors: Professional Support, Professional Development, Life Balance, Cognitive Awareness, and Daily Balance. Preliminary analyses provided initial support for the validity of the 5 factors. A follow-up study was conducted with a second sample of clinical psychologists. The 5-factor structure provided a good fit to the data with the second sample. Thus, based on factor analysis and validity data, a 5-factor, 21-item Professional Self-Care Scale was established for further study and use in future research. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Group lattices with applications to the molecule C60
International Nuclear Information System (INIS)
Stuart, S.
1993-01-01
A brief introduction to group lattices and their application to the electronic structure of C 6 0 is presented. Group lattice methods with experimental results yield a fairly clear picture of the electronic energy levels. (Author) 7 refs
International Nuclear Information System (INIS)
Morais, M.C.; Lichtenthaele, R.; Arazi, A.; Hojman, D.; Cardona, M.A.; Fimiani, L.; Carnelli, P.F.; Marti, G.V.; Pacheco, A.J.; Martinez Heimann, D.; Negri, A.E.; Capurro, O.A.; Niello, Fernandez; Montero, P.
2011-01-01
Full text: The 16 O+ 12 C elastic scattering was investigated considering the effect of exchange of an alpha particle between projectile and target leading to the same nuclei of the entrance channel (elastic transfer). Angular distributions were analyzed in an energy range from 8.55 MeV to 56.57 MeV in the center of mass frame. The Coulomb barrier is around 11MeV for this system. Measurements of angular distributions of elastic and inelastic transfer reactions to states of the 16 O in the 16 O+ 12 C system were performed at the TANDAR Laboratory in Buenos Aires, using an 16 O beam of E lab = 46; 26 MeV. The transfer angular distributions were analyzed by DWBA using the computer code FRESCO. Those measurements provided the spectroscopic factors of 12 C + α → 16 O for the ground state and for J π = 2 + and J π = 1 - 16 O excited states, both just below the α-threshold at 7.16 MeV. The Asymptotic Normalization Coefficient (ANC) for the J π = 2 + state was obtained (1.05 ±0,13(10 5 fm -1/2 )) and used to calculate the reduced width of this state, with this value a R-matrix calculation was performed to determine the astrophysical S-factor in energies around the Gamow peak, S(E2)=37keVb. (author)
Legal Professionals' Knowledge of Eyewitness Testimony in China: A Cross-Sectional Survey.
Directory of Open Access Journals (Sweden)
Lina Jiang
Full Text Available To examine legal professionals' knowledge of a wide range of factors that affect eyewitness accuracy in China.A total of 812 participants, including 210 judges, 244 prosecutors, 202 police officers, and 156 defense attorneys, were asked to respond to 12 statements about eyewitness testimony and 3 basic demographic questions (i.e., gender, age, and prior experience.Although the judges and the defense attorneys had a somewhat higher number of correct responses than the other two groups, all groups showed limited knowledge of eyewitness testimony. In addition, the participants' responses to only four items (i.e., weapon focus, attitude and expectations, child suggestibility, and the impact of stress were roughly unanimous within the four legal professional groups. Legal professionals' gender showed no significant correlations with their knowledge of eyewitness testimony. Prior experiences were significantly and negatively correlated with the item on the knowledge of forgetting curve among judges but positively correlated with two items (i.e., attitudes and exposure time among defense attorneys and with 4 statements (i.e., the knowledge of attitudes and expectations, impact of stress, child witness accuracy, and exposure time among prosecutors.The findings suggest that knowledge of the factors that influence eyewitness accuracy must be more effectively communicated to legal professionals in the future.
The effect of multiple sclerosis on the professional life of a group of Brazilian patients
Directory of Open Access Journals (Sweden)
Yára Dadalti Fragoso
2010-12-01
Full Text Available OBJECTIVE: To assess the impact of multiple sclerosis (MS on the professional life of Brazilian patients. METHOD: One hundred MS patients were randomly selected from the database of the Brazilian Multiple Sclerosis Association (ABEM. An individual interview was carried out by telephone by a member of ABEM, who collected data on the patients' clinical status, educational level and professional lives. RESULTS: Complete data were obtained from 96 patients (27 males and 69 females aged 55.0±14.1 years, with average disease duration of 4.6±4.0 years. Eighty percent had eleven or more years of schooling. Among the whole group, 66% did not present limitations on walking. The longer the disease duration and the older the patient were, the higher the chances were that the patient was retired or receiving workers' compensation benefits. However, even among patients with MS for less than five years, the rate of non-participation in the workforce was 47.7%. Fatigue, paresthesia, cognitive dysfunction and pain were often cited as the motives for not working. CONCLUSION: MS patients presented high levels of unemployment, retirement and receipt of workers' compensation benefits, despite their high schooling levels. Age, disease duration and disability influenced these results for the whole group. However, even among younger patients with shorter disease duration and low disability, this finding remained.
Some Remarks on Group Bundles and C* Dynamical Systems
Vasselli, Ezio
2007-08-01
We introduce the notion of fibred action of a group bundle on a C(X)-algebra. By using such a notion, a characterization in terms of induced C*-bundles is given for C*-dynamical systems such that the relative commutant of the fixed-point C*-algebra is minimal (i.e., it is generated by the centre of the given C*-algebra and the centre of the fixed-point C*-algebra). A class of examples in the setting of the Cuntz algebra is given, and connections with superselection structures with nontrivial centre are discussed.
Ghosh, Shampa; Sinha, Jitendra Kumar; Putcha, Uday Kumar; Raghunath, Manchala
2016-01-01
Vitamin B12 deficiency is widely prevalent in women of childbearing age, especially in developing countries. In the present study, through dietary restriction, we have established mouse models of severe and moderate vitamin B12 deficiencies to elucidate the impact on body composition, biochemical parameters, and reproductive performance. Female weanling C57BL/6 mice were fed for 4 weeks: (a) control AIN-76A diet, (b) vitamin B12-restricted AIN-76A diet with pectin as dietary fiber (severe deficiency group, as pectin inhibits vitamin B12 absorption), or (c) vitamin B12-restricted AIN-76A diet with cellulose as dietary fiber (moderate deficiency group as cellulose does not interfere with vitamin B12 absorption). After confirming deficiency, the mice were mated with male colony mice and maintained on their respective diets throughout pregnancy, lactation, and thereafter till 12 weeks. Severe vitamin B12 deficiency increased body fat% significantly, induced adiposity and altered lipid profile. Pregnant dams of both the deficient groups developed anemia. Severe vitamin B12 deficiency decreased the percentage of conception and litter size, pups were small-for-gestational-age and had significantly lower body weight at birth as well as weaning. Most of the offspring born to severely deficient dams died within 24 h of birth. Stress markers and adipocytokines were elevated in severe deficiency with concomitant decrease in antioxidant defense. The results show that severe but not moderate vitamin B12 restriction had profound impact on the physiology of C57BL/6 mice. Oxidative and corticosteroid stress, inflammation and poor antioxidant defense seem to be the probable underlying mechanisms mediating the deleterious effects.
Directory of Open Access Journals (Sweden)
Shampa eGhosh
2016-01-01
Full Text Available Vitamin B12 deficiency is widely prevalent in women of childbearing age especially in developing countries. In the present study, through dietary restriction, we have established mouse models of severe and moderate vitamin B12 deficiencies to elucidate the impact on body composition, biochemical parameters and reproductive performance. Female weanling C57BL/6 mice were fed for four weeks, (a control AIN-76A diet, (b vitamin B12 restricted AIN-76A diet with pectin as dietary fiber (severe deficiency group, as pectin inhibits vitamin B12 absorption or (c vitamin B12 restricted AIN-76A diet with cellulose as dietary fiber (moderate deficiency group as cellulose does not interfere with vitamin B12 absorption. After confirming deficiency, the mice were mated with male colony mice and maintained on their respective diets throughout pregnancy, lactation and thereafter till 12 weeks. Severe vitamin B12 deficiency increased body fat % significantly, induced adiposity and altered lipid profile. Pregnant dams of both the deficient groups developed anemia. Severe vitamin B12 deficiency decreased the percentage of conception and litter size, pups were small-for-gestational-age and had significantly lower body weight at birth as well as weaning. Most of the offspring born to severely deficient dams died within 24 hours of birth. Stress markers and adipocytokines were elevated in severe deficiency with concomitant decrease in antioxidant defense. The results show that severe but not moderate vitamin B12 restriction had profound impact on the physiology of C57BL/6 mice. Oxidative and corticosteroid stress, inflammation and poor antioxidant defense seem to be the probable underlying mechanisms mediating the deleterious effects.
Directory of Open Access Journals (Sweden)
Luciana Miato Gonçalves Silva
Full Text Available Snakebites is a neglected disease and in Brazil is considered a serious health problem, with the majority of the snakebites caused by the genus Bothrops. Antivenom therapy and other first-aid treatments do not reverse local myonecrose which is the main sequel caused by the envenomation. Several studies have shown the effectiveness of low level laser (LLL therapy in reducing local myonecrosis induced by Bothropic venoms, however the mechanism involved in this effect is unknown. In this in vitro study, we aimed to analyze the effect of LLL irradiation against cytotoxicity induced by Bothrops jararacussu venom on myoblast C2C12 cells.C2C12 were utilized as a model target and were incubated with B. jararacussu venom (12.5 μg/mL and immediately irradiated with LLL at wavelength of red 685 nm or infrared 830 nm with energy density of 2.0, 4.6 and 7.0 J/cm2. Effects of LLL on cellular responses of venom-induced cytotoxicity were examined, including cell viability, measurement of cell damage and intra and extracellular ATP levels, expression of myogenic regulatory factors, as well as cellular differentiation.In non-irradiated cells, the venom caused a decrease in cell viability and a massive release of LDH and CK levels indicating myonecrosis. Infrared and red laser at all energy densities were able to considerably decrease venom-induced cytotoxicity. Laser irradiation induced myoblasts to differentiate into myotubes and this effect was accompanied by up regulation of MyoD and specially myogenin. Moreover, LLL was able to reduce the extracellular while increased the intracellular ATP content after venom exposure. In addition, no difference in the intensity of cytotoxicity was shown by non-irradiated and irradiated venom.LLL irradiation caused a protective effect on C2C12 cells against the cytotoxicity caused by B. jararacussu venom and promotes differentiation of these cells by up regulation of myogenic factors. A modulatory effect of ATP synthesis may
[Eating habits of a group of professional volleyball players].
Gacek, Maria
2011-01-01
The aim of the research was an analysis of the eating habits of professional volleyball players according to their sex and age. The research has been carried out on a group of 210 men players and women players at the age of 13-25, representatives of sports clubs in Ostrołeka, Myślenice, Bydgoszcz and Warszawa. The research has revealed a limited realisation of rational diets by both men and women players. The most common mistakes made by them include a smaller number of meals during the day than recommended (especially among men), taking up training on empty stomach and insufficient frequency of consumption of dairy products, fish, vegetables and fruit. The research has also revealed excessive consumption of sweets, sweet sparkling drinks and fast food (mainly among men). The examined players to some extent only apply regular strategies of rehydration of their organisms. A high percentage of them do not pay attention to supplementation of liquids after an effort or they drink a lot of liquids at one time. The most frequently chosen drinks were mineral water and isotonic drinks. Supplementation was applied by a small percentage of the players, mainly men, who most often chose vitamins, Izostar, creatine, L-carnitine and HMB.
Directory of Open Access Journals (Sweden)
Duncan Madeleine
2007-11-01
Full Text Available Abstract Background An integrated sense of professionalism enables health professionals to draw on relevant knowledge in context and to apply a set of professional responsibilities and ethical principles in the midst of changing work environments 12. Inculcating professionalism is therefore a critical goal of health professional education. Two multi-professional courses for first year Health Science students at the University of Cape Town, South Africa aim to lay the foundation for becoming an integrated health professional 3. In these courses a diagram depicting the domains of the integrated health professional is used to focus the content of small group experiential exercises towards an appreciation of professionalism. The diagram serves as an organising framework for conceptualising an emerging professional identity and for directing learning towards the domains of 'self as professional' 45. Objective This paper describes how a diagrammatic representation of the core elements of an integrated health professional is used as a template for framing course content and for organising student learning. Based on the assumption that all health care professionals should be knowledgeable, empathic and reflective, the diagram provides students and educators with a visual tool for investigating the subjective and objective dimensions of professionalism. The use of the diagram as an integrating point of reference for individual and small group learning is described and substantiated with relevant literature. Conclusion The authors have applied the diagram with positive impact for the past six years with students and educators reporting that "it just makes sense". The article includes plans for formal evaluation. Evaluation to date is based on preliminary, informal feedback on the value of the diagram as a tool for capturing the domains of professionalism at an early stage in the undergraduate education of health professional students.
Analysis of the 12C (e,e'pd) Reaction at High Energy Transfer
Energy Technology Data Exchange (ETDEWEB)
Thompson, Neil [Univ. of Glasgow, Scotland (United Kingdom)
2011-03-31
The Jefferson Lab Hall A experiment E01015 measured the differential cross sections of the 12C (e,e'pd) reaction with low yields for kinematics of w = 0.865 GeV , Q2 = 2 (GeV/c)2, xB = 1.2 at three kinematic settings of 12C (e,e'p) missing momentum of 300, 400 and 500 MeV/c. The main objective of the experiment was to measure the 12C (e, e0p) cross section and the cross section ratios of 12C (e,e'pp) and 12C (e,e'pn) to investigate Short Range Correlations. The 12C (e,e'pd) reaction was investigated to find out what its magnitude of cross section. The very low yields and differential cross sections of 12C (e,e'pd) reaction measured at the three different kinematic settings suggests that the contribution of many of the different reaction mechanisms, including three nucleon forces, may be suppressed at the kinematics of this experiment.
Van Velsen, Lex; Wildevuur, Sabine; Flierman, Ina; Van Schooten, Boris; Tabak, Monique; Hermens, Hermie
2016-01-27
For many eServices, end-user trust is a crucial prerequisite for use. Within the context of Telemedicine, the role of trust has hardly ever been studied. In this study, we explored what determines trust in portals that facilitate rehabilitation therapy, both from the perspective of the patient and the healthcare professional. We held two focus groups with patients (total n = 15) and two with healthcare professionals (total n = 13) in which we discussed when trust matters, what makes up trust in a rehabilitation portal, what effect specific design cues have, and how much the participants trust the use of activity sensor data for informing treatment. Trust in a rehabilitation portal is the sum of trust in different factors. These factors and what makes up these factors differ for patients and healthcare professionals. For example, trust in technology is made up, for patients, mostly by a perceived level of control and privacy, while for healthcare professionals, a larger and different set of issues play a role, including technical reliability and a transparent data storage policy. Healthcare professionals distrust activity sensor data for informing patient treatment, as they think that sensors are unable to record the whole range of movements that patients make (e.g., walking and ironing clothes). The set of factors that affect trust in a rehabilitation portal are different from the sets that have been found for other contexts, like eCommerce. Trust in telemedicine technology should be studied as a separate subject to inform the design of reliable interventions.
Neutron scattering from 12C between 15.6 and 17.3 MeV
International Nuclear Information System (INIS)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.
1993-01-01
The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)
Determination of reaction cross sections with the aid of α decay in the 12C, 14C + 209Bl reactions
International Nuclear Information System (INIS)
Hick, H.
1980-01-01
For the reactions 14 C + 209 Bi and 12 C + 209 Bi excitation functions at energies in the range between 57 MeV and 76 MeV are measured. Radiative capture and particle evaporation cross sections were determined by means of α-spectroscopy, and fission cross sections were determined by the measurement of the γ-radiation after the β-decay of the fission products. For the radiative capture for the reaction 14 C + 209 Bi upper limits for the cross section from 21 nbarn to 178 nbarn in the energy interval 61-74 MeV were determined. The fission cross sections were 80 +- 30 mbarn at 490 +- 200 mbarn at 76 MeV. For the reaction 12 C + 209 Bi three new α-lines were found. They were due to the slope at their excitation functions assigned to the decay of isomeric states of following nuclei: 219 Ac Esub(α) = 9419 +- 4 keV Tsub(1/2) = 830 +- 100/μsec, 218 Ac Esub(α) = 9271 +- 4 keV Tsub(1/2) = 810 +- 70/μsec, 217 Ac Eα = 9730 +- 5 keV Tsub(1/2) = 970 +- 190/μsec. For the reactions respectively 12 C + 209 Bi calculations using the statistical model code Grogi of J. Gilat are performed. The calculated branchings of the evaporation channels were compared with the experiment. (orig./HSI) [de
Urquhart, M. L.; Curry, B.; Hairston, M. R.
2009-12-01
Professional development for teachers can take a variety of forms, each with unique challenges and needs. At the University of Texas at Dallas (UTD), we have leveraged partnerships between multiple groups including the Masters of Arts in Teaching program in Science Education, the joint US Air Force/NASA CINDI mission, an ionospheric explorer built at UTD, and the UTD Regional Collaborative for Excellence in Science Teaching. Each effort models, and in the case of the later two has created, inquiry-based lessons around Earth-systems science. A space science mission, currently in low Earth orbit aboard the Air Force satellite C/NOFS, provides real world connections to classroom science, scientific data and visualizations, and funding to support delivery of professional development in short courses and workshops at teacher conferences. Workshops and short course in turn often serve to recruit teachers into our longer-term programs. Long-term professional development programs such as the Collaborative provide opportunities to test curriculum and teacher learning, an interface to high-quality sustained efforts within talented communities of teachers, and much more. From the birth of our CINDI Educational Outreach program to the Collaborative project that produced geoscience kit-based modules and associated professional development adopted throughout the state of Texas, we will share highlights of our major professional development initiatives and how our partnerships have enabled us to better serve the needs of K-12 teachers expected to deliver geoscience and space science content in their classrooms.
Nuclear critical opalescence and the M1 form factors of 12C and 13C
International Nuclear Information System (INIS)
Delorme, J.; Figureau, A.; Guichon, P.
1981-01-01
It is shown that core polarization by the nuclear pion field has opposite effects on the M1 form factors of 12 C(15.11 MeV) and 13 C(g.s.). New data on 13 C are found to agree with this prediction and a common interpretation of the experiments is shown to be possible for the two nuclei in terms of critical opalescence. Discrimination from alternative explanations of the observed anomalies should await further experiments, especially photopion reactions. (orig.)
A new cell-based assay to evaluate myogenesis in mouse myoblast C2C12 cells
Energy Technology Data Exchange (ETDEWEB)
Kodaka, Manami [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Yang, Zeyu [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Department of Ultrasound, Shengjing Hospital of China Medical University, Shenyang (China); Nakagawa, Kentaro; Maruyama, Junichi [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Xu, Xiaoyin [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Department of Breast Surgery, The Second Affiliated Hospital of Wenzhou Medical University, Wenzhou (China); Sarkar, Aradhan; Ichimura, Ayana [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Nasu, Yusuke [Department of Breast Surgery, The Second Affiliated Hospital of Wenzhou Medical University, Wenzhou (China); Ozawa, Takeaki [Department of Chemistry, School of Science, The University of Tokyo, Tokyo (Japan); Iwasa, Hiroaki [Department of Medical Biochemistry, Graduate School of Medical and Dental Sciences, Tokyo Medical and Dental University, Tokyo (Japan); Ishigami-Yuasa, Mari [Chemical Biology Screening Center, Tokyo Medical and Dental University, Tokyo (Japan); Ito, Shigeru [Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental University, Tokyo (Japan); Kagechika, Hiroyuki [Chemical Biology Screening Center, Tokyo Medical and Dental University, Tokyo (Japan); Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental University, Tokyo (Japan); and others
2015-08-15
The development of the efficient screening system of detecting compounds that promote myogenesis and prevent muscle atrophy is important. Mouse C2C12 cells are widely used to evaluate myogenesis but the procedures of the assay are not simple and the quantification is not easy. We established C2C12 cells expressing the N-terminal green fluorescence protein (GFP) and the C-terminal GFP (GFP1–10 and GFP11 cells). GFP1–10 and GFP11 cells do not exhibit GFP signals until they are fused. The signal intensity correlates with the expression of myogenic markers and myofusion. Myogenesis-promoting reagents, such as insulin-like growth factor-1 (IGF1) and β-guanidinopropionic acid (GPA), enhance the signals, whereas the poly-caspase inhibitor, z-VAD-FMK, suppresses it. GFP signals are observed when myotubes formed by GFP1–10 cells are fused with single nuclear GFP11 cells, and enhanced by IGF1, GPA, and IBS008738, a recently-reported myogenesis-promoting reagent. Fusion between myotubes formed by GFP1–10 and GFP11 cells is associated with the appearance of GFP signals. IGF1 and GPA augment these signals, whereas NSC23766, Rac inhibitor, decreases them. The conditioned medium of cancer cells suppresses GFP signals during myogenesis and reduces the width of GFP-positive myotubes after differentiation. Thus the novel split GFP-based assay will provide the useful method for the study of myogenesis, myofusion, and atrophy. - Highlights: • C2C12 cells expressing split GFP proteins show GFP signals when mix-cultured. • The GFP signals correlate with myogenesis and myofusion. • The GFP signals attenuate under the condition that muscle atrophy is induced.
A new cell-based assay to evaluate myogenesis in mouse myoblast C2C12 cells
International Nuclear Information System (INIS)
Kodaka, Manami; Yang, Zeyu; Nakagawa, Kentaro; Maruyama, Junichi; Xu, Xiaoyin; Sarkar, Aradhan; Ichimura, Ayana; Nasu, Yusuke; Ozawa, Takeaki; Iwasa, Hiroaki; Ishigami-Yuasa, Mari; Ito, Shigeru; Kagechika, Hiroyuki
2015-01-01
The development of the efficient screening system of detecting compounds that promote myogenesis and prevent muscle atrophy is important. Mouse C2C12 cells are widely used to evaluate myogenesis but the procedures of the assay are not simple and the quantification is not easy. We established C2C12 cells expressing the N-terminal green fluorescence protein (GFP) and the C-terminal GFP (GFP1–10 and GFP11 cells). GFP1–10 and GFP11 cells do not exhibit GFP signals until they are fused. The signal intensity correlates with the expression of myogenic markers and myofusion. Myogenesis-promoting reagents, such as insulin-like growth factor-1 (IGF1) and β-guanidinopropionic acid (GPA), enhance the signals, whereas the poly-caspase inhibitor, z-VAD-FMK, suppresses it. GFP signals are observed when myotubes formed by GFP1–10 cells are fused with single nuclear GFP11 cells, and enhanced by IGF1, GPA, and IBS008738, a recently-reported myogenesis-promoting reagent. Fusion between myotubes formed by GFP1–10 and GFP11 cells is associated with the appearance of GFP signals. IGF1 and GPA augment these signals, whereas NSC23766, Rac inhibitor, decreases them. The conditioned medium of cancer cells suppresses GFP signals during myogenesis and reduces the width of GFP-positive myotubes after differentiation. Thus the novel split GFP-based assay will provide the useful method for the study of myogenesis, myofusion, and atrophy. - Highlights: • C2C12 cells expressing split GFP proteins show GFP signals when mix-cultured. • The GFP signals correlate with myogenesis and myofusion. • The GFP signals attenuate under the condition that muscle atrophy is induced
Directory of Open Access Journals (Sweden)
Noraimah Binti Sulaiman
2016-08-01
Full Text Available Probiotic is a group of microorganism, mainly from lactic acid bacteria (LAB, widely used to increase functionality of various foodstuffs, including lamb which was limited by its goaty odor and short life issue. This study aimed to evaluate the characteristic of lamb sausages fermented by either Lactobacillus plantarum IIA-2C12 or L. acidophilus IIA-2B4 isolated from local cattle in Indonesia, and stored for 21 days at low temperature (4oC. Fermented lamb sausages were made with the addition of L. plantarum IIA-2C12 and L. acidophilus IIA-2B4 with three replications. The result showed that pH value, protein, and cholesterol contents of the sausages with addition of L. acidophilus IIA-2B4 were higher (P<0.05 than that of L. plantarum IIA-2C12. Meanwhile, the sausage fermented with L. plantarum IIA-2C12 had higher titratable acid (TA value, texture, and the content of fat, carbohydrate, tyrosine, lysine, myristoleic (C14:1, pentadecanoic (C15:0, heneicosanoic (C21:0 and cis-11-eicosatrienoic (C20:1 as compared to that of L. acidophilus 2C12-2B4. Final population of LAB in the sausage fermented by L. plantarum IIA-2C12 was also higher than that of L. acidophilus IIA-2B4, yet both can be categorized as a probiotic. The differences between characteristics of the physicochemical traits and microbiological quality of the sausage fermentation associated with the addition of L. plantarum IIA-2C12 or L. acidophilus IIA-2B4. The 21 days of storage at cold temperatures with probiotics addition could extend shelf life and maintain quality of fermented sausage.
Synthesis and fluorescence of new 3-biphenylpyrrolo[1,2-c]pyrimidines
Directory of Open Access Journals (Sweden)
Marian-Laurentiu Tatu
2017-07-01
Full Text Available New pyrrolo[1,2-c]pyrimidines derivates having a biphenyl moiety at position 3 have been synthesized by 1,3-dipolar cycloaddition of their corresponding N-ylides with activated alkynes. FTIR, 1H and 13C NMR spectroscopy and elemental analysis have been used to characterize the structures of the new nine pyrrolo[1,2-c]pyrimidine derivates. Absorption and fluorescence spectra have been recorded. The appropriate solvent for the photoluminescence properties of the studied compounds has been found to be chloroform:acetonitrile mixture (1:1. The main spectral features such as molar extinction coefficients (ε, Stokes shifts, quantum yields using quinine sulphate as standard, fluorescence quenching in the presence of benzoquinone and Stern-Volmer constants have been calculated. The substituent effects on intensity of absorption, maximum absorbance wavelengths and fluorescence parameters have been discussed. The highest quantum yield value was found for ethyl 3-(4-biphenylyl-7-(3,4-dimethoxybenzoylpyrrolo[1,2-c]pyrimidine-5-carboxylate (0.55. The obtained results suggest that the studied compounds are promising candidates for future study in order to evaluate their use in practical applications in fluorescent chemical sensors.
Energy Technology Data Exchange (ETDEWEB)
Seo, S.; Uomori, A.; Yoshimura, Y.; Takeda, K. (Shionogi and Co. Ltd., Osaka (Japan). Research Lab.)
1984-09-01
The /sup 13/C labelling patterns of the two methyl groups at C-25 of dihydrobrassicasterol biosynthesized from (1,2-/sup 13/C/sub 2/) acetate differ from those of campesterol and 24-methylenecholesterol obtained from cultured cells of Physalis peruviana and ergosterol from yeast.
[Professional quality of life in workers of the Toledo primary care health area].
Villarín Castro, A; Méndez García, T; Zuzuárregui Gironés, M S; Sánchez Serrano, S; Conejo Ocaña, R
2015-01-01
To determine the professional quality of life in the workers of the Toledo Primary Care Health Area and to analyse its components. Descriptive, cross-sectional study, performed on workers of the Toledo Primary Care Health Area with an online self-administered questionnaire. age, sex, health centre, professional group, seniority, management experience, collaboration in working groups, employment situation, and the PQL-35 professional quality of life questionnaire. A total of 430 completed questionnaires were received (45.3%), of which 68.4% were women. The mean age was 47.7±8.6 years old. Mean seniority was 21.5±9.7 years. PQL-35 results were: perception of management support 4.8±1.5; perception of workload 6.2±1.3; intrinsic motivation 7.9±1.1; job disconnection capacity 6.3±2.6; and professional quality of life 5.2±2.1. Gender differences were found in perception of management support (4.5±1.5 in males vs 4.9±1.5 in females; P=.031) and professional quality of life (4.9±2.0 vs 5.3±2.1; p=.044). Depending on the professional group, differences were found in the perception of workload (6.4±1.1 in physicians, 6.3±1.3 in nurses, 5.9±1.6 in non-sanitary professionals, and 5.3±1.2 in support units professionals; Pquality of life in the workers of the Toledo Primary Care Health Area is similar to that of other Spanish Health Areas, even in a time of economic crisis. The intrinsic motivation of the professionals is very high, in contrast with their high perception of workload and their low perception of management support. Copyright © 2014 SECA. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Widmark Catarina
2012-07-01
Full Text Available Abstract Background Radiotherapy (RT units are high-tech nursing environments. In Sweden, RT registered nurses (RNs provide and manage RT in close collaboration with other professional groups, as well as providing nursing care for patients with cancer. Communication demands on these RNs are thus particularly complex. In this study, we aimed to better understand problems, strengths and change needs related to professional communication with and within the RT department, as a basis for developing a situation-specific intervention. Methods Focus groups discussions (FGDs were conducted with different professional (RNs, assistant nurses, physicians, engineers and physicists and user stakeholders. Transcripts of the FGDs were inductively analyzed by a team of researchers, to generate clinically relevant and useful data. Results These findings give insight into RT safety climate and are presented under three major headings: Conceptualization of professional domains; Organization and leadership issues; and Communication forms, strategies and processes. The impact of existing hierarchies, including how they are conceptualized and acted out in practice, was noted throughout these data. Despite other differences, participating professionals agreed about communication problems related to RT, i.e. a lack of systems and processes for information transfer, unclear role differentiation, a sense of mutual disrespect, and ad hoc communication taking place ‘on the fly’. While all professional groups recognized extensive communication problems, none acknowledged the potential negative effects on patient safety or care described in the FGD with patient representatives. While RNs often initially denied the existence of a hierarchy, they placed themselves on a hierarchy in their descriptions, describing their own role as passive, with a sense of powerlessness. Potential safety hazards described in the FGDs include not reporting medical errors and silently ignoring
Investigation of the 9Be(a,n)12C reaction. Pt. 2
International Nuclear Information System (INIS)
Schmidt, D.; Boettger, R.; Klein, H.; Nolte, R.
1992-04-01
Differential cross sections of the 9 Be(α,n) 12 C reaction have been measured at 19 alpha energies between 7 MeV and 16 MeV. Besides the differential cross sections from the 9 Be(α,n) 12 C(g.s.) reaction, also those of the 9 Be(α,n) 12 C(E ex ) reactions were derived for excitation energies E ex = 4.439, 7.654, 9.641, 10.84, 11.83 and 12.71 MeV. Possible sources of uncertainties have been extensively investigated and the corresponding results have been published in part 1. All partial and integrated cross sections from the 9 Be(α,n) 12 C(g.s.) reaction were determined with uncertainties of less than 5%. The angular distributions were fitted to Legendre polynomial expansions by the least-squares method. A comparison of the measured cross sections with data from other authors and with an evaluation shows considerable deviations in some cases. Tests were also carried out to ascertain how well an interpolation of the Legendre coefficients reproduces the magnitude and shape of the experimentally determined angular distributions. All angular distributions are presented in figures, together with their Legendre polynomial expansions and data from the literature if available. The a l coefficients of the Legendre polynomial expansions are given in the Appendix. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Tsukahara, Tamotsu, E-mail: ttamotsu@shinshu-u.ac.jp [Department of Integrative Physiology and Bio-System Control, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Haniu, Hisao [Department of Orthopedic Surgery, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Matsuda, Yoshikazu [Clinical Pharmacology Educational Center, Nihon Pharmaceutical University, Ina-machi, Saitama 362-0806 (Japan)
2013-04-12
Highlights: •Alkyl-LPA specifically interacts with PPARγ. •Alkyl-LPA treatments induces lipid accumulation in C2C12 cells. •Alkyl-LPA enhanced glucose uptake in C2C12 cells. •Alkyl-LPA-treated C2C12 cells express increased amounts of GLUT4 mRNA. •Alkyl-LPA is a novel therapeutic agent that can be used for the treatment of obesity and diabetes. -- Abstract: Studies on the effects of lipids on skeletal muscle cells rarely examine the effects of lysophospholipids. Through our recent studies, we identified select forms of phospholipids, such as alkyl-LPA, as ligands for the intracellular receptor peroxisome proliferator-activated receptor gamma (PPARγ). PPARγ is a nuclear hormone receptor implicated in many human diseases, including diabetes and obesity. We previously showed that alkyl-LPA is a specific agonist of PPARγ. However, the mechanism by which the alkyl-LPA–PPARγ axis affects skeletal muscle cells is poorly defined. Our objective in the present study was to determine whether alkyl-LPA and PPARγ activation promotes glucose uptake in skeletal muscle cells. Our findings indicate that PPARγ1 mRNA is more abundant than PPARγ2 mRNA in C2C12 cells. We showed that alkyl-LPA (3 μM) significantly activated PPARγ and increased intracellular glucose levels in skeletal muscle cells. We also showed that incubation of C2C12 cells with alkyl-LPA led to lipid accumulation in the cells. These findings suggest that alkyl-LPA activates PPARγ and stimulates glucose uptake in the absence of insulin in C2C12 cells. This may contribute to the plasma glucose-lowering effect in the treatment of insulin resistance.
International Nuclear Information System (INIS)
Tsukahara, Tamotsu; Haniu, Hisao; Matsuda, Yoshikazu
2013-01-01
Highlights: •Alkyl-LPA specifically interacts with PPARγ. •Alkyl-LPA treatments induces lipid accumulation in C2C12 cells. •Alkyl-LPA enhanced glucose uptake in C2C12 cells. •Alkyl-LPA-treated C2C12 cells express increased amounts of GLUT4 mRNA. •Alkyl-LPA is a novel therapeutic agent that can be used for the treatment of obesity and diabetes. -- Abstract: Studies on the effects of lipids on skeletal muscle cells rarely examine the effects of lysophospholipids. Through our recent studies, we identified select forms of phospholipids, such as alkyl-LPA, as ligands for the intracellular receptor peroxisome proliferator-activated receptor gamma (PPARγ). PPARγ is a nuclear hormone receptor implicated in many human diseases, including diabetes and obesity. We previously showed that alkyl-LPA is a specific agonist of PPARγ. However, the mechanism by which the alkyl-LPA–PPARγ axis affects skeletal muscle cells is poorly defined. Our objective in the present study was to determine whether alkyl-LPA and PPARγ activation promotes glucose uptake in skeletal muscle cells. Our findings indicate that PPARγ1 mRNA is more abundant than PPARγ2 mRNA in C2C12 cells. We showed that alkyl-LPA (3 μM) significantly activated PPARγ and increased intracellular glucose levels in skeletal muscle cells. We also showed that incubation of C2C12 cells with alkyl-LPA led to lipid accumulation in the cells. These findings suggest that alkyl-LPA activates PPARγ and stimulates glucose uptake in the absence of insulin in C2C12 cells. This may contribute to the plasma glucose-lowering effect in the treatment of insulin resistance
Care-managers' professional choices: ethical dilemmas and conflicting expectations.
Tønnessen, Siri; Ursin, Gøril; Brinchmann, Berit Støre
2017-09-07
Care-managers are responsible for the public administration of individual healthcare decisions and decide on the volume and content of community healthcare services given to a population. The purpose of this study was to investigate the conflicting expectations and ethical dilemmas these professionals encounter in their daily work with patients and to discuss the clinical implications of this. The study had a qualitative design. The data consisted of verbatim transcripts from 12 ethical reflection group meetings held in 2012 at a purchaser unit in a Norwegian city. The participants consist of healthcare professionals such as nurses, occupational therapists, physiotherapists and social workers. The analyses and interpretation were conducted according to a hermeneutic methodology. This study is part of a larger research project. Two main themes emerged through the analyses: 1. Professional autonomy and loyalty, and related subthemes: loyalty to whom/what, overruling of decisions, trust and obligation to report. 2. Boundaries of involvement and subthemes: private or professional, care-manager or provider and accessibility. Underlying values and a model illustrating the dimensions of professional responsibility in the care-manager role are suggested. The study implies that when allocating services, healthcare professionals need to find a balance between responsibility and accountability in their role as care-managers.
Molecular dynamic simulation of the self-assembly of DAP12-NKG2C activating immunoreceptor complex.
Directory of Open Access Journals (Sweden)
Peng Wei
Full Text Available The DAP12-NKG2C activating immunoreceptor complex is one of the multisubunit transmembrane protein complexes in which ligand-binding receptor chains assemble with dimeric signal-transducing modules through non-covalent associations in their transmembrane (TM domains. In this work, both coarse grained and atomistic molecular dynamic simulation methods were applied to investigate the self-assembly dynamics of the transmembrane domains of the DAP12-NKG2C activating immunoreceptor complex. Through simulating the dynamics of DAP12-NKG2C TM heterotrimer and point mutations, we demonstrated that a five-polar-residue motif including: 2 Asps and 2 Thrs in DAP12 dimer, as well as 1 Lys in NKG2C TM plays an important role in the assembly structure of the DAP12-NKG2C TM heterotrimer. Furthermore, we provided clear evidences to exclude the possibility that another NKG2C could stably associate with the DAP12-NKG2C heterotrimer. Based on the simulation results, we proposed a revised model for the self-assembly of DAP12-NKG2C activating immunoreceptor complex, along with a plausible explanation for the association of only one NKG2C with a DAP12 dimer.
Effectiveness of a Unique Support Group for Physicians in a Physician Health Program.
Sanchez, Luis T; Candilis, Philip J; Arnstein, Fredrick; Eaton, Judith; Barnes Blood, Diana; Chinman, Gary A; Bresnahan, Linda R
2016-01-01
State Physician Health Programs (PHPs) assess, support, and monitor physicians with mental, behavioral, medical, and substance abuse problems. Since their formation in the 1970s, PHPs have offered support groups following the 12-step model for recovery from substance use disorders (SUDs). However, few programs have developed support groups for physicians without SUDs. This study at the Massachusetts PHP (Physician Health Services Inc.) represents the first effort to survey physician attitudes concerning a unique support group that goes beyond classic addiction models. The group was initiated because of the observation that physicians with problems other than SUDs did not fit easily into the 12-step framework. It was hypothesized that such a group would be effective in helping participants control workplace stress, improve professional and personal relationships, and manage medical and psychiatric difficulties. With a response rate of 43% (85 respondents), the survey identified a strong overall impact of the Physician Health Services Inc. support group, identifying positive effects in all areas of personal and professional life: family and friends, wellness, professional relationships, and career. Respondents identified the role of the facilitator as particularly important, underscoring the facilitator's capacity to welcome participants, manage interactions, set limits, and maintain a supportive emotional tone. The implications for physician health extend from supporting a broader application of this model to using a skilled facilitator to manage groups intended to reduce the stress and burnout of present-day medical practice. The results encourage PHPs, hospitals, medical practices, and physician groups to consider implementing facilitated support groups as an additional tool for maintaining physician health.
Study of 12C interactions at HISS
International Nuclear Information System (INIS)
Crawford, H.J.
1982-12-01
Single-particle inclusive measurements in high-energy nuclear physics have provided the foundation for a number of models of interacting nuclear fluids. Such measurements yield information on the endpoints of the evolution of highly excited nuclear systems. However, they suffer from the fact that observed particles can be formed in a large number of very different evolutionary paths. To learn more about how interactions proceed we have performed a series of experiments in which all fast nuclear fragments are analyzed for each individual interaction. These experiments were performed at the LBL Bevalac HISS (Heavy Ion Spectrometer System) facility where we studied the interaction of 1 GeV/nuc 12C nuclei with targets of C, CH 2 , Cu, and U. In this paper we describe HISS and present some preliminary results of the experiment
... Consumer Datos en español Health Professional Other Resources Vitamin B12 Fact Sheet for Consumers Have a question? ... out more about vitamin B12? Disclaimer What is vitamin B12 and what does it do? Vitamin B12 ...
Saad, N.; Hoffnagle, J.
2012-04-01
Olive oil samples were analyzed using the world's first simultaneous δ13C + δD instrument, the 13C+D Combustion Module-Cavity Ringdown Spectroscopy (CM-CRDS) Isotope Analyzer. Simultaneous measurements of δ13C and δD of the whole oil have been performed on commercially available olive oils produced in Greece, Spain, Italy, California, Lebanon, Israel, Australia and Turkey. Together, the measurements of isotopic ratios of carbon (13C/12C) and hydrogen (D/H) produce statistically significant differentiation between olive oils from different locations around the globe. Stable isotope ratios are exquisitely sensitive to the biochemistry of plant species and the nutrients available to them in a particular geographical location. Isotope ratios provide detailed knowledge useful for forensic applications through a combination of stable-isotope measurements of carbon (13C/12C) and hydrogen (D/H) isotopes of organic matter and can help the associations among specific geographic areas through the measurement of these dual isotopes. We report here on the development of a novel laser spectroscopy based system for the simultaneous analysis of the stable isotope ratios of carbon (13C/12C) and hydrogen (D/H) that is robust, easy-to-use, and is the first stable isotope ratio analysis system to combine the measurement of 13C/12C and D/H in one simple analysis from a bulk organic sample. The system comprises a combustion module to convert the organic sample into CO2 and H2O and a Cavity Ring-Down Spectrometer (CRDS) that analyzes the combustion species inside an optical cavity based on the molecular absorption of individual isotopomers. The CRDS uses dual lasers to target the four isotpomers of interest: 12CO2, 13CO2, H2O and HDO. The system delivers a typical precision of 0.1permil for δ13C and 1.5 permil for δD that parallels that achieved by IRMS, but with an unprecedented simplicity that allows scientists to leverage the science and map out the provenance of the analyzed
Probing the Statistical Decay and α-clustering effects in 12C + 12C and 14N + 10B reactions
Directory of Open Access Journals (Sweden)
Morelli L.
2014-03-01
Full Text Available An experimental campaign has been undertaken at Laboratori Nazionali di Legnaro (LNL INFN, Italy, in order to progress in our understanding of the statistical properties of light nuclei at excitation energies above particle emission threshold, by measuring exclusive data from fusion-evaporation reactions. On the experimental side, a first reaction: 12C+12C at 95 MeV beam energy has been measured, using the GARFIELD + Ring Counter (RCo apparatuses. Fusion-evaporation events have been exclusively selected out of the entire data set. The comparison to a dedicated Hauser-Feshbach calculation allows us to give constraints on the nuclear level density at high excitation energy for light systems ranging from C up to Mg. Out-of-equilibrium aα emission has been evidenced and attributed both to an entrance channel effect (favoured by the cluster nature of reaction partners, and, in more dissipative events, to the persistence of cluster correlations well above the 24Mg threshold for 6 α’s decay. In order to study the same 24Mg compound nucleus at similar excitation energy with respect to this first reaction a new measurement, 14N + 10B at 5.7 A.MeV, was performed at LNL laboratories with the same experimental setup. The comparison between the two systems would allow us to further constrain the level density of light nuclei in the mass-excitation energy range of interest. In this perspective, deviations from a statistical behaviour can be used as a tool to get information on nuclear clustering, both in the ground-state for projectile and target and in the hot source formed in the collision.
Multi-cluster dynamics in CΛ13 and analogy to clustering in 12C
Directory of Open Access Journals (Sweden)
Y. Funaki
2017-10-01
Full Text Available We investigate structure of CΛ13 and discuss the difference and similarity between the structures of C12 and CΛ13 by answering the questions if the linear-chain and gaslike cluster states, which are proposed to appear in C12, survives, or new structure states appear or not. We introduce a microscopic cluster model called, Hyper-Tohsaki–Horiuchi–Schuck–Röpke (H-THSR wave function, which is an extended version of the THSR wave function so as to describe Λ hypernuclei. We obtained two bound states and two resonance (quasi-bound states for Jπ=0+ in CΛ13, corresponding to the four 0+ states in C12. However, the inversion of level ordering between the spectra of C12 and CΛ13, i.e. that the 03+ and 04+ states in CΛ13 correspond to the 04+ and 03+ states in C12, respectively, is shown to occur. The additional Λ particle reduces sizes of the 02+ and 03+ states in CΛ13 very much, but the shrinkage of the 04+ state is only a half of the other states, in spite of the fact that attractive Λ-N interaction makes nucleus contracted so much when the Λ particle occupies an S-orbit. In conclusion, the Hoyle state becomes quite a compact object with BeΛ9+α configuration in CΛ13 and is no more gaslike state composed of the 3α clusters. Instead, the 04+ state in CΛ13, coming from the C12(03+ state, appears as a gaslike state composed of α+α+Λ5He configuration, i.e. the Hoyle analog state. A linear-chain state in a Λ hypernucleus is for the first time predicted to exist as the 03+ state in CΛ13 with more shrunk arrangement of the 3α clusters along z-axis than the 3α linear-chain configuration realized in the C12(04+ state. All the excited states are shown to appear around the corresponding cluster-decay threshold, reflecting the threshold rule.
Energy Technology Data Exchange (ETDEWEB)
Halfen, D. T.; Ziurys, L. M. [Department of Chemistry and Biochemistry, University of Arizona, 1305 E. 4th Street, Tucson, AZ 85719 (United States); Woolf, N. J., E-mail: halfend@email.arizona.edu [Department of Astronomy, Arizona Radio Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States)
2017-08-20
A study has been conducted of {sup 12}C/{sup 13}C ratios in five complex molecules in the Galactic center. H{sub 2}CS, CH{sub 3}CCH, NH{sub 2}CHO, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN and their {sup 13}C-substituted species have been observed in numerous transitions at 1, 2, and 3 mm, acquired in a spectral-line survey of Sgr B2(N), conducted with the telescopes of the Arizona Radio Observatory (ARO). Between 22 and 54 individual, unblended lines for the {sup 12}C species and 2–54 for {sup 13}C-substituted analogs were modeled in a global radiative transfer analysis. All five molecules were found to consistently exhibit two velocity components near V {sub LSR} ∼ 64 and 73 km s{sup −1}, with column densities ranging from N {sub tot} ∼ 3 × 10{sup 14} − 4 × 10{sup 17} cm{sup −2} and ∼2 × 10{sup 13} − 1 × 10{sup 17} cm{sup −2} for the {sup 12}C and {sup 13}C species, respectively. Based on 14 different isotopic combinations, ratios were obtained in the range {sup 12}C/{sup 13}C = 15 ± 5 to 33 ± 13, with an average value of 24 ± 7, based on comparison of column densities. These measurements better anchor the {sup 12}C/{sup 13}C ratio at the Galactic center, and suggest a slightly revised isotope gradient of {sup 12}C/{sup 13}C = 5.21(0.52) D {sub GC} + 22.6(3.3). As indicated by the column densities, no preferential {sup 13}C enrichment was found on the differing carbon sites of CH{sub 3}CCH, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN. Because of the elevated temperatures in Sgr B2(N), {sup 13}C isotopic substitution is effectively “scrambled,” diminishing chemical fractionation effects. The resulting ratios thus reflect stellar nucleosynthesis and Galactic chemical evolution, as is likely the case for most warm clouds.
Appreciation of cleft lip and palate treatment outcome by professionals and laypeople.
Papamanou, Despina A; Gkantidis, Nikolaos; Topouzelis, Nikolaos; Christou, Panagiotis
2012-10-01
The aim of the study was to analyse the aesthetic evaluation of head photographs of treated individuals with clefts by laypeople and professionals and to investigate how certain cephalometric variables could be related to their rating. A set of five standardized head photos (frontal, both laterals, three-quater right and left) of 12 Caucasian patients with treated unilateral cleft lip and palate were presented to 12 adult laypeople, 12 orthodontists, and 12 maxillofacial surgeons. For each set of photos the judges had to answer four questions on a visual analogue scale (VAS). The answers were analysed for intra- and inter-panel level of agreement and correlations of assessments with certain cephalometric parameters were determined. There was a high level of agreement for all assessments of each panel of raters. However, laypeople were less satisfied with lip and nose aesthetics compared to professionals. The three groups were similarly satisfied with the aesthetics of the jaws and the face. The anterior position of the maxilla (SNA) influenced positively professionals' ratings of facial aesthetics. Orthodontists were negatively influenced when the vertical dimension of the face or the distance of the lower lip to E-plane were relatively increased. The latter was the only cephalometric parameter correlated with lower aesthetic scores obtained from laypeople. Professionals report greater satisfaction from the treatment outcome and evaluate cleft consequences with less severity than laypeople. According to cephalometric findings, the relative positions of the lips seem to dominate facial aesthetics' appreciation by laypeople, while specialists appear to focus on different features of the face.
Korhonen, Vesa; Törmä, Sirpa
2016-01-01
The aim of this qualitative study was to identify teachers' ways of experiencing their identity and development challenges as teachers in the social and professional context of university. Identity and development as a teacher were examined based on interviews and drawings of career paths collected from a group of university teachers representing…
LENUS (Irish Health Repository)
Moorhead, Anne
2011-03-31
Abstract Background Health professionals working in primary care and public health have opportunities to address body weight status issues with their patients through face-to-face contact. The objectives of this all-Ireland project are: 1. to assess the attitudes, current practices\\/behaviours and knowledge of key health professional groups on body weight status; 2. to assess the health professional groups\\' ability to identify body weight status in both adults and children. The health professional groups are: (a) community related public health nurses; (b) school public health nurses; (c) GPs and practice nurses (primary care); and (d) occupational health nurses (workplace) from both Northern Ireland and the Republic of Ireland. Methods\\/Design This all-Ireland multi-disciplinary project follows a mixed methods approach using both quantitative and qualitative methodologies, and consists of four components: 1. Literature review - to explore the role of health professionals in managing obesity through spontaneous intervention in a variety of health promotion settings. 2. Telephone interviews and focus groups - to gain an in-depth insight into the views of health professionals in assessing body weight status. 3. Survey (primarily online but also paper-based) - to determine the attitudes, current practices\\/behaviours and knowledge of health professionals in assessing body weight status. 4. Online evaluation study - an online interactive programme will be developed to assess health professionals\\' ability to identify the body weight status of adults and children. Discussion This project will assess and report the attitudes, current practices\\/behaviours and knowledge of key health professional groups within Northern Ireland and the Republic of Ireland on body weight status, and their ability to identify body weight status in both adults and children. The results of this project will generate recommendations for clinical practice in managing obesity, which may
Directory of Open Access Journals (Sweden)
Murphy Kathy
2011-03-01
Full Text Available Abstract Background Health professionals working in primary care and public health have opportunities to address body weight status issues with their patients through face-to-face contact. The objectives of this all-Ireland project are: 1. to assess the attitudes, current practices/behaviours and knowledge of key health professional groups on body weight status; 2. to assess the health professional groups' ability to identify body weight status in both adults and children. The health professional groups are: (a community related public health nurses; (b school public health nurses; (c GPs and practice nurses (primary care; and (d occupational health nurses (workplace from both Northern Ireland and the Republic of Ireland. Methods/Design This all-Ireland multi-disciplinary project follows a mixed methods approach using both quantitative and qualitative methodologies, and consists of four components: 1. Literature review - to explore the role of health professionals in managing obesity through spontaneous intervention in a variety of health promotion settings. 2. Telephone interviews and focus groups - to gain an in-depth insight into the views of health professionals in assessing body weight status. 3. Survey (primarily online but also paper-based - to determine the attitudes, current practices/behaviours and knowledge of health professionals in assessing body weight status. 4. Online evaluation study - an online interactive programme will be developed to assess health professionals' ability to identify the body weight status of adults and children. Discussion This project will assess and report the attitudes, current practices/behaviours and knowledge of key health professional groups within Northern Ireland and the Republic of Ireland on body weight status, and their ability to identify body weight status in both adults and children. The results of this project will generate recommendations for clinical practice in managing obesity, which may
International Nuclear Information System (INIS)
Morton, David W.; Lui, Matthew P.W.; Young, Colin L.
2003-01-01
Previously, the investigation of the (gas + liquid) critical properties of (alkanol + alkane) mixtures has focussed on (primary alkanol + straight chain alkane) mixtures. The experimental data available for (alkanol + alkane) mixtures, which include secondary or tertiary alcohols and/or branched chain alkanes, are extremely limited. This work extends the existing body of data on (alkanol + alkane) mixtures to include mixtures containing these components. Here the (gas + liquid) critical temperatures of 29 {alkanol (C 2 -C 5 ) + alkane (C 5 -C 12 )} mixtures are reported. All the (gas + liquid) critical lines for the binary mixtures studied are continuous, indicating they obey either Type I or Type II phase behaviour
Quantum mechanics, group theory, and C60
International Nuclear Information System (INIS)
Rioux, F.
1994-01-01
The recent discovery of a new allotropic form of carbon and its production in macroscopic amounts has generated a tremendous amount of research activity in chemistry, physics, and material science. It has also provided educators with an exciting new vehicle for breathing fresh life into some old, well-established methods and principles. Recently, for example, Boo demonstrated the power of group theory in classifying existing and hypothetical fullerenes by their symmetries. In a similar spirit this note describes a model for the electronic structure of C 60 based on the most elementary principles of quantum mechanics and group theory
Walsh, N; George, S; Priest, L; Deakin, T; Vanterpool, G; Karet, B; Simmons, D
2011-12-01
Diabetes is a significant health concern, both in the UK and globally. Management can be complex, often requiring high levels of knowledge and skills in order to provide high-quality and safe care. The provision of good, safe, quality care lies within the foundations of healthcare education, continuing professional development and evidence-based practice, which are inseparable and part of a continuum during the career of any health professional. Sound education provides the launch pad for effective clinical management and positive patient experiences. This position paper reviews and discusses work undertaken by a Working Group under the auspices of Diabetes UK with the remit of considering all health professional educational issues for people delivering care to people with diabetes. This work has scoped the availability of education for those within the healthcare system who may directly or indirectly encounter people with diabetes and reviews alignment to existing competency frameworks within the UK's National Health Service. © 2011 The Authors. Diabetic Medicine © 2011 Diabetes UK.
Vertebral artery variations at the C1-2 level diagnosed by magnetic resonance angiography
Energy Technology Data Exchange (ETDEWEB)
Uchino, Akira; Saito, Naoko; Watadani, Takeyuki; Okada, Yoshitaka; Kozawa, Eito; Nishi, Naoko; Mizukoshi, Waka; Inoue, Kaiji; Nakajima, Reiko; Takahashi, Masahiro [Saitama Medical University International Medical Center, Department of Diagnostic Radiology, Hidaka, Saitama (Japan)
2012-01-15
The craniovertebral junction is clinically important. The vertebral artery (VA) in its several variations runs within this area. We report the prevalence of these VA variations on magnetic resonance angiography (MRA). We retrospectively reviewed MRA images, obtained using two 1.5-T imagers, of 2,739 patients, and paid special attention to the course and branching of the VA at the level of the C1-2 vertebral bodies. There were three types of VA variation at the C1-2 level: (1) persistent first intersegmental artery (FIA), (2) VA fenestration, and (3) posterior inferior cerebellar artery (PICA) originating from the C1/2 level. The overall prevalence of these three variations was 5.0%. There was no laterality in frequency, but we found female predominance (P < 0.05). We most frequently observed the persistent FIA (3.2%), which was sometimes bilateral. We found VA fenestration (0.9%) and PICA of C1/2 origin (1.1%) with almost equal frequency. Two PICAs of C1/2 origin had no normal VA branch. We frequently observed VA variations at the C1-2 level and with female predominance. The persistent FIA was most prevalent and sometimes seen bilaterally. Preoperative identification of these variations in VA is necessary to avoid complications during surgery at the craniovertebral junction. (orig.)
lin-12 Notch functions in the adult nervous system of C. elegans
Directory of Open Access Journals (Sweden)
Tucey Tim M
2005-07-01
Full Text Available Abstract Background Notch signaling pathways are conserved across species and traditionally have been implicated in cell fate determination during embryonic development. Notch signaling components are also expressed postdevelopmentally in the brains of adult mice and Drosophila. Recent studies suggest that Notch signaling may play a role in the physiological, rather than developmental, regulation of neurons. Here, we investigate a new non-developmental role for Caenorhabditis elegans lin-12 Notch signaling in neurons regulating the spontaneous reversal rate during locomotion. Results The spontaneous reversal rate of C. elegans during normal locomotion is constant. Both lin-12 gain and loss of function mutant animals had significantly increased reversal rates compared to wild type controls. These defects were caused by lin-12 activity, because the loss of function defect could be rescued by a wild type lin-12 transgene. Furthermore, overexpression of lin-12 recapitulated the gain-of-function defect. Increasing or decreasing lin-12 activity in the postdevelopmental adult animal was sufficient to rapidly and reversibly increase reversals, thereby excluding a developmental role for lin-12. Although lin-12 is expressed in the vulval and somatic gonad lineages, we find that these tissues play no role in regulating reversal rates. In contrast, altering lin-12 activity specifically in the nervous system was sufficient to increase reversals. These behavioral changes require components of the canonical lin-12 signaling cascade, including the ligand lag-2 and the transcriptional effector lag-1. Finally, the C. elegans AMPA/kainate glutamate receptor homolog glr-1 shows strong genetic interactions with lin-12, suggesting that glr-1 and/or other glutamate gated channels may be targets of lin-12 regulation. Conclusion Our results demonstrate a neuronal role for lin-12 Notch in C. elegans and suggest that lin-12 acutely regulates neuronal physiology to
Hepatitis C infection in risk groups
Directory of Open Access Journals (Sweden)
Sead Ahmetagić
2006-11-01
Full Text Available Hepatitis C infection is important global health problem with wide spectrum of health, social and economic consequences. The goal of this research was to estimate prevalence of hepatitis C virus infection in risk groups, and to determine association hepatitis C virus (HCV infection and risk factors. Research included 4627 subjects divided in two groups. Test group included 2627 subjects divided in 4 subgroups with risk for HCV infection: those who received blood transfusion without screening on HCV (it was introduced in 1995 (700; intravenous drug users (60; patients on hemodialysis (168 and health care workers (1699. Control group included 2000 healthy volunteer blood donors. In all subjects anti-HCV antibodies were tested with third generation ELISA test. Positive serum samples were tested for presence of HCVRNA, using reaction of reverse transcription and polymerase chain reaction. In all anti-HCV positive subjects further epidemiological and clinical workup was performed. Prevalence of HCV infection in risk groups was: 4.6% in subjects who have received blood transfusions without HCV blood screening, 35% in intravenous drug users, 58.9% in patients on chronic dialysis, and 0.4% in health care workers. In control group prevalence was low (0.2%. In the group of 158 anti-HCV positive subjects, 73.4% had HCVRNA. The largest number of subjects with HCV infection was in the age group of 30-49 years (45.8%. This study showed that multiple blood transfusions before introducing the blood screening for HCV, longer duration of intravenous drug abuse, longer duration of hemodialysis treatment, larger number of accidental injuries in health care workers are independent and statistically significant risk factors for those groups examined. Results of this study confirm that general screening for HCV infection is recommended in risk groups for HCV infection in order to identify to prevent and to treat it.
Differential cross section measurement of radiative capture of protons by nuclei 12C
International Nuclear Information System (INIS)
Burtebayev, N.; Zazulin, D.M.; Buminskii, V.P.; Zarifov, R.A.; Tohtarov, R.N.; Sagindykov, Sh.Sh.; Baktibayev, M.K.
2003-01-01
Measurements of differential cross sections of nuclear reaction 12 C(p, γ) 13 N at 0, 45, 90, 135 Deg. to beam direction of flying protons in the field of E p = 350-1100 KeV with an error it is not worse than 10 % have been carried out. Most important was studied, from the astrophysical point of view, process of capture of protons by nucleuses 12 C on the ground state of a nucleus 13 N. It is experimentally shown isotropy of angular distribution of differential cross sections of reaction 12 C(p, γ) 13 N, in the given field energy of protons
Spin alignment and density matrix measurement in 28Si + 12C orbiting reaction
International Nuclear Information System (INIS)
Ray, A.; Shapira, D.; Halbert, M.L.; Gomez del Campo, J.; Kim, H.J.; Sullivan, J.P.; Shivakumar, B.; Mitchell, J.
1990-01-01
Gamma-ray angular correlations have been measured for the strongly damped reactions 12 C( 28 Si, 12 C) 28 Si between θ cm = (120 degree - 160 degree) for E cm = 43.5 and 48 MeV. We find that the density matrices for the 12 C(2 1 + ) and 28 Si states are almost diagonal with respect to the direction of motion of the outgoing particle. The measured density matrices and spin alignments are consistent with the picture of formation of a long-lived dinuclear complex undergoing orbiting, bending and wriggling motions, but not with those obtained from statistical compound nucleus or sticking model calculations. 17 refs., 2 figs., 1 tab
Inhibitory effect of 12C6+ ion and X-ray on angiogenesis in HMEC-1
International Nuclear Information System (INIS)
Liu Yuanyuan; Zhang Hong; Liu Yang; Wu Zhenhua; Sun Chao; Li Hongyan
2013-01-01
The study aims to explore the effect of 12 C 6+ ion and X-ray on proliferation, migration, tube formation and MMPS of human microvascular endothelial cells (HMEC-1). Transwell migration experiment showed that the radiation could inhibit the migration of HMEC-1 in sub-lethal dose 24 h after irradiation. Furthermore, the inhibition ability of 12 C 6+ ion was stronger than that of X-ray. Matrigel experiment indicated that 12 C 6+ ion suppressed the tube formation of HMEC-1 spontaneously. However, the inhibitory effect of X-ray had no significance. Meanwhile, Gelatin Zymography showed the expression of MMP-2 was inhibited obviously by 12 C 6+ ion, while X-ray had little effect on the expression of MMP-2. In conclusion, 12 C 6+ ion is superior to X-ray in radiotherapy of tumor. (authors)
Role of the C-E owner group in the nuclear industry
International Nuclear Information System (INIS)
Gasper, J.K.
1988-01-01
The Combustion Engineering (C-E) owner group was formed in 1979 to address the technical and regulatory issues for plants with nuclear steam supply systems supplied by C-E that resulted from the accident at the Three Mile Island plant. The group addressed many of the immediate concerns from the accident including the response of C-E owner-group plants to small-break loss-of-coolant accidents, the use of power-operated relief valves, emergency operating procedure upgrades, as well as transient and accident responses. The group was successful in addressing these technical and regulatory issues with the US Nuclear Regulatory Commission in such a manner that C-E owner-group plants were not required to shut down or operate at reduced power levels. In recent years, the group has increasingly pursued programs for the benefit of its members rather than because of a regulatory commitment. The major current activities of the group are programs to support the design basis reconstruction of our member plants, improvements to emergency procedure guidelines, which are the basis for the emergency operating procedures used in our plants, a charging pump performance improvement program, various activities to reduce the number of unplanned reactor scrams at our plants, modeling of steam generator corrosion mechanisms to improve steam generator performance, and leak-before-break justification of reactor coolant system piping
Probing the possibility of a 12C13C abundance gradient from observations of interstellar CH+
International Nuclear Information System (INIS)
Hawkins, I.
1987-01-01
I have performed high signal-to-noise (SN /equals/ 300 to 500) observations of interstellar CH/sup /plus// at Lick Observatory and at CTIO of the reddened, early-type stars HD 183143, HD 24432, and HD 157038 in an effort to probe the existence of a 12 C 13 C abundance gradient in our Galaxy
Differential regulation of iPLA2beta splice variants by in vitro ischemia in C2C12 myotubes
DEFF Research Database (Denmark)
Poulsen, K. A.; Kolko, M.; Lambert, I. H.
2006-01-01
In this study we investigated the activity, expression and regulation of iPLA2 during ischemia in mouse C2C12 myotubes. Here, we show that in vitro ischemia, i.e. oxygen deprivation and glucose starvation, induces an iPLA2 activity that is totally reversed by siRNA knock down of iPLA2£], indicating...... preferential activation of iPLA2£]. The activity of the native iPLA2£] tetramer has in humans been proposed to be negatively regulated by interactions with catalytic inactive splice variants of the full-length protein. These variants, characterized by the presence exon 9a, have however not been identified...... of this transcript would be a C-terminally truncated î50 kDa protein lacking the catalytic site. qPCR indicated that, while the total iPLA2£] mRNA level in C2C12 myotubes increased weakly within 1-2 hours of in vitro ischemia, the transcript containing the mouse exon 9a was rapidly down regulated. In addition...
Andreasson, Jesper; Johansson, Thomas
2016-01-01
This article analyses fitness professionals' perceptions and understanding of their occupational education and pedagogical pursuance, framed within the emergence of a global fitness industry. The empirical material consists of interviews with personal trainers and group fitness instructors, as well as observations in their working environment. In…
Bipolaron formation in B/sub 12/ and (B/sub 11/C)/sup +/ icosahedra
International Nuclear Information System (INIS)
Howard, I.A.; Beckel, C.L.; Emin, D.
1987-01-01
Boron carbides, B/sub 1-x/C/sub x/ with 0.085 ≤ x ≤ 0.200, generally contain both B/sub 12/ and B/sub 11/C icosahedra. However, the electronic transport with 0.1 ≤ x ≤ 0.2 is believed to occur by means of bipolaron hopping between only B/sub 11/C icosahedra. The authors have calculated the changes in energy, atomic positions and charge distribution when a pair of electrons is added to the isoelectronic icosahedral clusters B/sub 12/ and (B/sub 11/C)/sup +/. They simulate an icosahedron in a neutral lattice by bonding the icosahedral atoms to hydrogenic atoms which the authors constrain to be neutral. The computations are performed with a self-consistent molecular-orbital method, PRDDO. They find a total energy reduction of -- 3.7 eV for two electrons added to a B/sub 12/ icosahedron. Of this, -- 2.7 eV arises from the electrons filling the icosahedron's bonding orbitals. The remaining -- 1.0 eV comes from the contraction of the icosahedron's radius by -- 0.09 A. For two electrons added to a (B/sub 11/C)/sup +/ icosahedron the authors find a total energy reduction of -- 18.2 eV. Of this, -- 16.5 eV arises from filling the icosahedron's bonding orbitals. The remainder arises from a -- 0.09 A contraction of the icosahedron's radius. Thus, the authors find (B/sub 11/C)/sup +/ icosahedra to be strongly energetically favored over B/sub 12/ icosahedra as bipolaron sites. The positive charge associated with a (B/sub 11/C)/sup +/ icosahedron is distributed over the eleven boron atoms. Concomitantly, they find the added two electrons of the bipolaron to be distributed over all twelve sites of the B/sub 11/C icosahedron. They find the energy difference between an electron pair added to B/sub 12/ and (B/sub 11/C)/sup +/ icosahedra to arise principally from the increased Coulombic attraction provided by the extra positive charge of the (B/sub 11/C)/sup +/ icosahedron
Deformation effects in the 20Ne+12C reaction
International Nuclear Information System (INIS)
Dey, A.; Bhattacharya, C.; Banerjee, K.; Kundu, S.; Mukhopadhyay, S.; Gupta, D.; Saha, R.; Bhattacharya, S.
2004-01-01
The present work has been performed with the aim to investigate the possible occurrence of highly deformed configurations of the 32 S di-nuclear systems which may be formed in the 20 Ne+ 12 C reaction by studying the properties of emitted light charged particles
Measurement of the /sup 12/C(n,γ0)/sup 13/C cross section in the giant dipole resonance region
International Nuclear Information System (INIS)
August, R.A.; Weller, H.R.; Tilley, D.R.
1987-01-01
The /sup 12/C(n,γ 0 ) /sup 13/C excitation function at 90 0 has been measured for neutron energies from 6.5 to 18.5 MeV. Whereas previous measurements disagreed at the lower energies with a direct-semidirect capture calculation based on /sup 12/C(p,γ 0 ) /sup 13/N data, the present results, especially when the uncertainty in absolute cross section is considered, indicate reasonable qualitative agreement with the calculation
Disintegration of {sup 12}C nuclei by 700–1500 MeV photons
Energy Technology Data Exchange (ETDEWEB)
Nedorezov, V. [Institute for Nuclear Research, Russian Academy of Sciences, Prospekt 60-letiya Oktyabrya 7a, 117312 Moscow (Russian Federation); D' Angelo, A.; Bartalini, O. [Dipartimento di Fisica – Università degli Studi di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Bellini, V. [Dipartimento di Fisica – Università degli Studi di Catania, via Santa Sofia 64, I-95123 Catania (Italy); INFN – Sezione di Catania, via Santa Sofia 64, I-95123 Catania (Italy); Capogni, M. [Dipartimento di Fisica – Università degli Studi di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Casano, L.E. [INFN – Sezione di Roma “Tor Vergata”, via della Ricerca Scientifica 1, I-00133 Roma (Italy); Castoldi, M. [Dipartimento di Fisica – Università degli Studi di Genova, via Dodecaneso 33, I-16146 Genova (Italy); Curciarello, F.; De Leo, V. [Dipartimento di Fisica e di Scienze della Terra, Università di Messina, salita Sperone 31, I-98166 Messina (Italy); INFN – Sezione di Catania, via Santa Sofia 64, I-95123 Catania (Italy); Didelez, J.-P. [IN2P3, Institut de Physique Nucléaire, Rue Georges Clemenceau, F-91406 Orsay (France); and others
2015-08-15
Disintegration of {sup 12}C nuclei by tagged photons of 700–1500 MeV energy at the GRAAL facility has been studied by means of the LAGRANγE detector with a wide angular acceptance. The energy and momentum distributions of produced neutrons and protons as well as their multiplicity distributions were measured and compared with corresponding distributions calculated with the RELDIS model based on the intranuclear cascade and Fermi break-up models. It was found that eight fragments are created on average once per about 100 disintegration events, while a complete fragmentation of {sup 12}C into 12 nucleons is observed typically only once per 2000 events. Measured multiplicity distributions of produced fragments are well described by the model. The measured total photoabsorption cross section on {sup 12}C in the same energy range is also reported.
Wang, Xiaoli; Cho, Sool Yeon; Hu, Cing Siang; Chen, Daniel; Roboz, John; Hoffman, Ronald
2015-02-01
Myelofibrosis (MF) is characterized by the constitutive mobilization of hematopoietic stem cells (HSC) and hematopoietic progenitor cells (HPC) and the establishment of extramedullary hematopoiesis. The mechanisms underlying this abnormal HSC/HPC trafficking pattern remain poorly understood. We demonstrated that both splenic and peripheral blood (PB) MF CD34(+) cells equally share a defective ability to home to the marrow, but not to the spleens, of NOD/LtSz-Prkdc(scid) mice. This trafficking pattern could not be attributed to discordant expression of integrins or chemokine receptors other than the downregulation of C-X-C chemokine receptor type 4 by both PB and splenic MF CD34(+) cells. The number of both splenic MF CD34(+) cells and HPCs that migrated toward splenic MF plasma was, however, significantly greater than the number that migrated toward PB MF plasma. The concentration of the intact HSC/HPC chemoattractant C-X-C motif chemokine 12 (CXCL12) was greater in splenic MF plasma than PB MF plasma, as quantified using mass spectrometry. Functionally inactive truncated products of CXCL12, which are the product of proteolytic degradation by serine proteases, were detected at similar levels in both splenic and PB MF plasma. Treatment with an anti-CXCL12 neutralizing antibody resulted in a reduction in the degree of migration of splenic MF CD34(+) cells toward both PB and splenic MF plasma, validating the role of CXCL12 as a functional chemoattractant. Our data indicate that the MF splenic microenvironment is characterized by increased levels of intact, functional CXCL12, which contributes to the localization of MF CD34(+) cells to the spleen and the establishment of extramedullary hematopoiesis. Copyright © 2015 ISEH - International Society for Experimental Hematology. Published by Elsevier Inc. All rights reserved.
Proportional Counter Calibration and Analysis for 12C + p Resonance Scattering
Nelson, Austin; Rogachev, Grigory; Uberseder, Ethan; Hooker, Josh; Koshchiy, Yevgen
2014-09-01
Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Funded by DOE and NSF-REU Program; Grant No. PHY-1263281.
Wholey, Douglas R; Disch, Joanne; White, Katie M; Powell, Adam; Rector, Thomas S; Sahay, Anju; Heidenreich, Paul A
2014-01-01
Leadership by health care professionals is likely to vary because of differences in the social contexts within which they are situated, socialization processes and societal expectations, education and training, and the way their professions define and operationalize key concepts such as teamwork, collaboration, and partnership. This research examines the effect of the nurse and physician leaders on interdependence and encounter preparedness in chronic disease management practice groups. The aim of this study was to examine the effect of complementary leadership by nurses and physicians involved in jointly producing a health care service on care team functioning. The design is a retrospective observational study based on survey data. The unit of analysis is heart failure care groups in U.S. Veterans Health Administration medical centers. Survey and administrative data were collected in 2009 from 68 Veterans Health Administration medical centers. Key variables include nurse and physician leadership, interdependence, psychological safety, coordination, and encounter preparedness. Reliability and validity of survey measures were assessed with exploratory factor analysis and Cronbach alphas. Multivariate analyses tested hypotheses. Professional leadership by nurses and physicians is related to encounter preparedness by different paths. Nurse leadership is associated with greater team interdependence, and interdependence is positively associated with respect. Physician leadership is positively associated with greater psychological safety, respect, and shared goals but is not associated with interdependence. Respect is associated with involvement in learning activities, and shared goals are associated with coordination. Coordination and involvement in learning activities are positively associated with encounter preparedness. By focusing on increasing interdependence and a constructive climate, nurse and physician leaders have the opportunity to increase care coordination
Some Remarks on Group Bundles and C*-dynamical systems
Vasselli, Ezio
2003-01-01
We introduce the notion of fibred action of a group bundle on a C(X)-algebra. By using such a notion, a characterization in terms of induced C*-bundles is given for C*-dynamical systems such that the relative commutant of the fixed-point algebra is minimal (i.e., it is generated by the centre of the given C*-algebra and the centre of the fixed-point algebra). A class of examples in the setting of the Cuntz algebra is given, and connections with superselection structures with nontrivial centre...
International Nuclear Information System (INIS)
Bauhoff, W.
1983-01-01
The excitation of the 0 2 + (7.65 MeV) state in 12 C by inelastic alpha scattering is investigated using microscopic resonating-group wave-functions in a coupled channel folding model. The importance of coupling to other states and the influence of varying the optical potential in the excited states is studied. Both effects must be taken into account for a quantitative description
DEFF Research Database (Denmark)
Straadt, Ida K; Young, Jette F; Petersen, Bent O
2010-01-01
to anaerobic metabolism due to inhibition of the aerobic pathway in the mitochondria. Conversely, lower levels of unlabeled ((12)C) lactate were apparent at increasing severity of stress, which indicate that lactate is released from the myotubes to the medium. In conclusion, the metabolites identified......In the present study, the metabolic effects of heat and anoxic stress in myotubes from the mouse cell line C2C12 were investigated by using a combination of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy and enrichment with [(13)C]-glucose. Both the (13)C and the (1)H NMR...... spectra showed reduced levels of the amino acids alanine, glutamate, and aspartate after heat or anoxic stress. The decreases were smallest at 42 degrees C, larger at 45 degrees C, and most pronounced after anoxic conditions. In addition, in both the (1)H and the (31)P NMR spectra, decreases in the high...
Ferretti, Maria Santa
Job satisfaction and organizational commitment have long been identified as relevant factors for the well-being of individuals within an organization and the success of the organization itself. As the well-being can be, in principle, considered as emergent from the influence of a number of factors, the main goal of a theory of organizations is to identify these factors and the role they can play. In this regard job satisfaction and organizational commitment have been often identified with structural factors allowing an organization to be considered as a system, or a wholistic entity, rather than a simple aggregate of individuals. Furthermore, recent studies have shown that job satisfaction has a significant, direct effect on determining individuals' attachment to an organization and a significant but indirect effect on their intention to leave a company. However, a complete assessment of the role of these factors in establishing and keeping the emergence of an organization is still lacking, due to shortage of measuring instruments and to practical difficulties in interviewing organization members. The present study aims to give a further contribution to what is currently known about the relationship between job satisfaction and affective commitment by using a group of professionals, all at management level. A questionnaire to measure these constructs, following a pilot study, was designed and administered to 1042 participants who were all professionals and had the title of industrial manager or director. The factors relating to job satisfaction and the predictive value of these factors (to predict an employee's emotional involvement with their organization) were simultaneously tested by a confirmative factorial model. The results were generalized with a multi-sample procedure by using models of structural equations. This procedure was used to check whether these factors could be considered or not as causes producing the measured affective commitment. The results
Directory of Open Access Journals (Sweden)
Lomax Michael A
2007-03-01
Full Text Available Abstract Background The ubiquitin-proteasome system is the predominant pathway for myofibrillar proteolysis but a previous study in C2C12 myotubes only observed alterations in lysosome-dependent proteolysis in response to complete starvation of amino acids or leucine from the media. Here, we determined the interaction between insulin and amino acids in the regulation of myotube proteolysis Results Incubation of C2C12 myotubes with 0.2 × physiological amino acids concentration (0.2 × PC AA, relative to 1.0 × PC AA, significantly increased total proteolysis and the expression of 14-kDa E2 ubiquitin conjugating enzyme (p Conclusion In a C2C12 myotube model of myofibrillar protein turnover, amino acid limitation increases proteolysis in a ubiquitin-proteasome-dependent manner. Increasing amino acids or leucine alone, act additively with insulin to down regulate proteolysis and expression of components of ubiquitin-proteasome pathway. The effects of amino acids on proteolysis but not insulin and leucine, are blocked by inhibition of the mTOR signalling pathway.
Molle, Daniella
2010-01-01
The lack of empirical scholarship on professional development initiatives for teachers of English language learners (ELLs) in US schools has been repeatedly documented in educational research. The present dissertation project examines a professional development course specifically designed for K-12 teachers of ELLs. The course aims to foster the…
Energy and macronutrient intakes of professional football (soccer) players.
Maughan, R J
1997-03-01
To examine the dietary habits of professional soccer players at two Scottish Premier League clubs during the competitive season. A study of the dietary intake of 51 professional soccer players with two different clubs was carried out by the seven day weighed intake method. Physical characteristics of the two groups of players were similar, with only small differences in age and body mass but no difference in height and body fat. Mean (SD) daily energy intake for club A was 11.0 (2.6) MJ, and for club B 12.8 (2.2) MJ. The higher energy intake at club B was largely accounted for by a higher (P macronutrients to total energy intake was broadly similar to that of the general population.
The level structure of 13C around Esub(x)=20 MeV studied by polarised neutron scattering from 12C
International Nuclear Information System (INIS)
Tornow, W.; Woye, E.
1987-01-01
Analysing-power data for elastic scattering of neutrons from 12 C have been obtained at selected angles in small energy steps between incident energies of 15.55 and 17.35 MeV. The excitation energy, spin and parity of levels in 13 C have been determined for excitation energies around 20 MeV via a phase-shift analysis of these data and of previously measured n- 12 C total cross section data. In addition, an auxiliary phase-shift analysis has been performed in the neutron energy range from 12 to 15 MeV. All experimental data are well reproduced by the phase shifts obtained. The need for further experimental data is pointed out. (author)
Quasielastic C-12(e,e ' p) reaction at high momentum transfer
Morrison, JH; Baghaei, H; Bertozzi, W; Gilad, S; Glickman, J; Hyde-Wright, CE; Kalantar-Nayestanaki, N; Lourie, RW; Penn, S; Ulmer, PE; Weinstein, LB; Cottman, BH; Ghedira, L; Winhold, EJ; Calarco, J.R.; Wise, J; Boberg, P; Chang, CC; Zhang, D; Aniol, K; Epstein, MB; Margaziotis, DJ; Finn, JM; Perdrisat, C; Punjabi, P.
We measured the C-12(e,e'p) cross section as a function of missing energy in parallel kinematics for (q,omega)=(970 MeV/c, 330 MeV) and (990 MeV/c, 475 MeV). At omega=475 MeV, at the maximum of the quasielastic peak, there is a large continuum (E-m>50 MeV) cross section extending out to the deepest
Energy Technology Data Exchange (ETDEWEB)
Chu, Weiwei; Wei, Wei; Yu, Shigang; Han, Haiyin; Shi, Xiaoli [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); Sun, Wenxing [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); College of Public Health, Nantong University, Nantong 226019 (China); Gao, Ying [College of Veterinary Medicine, Nanjing Agricultural University, Nanjing 210095 (China); Zhang, Lifan [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China); Chen, Jie, E-mail: jiechen@njau.edu.cn [College of Animal Science and Technology, Nanjing Agricultural University, Nanjing 210095 (China)
2016-03-25
Obesity is a well-established risk factor to health for its relationship with insulin resistance, diabetes and metabolic syndrome. Myocyte-adipocyte crosstalk model plays a significant role in studying the interaction of muscle and adipose development. Previous related studies mainly focus on the effects of adipocytes on the myocytes activity, however, the influence of myotubes on the preadipocytes development remains unclear. The present study was carried out to settle this issue. Firstly, the co-culture experiment showed that the proliferation, cell cycle, and differentiation of 3T3-L1 preadipocytes were arrested, and the apoptosis was induced, by differentiated C2C12 myotubes. Next, the sensitivity of 3T3-L1 preadipocytes to glucocorticoids (GCs), which was well known as cell proliferation, differentiation, apoptosis factor, was decreased after co-cultured with C2C12 myotubes. What's more, our results showed that C2C12 myotubes suppressed the mRNA and protein expression of glucocorticoid receptor (GR) in 3T3-L1 preadipocytes, indicating the potential mechanism of GCs sensitivity reduction. Taken together, we conclude that C2C12 myotubes inhibited 3T3-L1 preadipocytes proliferation and differentiation by reducing the expression of GR. These data suggest that decreasing GR by administration of myokines may be a promising therapy for treating patients with obesity or diabetes. - Highlights: • C2C12 myotubes inhibited proliferation and differentiation of 3T3-L1 preadipocytes. • C2C12 myotubes arrested cell cycle of 3T3-L1 preadipocytes. • C2C12 myotubes induced apoptosis of 3T3-L1 preadipocytes. • C2C12 inhibit 3T3-L1 cells by reducing the expression of glucocorticoid receptor gene.
Evaluation of n-{sup 12}C scattering between 7 and 26 MeV
Energy Technology Data Exchange (ETDEWEB)
Chen, Z P; Tornow, W [Department of Physics, Duke University, Durham, NC 27708-0308 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708-0308 (United States)
2005-11-01
The existing n-{sup 12}C elastic differential cross-section, analysing power and total cross-section data in the energy range from 7 to 26 MeV were analysed via a phase-shift analysis. A very good description of the uniquely large database has been achieved. The level parameters of 40 states or resonances in {sup 13}C were deduced. The values obtained for the n-{sup 12}C reaction cross section are larger than those given in the ENDF/B-VI evaluation.
Xu, Qi; Luo, Jiao; Wu, Ning; Zhang, Renshuai; Shi, Dayong
2018-01-01
Insulin resistance is a key feature of type 2 diabetes mellitus (T2DM) and is characterized by defects in insulin signaling. Protein tyrosine phosphatase 1B (PTP1B) is a major negative regulator of insulin signaling cascade and has attracted intensive investigation in recent T2DM therapy study. BPN, a marine-derived bromophenol compound, was isolated from the red alga Rhodomela confervoides. This study investigated the effects of BPN on the insulin signaling pathway in insulin-resistant C2C12 myotubes by inhibiting PTP1B. Molecular docking study and analysis of small- molecule interaction with PTP1B all showed BPN inhibited PTP1B activity via binding to the catalytic site through hydrogen bonds. We then found that BPN permeated into C2C12 myotubes, on the one hand, activated insulin signaling in an insulin-independent manner in C2C12 cells; on the other hand, ameliorated palmitate-induced insulin resistance through augmenting insulin sensitivity. Moreover, our studies also showed that PTP1B inhibition by BPN increased glucose uptake in normal and insulin-resistant C2C12 myotubes through glucose transporter 4 (GLUT4) translocation. Taken together, BPN activates insulin signaling and alleviates insulin resistance and represents a potential candidate for further development as an antidiabetic agent. Copyright © 2017 Elsevier B.V. All rights reserved.
Fredheim, Terje; Danbolt, Lars J; Haavet, Ole R; Kjønsberg, Kari; Lien, Lars
2011-05-23
Collaboration between general practice and mental health care has been recognised as necessary to provide good quality healthcare services to people with mental health problems. Several studies indicate that collaboration often is poor, with the result that patient' needs for coordinated services are not sufficiently met, and that resources are inefficiently used. An increasing number of mental health care workers should improve mental health services, but may complicate collaboration and coordination between mental health workers and other professionals in the treatment chain. The aim of this qualitative study is to investigate strengths and weaknesses in today's collaboration, and to suggest improvements in the interaction between General Practitioners (GPs) and specialised mental health service. This paper presents a qualitative focus group study with data drawn from six groups and eight group sessions with 28 health professionals (10 GPs, 12 nurses, and 6 physicians doing post-doctoral training in psychiatry), all working in the same region and assumed to make professional contact with each other. GPs and mental health professionals shared each others expressions of strengths, weaknesses and suggestions for improvement in today's collaboration. Strengths in today's collaboration were related to common consultations between GPs and mental health professionals, and when GPs were able to receive advice about diagnostic treatment dilemmas. Weaknesses were related to the GPs' possibility to meet mental health professionals, and lack of mutual knowledge in mental health services. The results describe experiences and importance of interpersonal knowledge, mutual accessibility and familiarity with existing systems and resources. There is an agreement between GPs and mental health professionals that services will improve with shared knowledge about patients through systematic collaborative services, direct cell-phone lines to mental health professionals and allocated
Directory of Open Access Journals (Sweden)
Haavet Ole R
2011-05-01
Full Text Available Abstract Background Collaboration between general practice and mental health care has been recognised as necessary to provide good quality healthcare services to people with mental health problems. Several studies indicate that collaboration often is poor, with the result that patient' needs for coordinated services are not sufficiently met, and that resources are inefficiently used. An increasing number of mental health care workers should improve mental health services, but may complicate collaboration and coordination between mental health workers and other professionals in the treatment chain. The aim of this qualitative study is to investigate strengths and weaknesses in today's collaboration, and to suggest improvements in the interaction between General Practitioners (GPs and specialised mental health service. Methods This paper presents a qualitative focus group study with data drawn from six groups and eight group sessions with 28 health professionals (10 GPs, 12 nurses, and 6 physicians doing post-doctoral training in psychiatry, all working in the same region and assumed to make professional contact with each other. Results GPs and mental health professionals shared each others expressions of strengths, weaknesses and suggestions for improvement in today's collaboration. Strengths in today's collaboration were related to common consultations between GPs and mental health professionals, and when GPs were able to receive advice about diagnostic treatment dilemmas. Weaknesses were related to the GPs' possibility to meet mental health professionals, and lack of mutual knowledge in mental health services. The results describe experiences and importance of interpersonal knowledge, mutual accessibility and familiarity with existing systems and resources. There is an agreement between GPs and mental health professionals that services will improve with shared knowledge about patients through systematic collaborative services, direct cell
Neutron scattering from [sup 12]C between 15. 6 and 17. 3 MeV
Energy Technology Data Exchange (ETDEWEB)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (United States). Dept. of Physics Triangle Universities Nuclear Lab., Durham, NC (United States))
1993-06-01
The differential cross section [sigma]([theta]) for neutron elastic scattering from [sup 12]C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The [sigma]([theta]) data, together with published analysing power A[sub y]([theta]) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present [sup 12]C(n,n)[sup 12]C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in [sup 11]C via an iterative-moment approach or a dispersive optical-model analysis. (author).
Nislin, Mari A.; Sajaniemi, Nina K.; Sims, Margaret; Suhonen, Eira; Maldonado Montero, Enrique F.; Hirvonen, Ari; Hyttinen, Sirpa
2016-01-01
The aim of this study was to investigate the relationship between early childhood professionals' (ECPs) stress regulation (using salivary cortisol and alpha-amylase [AA] measurements), work engagement and the quality of their pedagogical work in integrated special day-care groups. Participants were 89 ECPs from 21 integrated special day-care…
International Nuclear Information System (INIS)
Angelov, N.S.; Grishin, V.G.; Nad', Yu.; Kanarek, T.; Batskovich, S.
1978-01-01
The multiplicities of secondary charged particles in π -12 C-interactions with ν-protons of carbon nucleus at p=40 GeV/c (ν=1-5) is presented. It is shown that the dependence of the average values of particle multiplicities on ν approximately equals the dependence on initial pion energy in π - p-interactions in the range from 40 to 200 GeV. KNO scaling and the Wroblewski empirical law for interactions with several nucleons of 12 C nucleus are observed
Elastic and inelastic scattering of 800 MeV/c K+- mesons from 12C and 40Ca
International Nuclear Information System (INIS)
Marlow, D.R.
1981-04-01
Methods and results of an experiment to study the scattering of 800 MeV/c K +- mesons from 12 C and 40 Ca are presented. The reactions under study include: the four elastic scattering reactions 12 C(K +- ,K +- ) and 40 Ca(K +- ,K +- ), and the four inelastic scattering reactions, 12 C(K +- .K +- ') to the J/sup P/ = 2 + 4.43 MeV and J/sup P/ = 3 - states. The experimental data were obtained using the Hyper-Nuclear Spectrometer and the Low Energy Separated Beam (LESB I) at the Alternating Gradient Synchrotron (AGS) of Brookhaven Laboratory (BNL). Calculations using the program PIRK, an optical potential code, are compared to the elastic data. The results of a second set of calculations, using Glauber theory are also presented. Both sets of calculations use as input: the results of partial wave analyses of kaon nucleon scattering data, and nuclear shapes as determined from the results of electron nucleus scattering experiments. The agreement between the experimental data and the theoretical predictions is reasonable over the angular range of the data, with the exception of Glauber calculations of the K + elastic scattering. In those cases, the eikonal approximation proves to be a poor approximation. Smaller discrepancies are found in some other cases, indicating the possible need for more sophisticated calculations
A nutritional evaluation of dietary behaviour in various professional sports.
Pilis, Karol; Michalski, Cezary; Zych, Michał; Pilis, Anna; Jelonek, Jakub; Kaczmarzyk, Agata; Pilis, Wiesław
2014-01-01
The types of physical exertion undertaken by weightlifters and race walkers markedly differ. This difference should also be reflected in their respective diets. The aim of the study was to investigate and assess the diets of professional weightlifters and race walkers, along with a comparison to the diets of those students studying physical education (PE). Materials and Methods. Subjects were respectively 12 weightlifters, 12 race walkers and 12 physical education students whose body composition and nutrition were determined by weighing the foods that were both eaten and drunk. The study groups showed body differences, which may have arisen through dietary differences. Higher calorie diets were observed for race walkers according to body mass whilst weightlifters showed no difference with the other groups. Dietary intakes of protein, fat, and carbohydrates were however inappropriate for all groups. Vitamin and mineral intakes in weightlifters and students were within tolerable limits, but the rather aggressive taking of supplements by race walkers resulted in standard/recommended consumption levels being greatly exceeded in some cases. The diets of the study groups of weightlifters and race walkers need to be corrected. nutrition in sport, weightlifting, race walking, food supplementation.
Vitamin C and E Supplementation Effects in Professional Soccer Players Under Regular Training
Directory of Open Access Journals (Sweden)
Stancanneli Mirtes
2006-12-01
Full Text Available Abstract Exercise training is known to induce an increase in free radical production potentially leading to enhanced muscle injury. Vitamins C and E are well known antioxidants that may prevent muscle cell damage. The purpose of this study was to determine the effects of these supplemental antioxidant vitamins on markers of oxidative stress, muscle damage and performance of elite soccer players. Ten male young soccer players were divided into two groups. Supplementation group (n = 5 received vitamins C and E supplementation daily during the pre-competitive season (S group, while the placebo group (PL group, n = 5 received a pill containing maltodextrin. Both groups performed the same training load during the three-month pre-season training period. Erythrocyte antioxidant enzymes glutathione reductase, catalase and plasma carbonyl derivatives did not show any significant variation among the experimental groups. Similarly, fitness level markers did not differ among the experimental groups. However, S group demonstrated lower lipid peroxidation and muscle damage levels (p
12 CFR 563c.1 - Form and content of financial statements.
2010-01-01
... ACCOUNTING REQUIREMENTS Form and Content of Financial Statements § 563c.1 Form and content of financial... statements shall: (1) Be prepared and presented in accordance with generally accepted accounting principles... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Form and content of financial statements. 563c...
DEFF Research Database (Denmark)
Straadt, Ida K; Young, Jette F; Petersen, Bent O
2010-01-01
In this study, stress in relation to slaughter was investigated in a model system by the use of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy for elucidating changes in the metabolites in C2C12 myotubes exposed to H(2)O(2)-induced stress. Oxidative stress resulted in lower...... to lower levels of the unlabeled ((12)C) lactate were identified in the (1)H spectra after stress exposure. These data indicate an increase in de novo synthesis of alanine, concomitant with a release of lactate from the myotubes to the medium at oxidative stress conditions. The changes in the metabolite...
Genetic disorders of vitamin B12 metabolism: eight complementation groups – eight genes
Froese, D. Sean; Gravel, Roy A.
2010-01-01
Vitamin B12 (cobalamin, Cbl) is an essential nutrient in human metabolism. Genetic diseases of vitamin B12 utilisation constitute an important fraction of inherited newborn disease. Functionally, B12 is the cofactor for methionine synthase and methylmalonyl CoA mutase. To function as a cofactor, B12 must be metabolised through a complex pathway that modifies its structure and takes it through subcellular compartments of the cell. Through the study of inherited disorders of vitamin B12 utilisation, the genes for eight complementation groups have been identified, leading to the determination of the general structure of vitamin B12 processing and providing methods for carrier testing, prenatal diagnosis and approaches to treatment. PMID:21114891
Characteristics of the groups of charged particles in bar pp,pp and K-p interactions at 32 GeV/c
International Nuclear Information System (INIS)
Bogolubsky, M.Yu.; Levitsky, M.S.; Maksimov, V.V.
1995-01-01
In the clan model, a method is developed for determining the following characteristics of the groups of charged particles: group multiplicity in an interval, particle multiplicity in a group, and width distribution of groups. Distribution densities are obtained for particles originating from clans produced at a given rapidity point with given width in bar pp, K - p, and pp interactions at 32 GeV/c. It is shown that the differences in the rate of growth of factorial moments in bar pp and K - p interactions are due to a difference in the relative contributions of small-width clans. 12 refs., 13 figs., 2 tabs
Integral measurement of the {sup 12}C(n, p){sup 12}B reaction up to 10 GeV
Energy Technology Data Exchange (ETDEWEB)
Zugec, P.; Bosnar, D. [University of Zagreb, Department of Physics, Faculty of Science, Zagreb (Croatia); Colonna, N.; Barbagallo, M.; Mastromarco, M.; Tagliente, G.; Variale, V. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Ventura, A. [Istituto Nazionale di Fisica Nucleare, Bologna (Italy); Mengoni, A. [ENEA, Bologna (Italy); Altstadt, S.; Langer, C.; Lederer, C.; Reifarth, R.; Schmidt, S.; Weigand, M. [Johann-Wolfgang-Goethe Universitaet, Frankfurt (Germany); Andrzejewski, J.; Marganiec, J.; Perkowski, J. [Uniwersytet Lodzki, Lodz (Poland); Audouin, L.; Leong, L.S.; Tassan-Got, L. [Centre National de la Recherche Scientifique/IN2P3 - IPN, Orsay (France); Becares, V.; Cano-Ott, D.; Garcia, A.R.; Gonzalez-Romero, E.; Martinez, T.; Mendoza, E. [Centro de Investigaciones Energeticas Medioambientales y Tecnologicas (CIEMAT), Madrid (Spain); Becvar, F.; Krticka, M.; Kroll, J.; Valenta, S. [Charles University, Prague (Czech Republic); Belloni, F.; Mondalaers, W.; Plompen, A.; Schillebeeckx, P. [European Commission JRC, Institute for Reference Materials and Measurements, Geel (Belgium); Berthoumieux, E.; Fraval, K.; Gunsing, F. [CEA/Saclay - IRFU, Gif-sur-Yvette (France); Billowes, J.; Ware, T.; Wright, T. [University of Manchester, Manchester (United Kingdom); Boccone, V.; Brugger, M.; Calviani, M.; Cerutti, F.; Chiaveri, E.; Chin, M.; Ferrari, A.; Guerrero, C.; Losito, R.; Roman, F.; Rubbia, C.; Tsinganis, A.; Versaci, R.; Vlachoudis, V.; Weiss, C. [CERN, Geneva (Switzerland); Calvino, F.; Cortes, G.; Gomez-Hornillos, M.B.; Riego, A. [Universitat Politecnica de Catalunya, Barcelona (Spain); Carrapico, C.; Goncalves, I.F.; Sarmento, R.; Vaz, P. [Universidade de Lisboa, C2TN-Instituto Superior Tecnico, Lisboa (Portugal); Cortes-Giraldo, M.A.; Praena, J.; Quesada, J. [Universidad de Sevilla, Sevilla (Spain); Cosentino, L.; Finocchiaro, P. [INFN - Laboratori Nazionali del Sud, Catania (Italy); Diakaki, M.; Karadimos, D.; Kokkoris, M.; Vlastou, R. [National Technical University of Athens (NTUA), Athens (Greece); Domingo-Pardo, C.; Giubrone, G.; Tain, J.L. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Dressler, R.; Heinitz, S.; Kivel, N.; Schumann, D. [Paul Scherrer Institut, Villigen (Switzerland); Duran, I.; Tarrio, D. [Universidade de Santiago de Compostela, Santiago de Compostela (Spain); Eleftheriadis, C.; Manousos, A. [Aristotle University of Thessaloniki, Thessaloniki (Greece); Ganesan, S.; Gurusamy, P.; Saxena, A. [Bhabha Atomic Research Centre (BARC), Mumbai (India); Griesmayer, E.; Jericha, E.; Leeb, H. [Atominstitut der Oesterreichischen Universitaeten, Technische Universitaet Wien, Wien (Austria); Jenkins, D.G.; Vermeulen, M.J. [University of York, York, Heslington (United Kingdom); Kaeppeler, F. [Karlsruhe Institute of Technology (KIT), Institut fuer Kernphysik, Karlsruhe (Germany); Lo Meo, S. [Istituto Nazionale di Fisica Nucleare, Bologna (Italy); ENEA, Bologna (Italy); Massimi, C.; Mingrone, F.; Vannini, G. [Dipartimento di Fisica, Universita di Bologna (IT); INFN, Bologna (IT); Mastinu, P. [Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (IT); Milazzo, P.M. [Istituto Nazionale di Fisica Nucleare, Trieste (IT); Mirea, M. [Horia Hulubei National Institute of Physics and Nuclear Engineering - IFIN HH, Magurele (RO); Musumarra, A. [Universita di Catania, Dipartimento di Fisica e Astronomia DFA, Catania (IT); INFN-Laboratori Nazionali del Sud, Catania (IT); Paradela, C. [European Commission JRC, Institute for Reference Materials and Measurements, Geel (BE); Universidade de Santiago de Compostela, Santiago de Compostela (ES); Pavlik, A. [Faculty of Physics, University of Vienna, Wien (AT); Rauscher, T. [University of Hertfordshire, Centre for Astrophysics Research, School of Physics, Astronomy and Mathematics, Hatfield (GB); University of Basel, Department of Physics, Basel (CH); Wallner, A. [Faculty of Physics, University of Vienna, Wien (AT); Australian National University, Research School of Physics and Engineering, Canberra (AU)
2016-04-15
The integral measurement of the {sup 12}C(n, p){sup 12}B reaction was performed at the neutron time-of-flight facility nTOF at CERN. The total number of {sup 12}B nuclei produced per neutron pulse of the nTOF beam was determined using the activation technique in combination with a time-of-flight technique. The cross section is integrated over the nTOF neutron energy spectrum from reaction threshold at 13.6 MeV to 10 GeV. Having been measured up to 1GeV on basis of the {sup 235}U(n, f) reaction, the neutron energy spectrum above 200 MeV has been re-evaluated due to the recent extension of the cross section reference for this particular reaction, which is otherwise considered a standard up to 200 MeV. The results from the dedicated GEANT4 simulations have been used to evaluate the neutron flux from 1 GeV up to 10 GeV. The experimental results related to the {sup 12}C(n, p){sup 12}B reaction are compared with the evaluated cross sections from major libraries and with the predictions of different GEANT4 models, which mostly underestimate the {sup 12}B production. On the contrary, a good reproduction of the integral cross section derived from measurements is obtained with TALYS-1.6 calculations, with optimized parameters. (orig.)
26 CFR 1.381(c)(12)-1 - Recovery of bad debts, prior taxes, or delinquency amounts.
2010-04-01
... delinquency amounts. 1.381(c)(12)-1 Section 1.381(c)(12)-1 Internal Revenue INTERNAL REVENUE SERVICE...(c)(12)-1 Recovery of bad debts, prior taxes, or delinquency amounts. (a) Carryover requirement. (1... corporation is entitled to the recovery of a bad debt, prior tax, or delinquency amount on account of which a...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys
DEFF Research Database (Denmark)
Møller, P; Wallin, Håkan; Grunnet, N
1998-01-01
The induction of DNA damage by commonly used printing ink pigments, C.I. pigment orange 5 (C.I. 12075) and C.I. pigment yellow 12 (C.I. 21090), was investigated in freshly isolated rat hepatocytes with the comet assay. C.I. pigment yellow 12 is a 3,3'-dichlorobenzidine-based diarylide pigment...
Job Satisfaction among Library and Information Science Professionals in India: A Case Study
Directory of Open Access Journals (Sweden)
Pandita, Ramesh
2017-03-01
Full Text Available Purpose: This study aims to assess the level of job satisfaction among the practicing Library and Information Science (LIS professionals in India. Some of the key variables studied include salary, work environment, professional position, working hours, location, employee participation in administrative matters, recognition, and advancement. Scope: The study is limited to LIS professionals in India; however, the results of the study show some degree of commonality among LIS professionals across the world. Methodology/Approach: The study has been purely undertaken by analyzing the primary data collected from practicing library and information professionals across India by circulating an online questionnaire, using Google services and by posting the link on various social groups and other social networking sites such as Groups, Facebook, LinkedIn, discussion forums, and e-mails. Findings: Responses were generated across 20 states and union territories of the country, representing 88.15% territory of India. Of the total responses generated, 72.88% are males and 27.12% females. From the data analysis it emerged that every third library professional in India enters in to LIS profession by chance and not by choice, as 35.59% respondents expressed that they landed in the LIS profession by chance and 60.45% by choice. More than 77% respondents have expressed their willingness to change their present employer, if given better opportunity. More than 80% professionals either fully or partly agree that most of the LIS professionals across India are dissatisfied with their employers. All these and many more areas have been explored, which reflect the aspects of job satisfaction and dissatisfaction among LIS professionals in India.
Group supervision for general practitioners
DEFF Research Database (Denmark)
Galina Nielsen, Helena; Sofie Davidsen, Annette; Dalsted, Rikke
2013-01-01
AIM: Group supervision is a sparsely researched method for professional development in general practice. The aim of this study was to explore general practitioners' (GPs') experiences of the benefits of group supervision for improving the treatment of mental disorders. METHODS: One long-establish......AIM: Group supervision is a sparsely researched method for professional development in general practice. The aim of this study was to explore general practitioners' (GPs') experiences of the benefits of group supervision for improving the treatment of mental disorders. METHODS: One long...... considered important prerequisites for disclosing and discussing professional problems. CONCLUSION: The results of this study indicate that participation in a supervision group can be beneficial for maintaining and developing GPs' skills in dealing with patients with mental health problems. Group supervision...... influenced other areas of GPs' professional lives as well. However, more studies are needed to assess the impact of supervision groups....
Delineation of C12orf65-related phenotypes: a genotype-phenotype relationship.
Spiegel, Ronen; Mandel, Hanna; Saada, Ann; Lerer, Issy; Burger, Ayala; Shaag, Avraham; Shalev, Stavit A; Jabaly-Habib, Haneen; Goldsher, Dorit; Gomori, John M; Lossos, Alex; Elpeleg, Orly; Meiner, Vardiella
2014-08-01
C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.We used whole-genome homozygosity mapping as well as exome sequencing and targeted gene sequencing to identify novel C12orf65 disease-causing mutations in seven affected individuals originating from two consanguineous families. In four family members affected with childhood-onset optic atrophy accompanied by slowly progressive peripheral neuropathy and spastic paraparesis, we identified a homozygous frame shift mutation c.413_417 delAACAA, which predicts a truncated protein lacking the C-terminal portion. In the second family, we studied three affected individuals who presented with early onset optic atrophy, peripheral neuropathy, and spastic gait in addition to moderate intellectual disability. Muscle biopsy in two of the patients revealed decreased activities of the mitochondrial respiratory chain complexes I and IV. In these patients, we identified a homozygous splice mutation, g.21043 T>A (c.282+2 T>A) which leads to skipping of exon 2. Our study broadens the phenotypic spectrum of C12orf65 defects and highlights the triad of optic atrophy, axonal neuropathy and spastic paraparesis as its key clinical features. In addition, a clear genotype-phenotype correlation is anticipated in which deleterious mutations which disrupt the GGQ-containing domain in the first coding exon are expected to result in a more severe phenotype, whereas down-stream C-terminal mutations may result in a more favorable phenotype, typically lacking cognitive impairment.
Kaszczak, Lesia
With the adoption of the Common Core State Standards in New York State and the Next Generation Science Standards, it is more important than ever for school districts to develop professional development programs to provide teachers with the resources that will assist them in incorporating the new standards into their classroom instruction. This study focused on a mathematics and science professional development program known as STEMtastic STEM. The two purposes of the study were: to determine if there is an increase in STEM content knowledge of the participants involved in year two of a three year professional development program and to examine the teachers' perceptions of the impact of the professional development program on classroom instruction. The sample included teachers of grades 7-12 from an urban school district in New York State. The scores of a content knowledge pre-test and post-test were analyzed using a paired sample t-test to determine any significant differences in scores. In order to determine mathematics and science teachers' perceptions of the impact of the professional development program, responses from a 22 item Likert-style survey were analyzed to establish patterns of responses and to determine positive and negative perceptions of participants of the professional development program. A single sample t-test was used to determine if the responses were significantly positive. The results of this study indicated that there was no significant increase in content knowledge as a result of participation in the STEMtastic STEM professional development program. Both mathematics and science teachers exhibited significant positive perceptions of items dealing with hands-on participation during the professional development; support provided by STEMtastic STEM specialists; and the support provided by the administration. It was concluded that both mathematics and science teachers responded positively to the training they received during the professional
Proton-induced $\\alpha$-cluster knockout from $^{12}$C
Cowley, A A; Förtsch, S V; Buthelezi, E Z; Neveling, R; Smit, F D; Steyn, G F; van Zyl, J J
2010-01-01
Results of a study of the (p, p ) reaction on 12C with polarized incident protons of 100 MeV are reviewed. Experimental cross section and analyzing power distributions are compared with predictions of a distorted wave impulse approximation (DWIA) theory. The theory reproduces the data reasonably well, suggesting that a quasifree knockout mechanism dominates the reaction. Spectroscopic information extracted from the cross section data is in agreement with a shell model prediction.
Oxidative C-C bond cleavage of 1,2-diols by silver(II)
International Nuclear Information System (INIS)
Kumar, A.
1981-01-01
Oxidation of ethylene glycol and related compounds by Ag(II) has been investigated. Complexation of these substrates by Ag(II) precedes their oxidation. Oxidation occurs through electron transfer from an OH group to the Ag(II) within the complex resulting in the formation of alkoxyl-type radicals. The radicals thus formed undergo β-scission to give cleavage products. For ethylene glycol a complexation rate 1.3 x 10 6 M -1 s -1 and oxidation rate approx. 3 x 10 3 s -1 were observed. A general trend for the type of the substrates which would undergo C-C bond scission by Ag(II) is discussed
Challenges of 13C/12C measurements by CF-IRMS of biochemical samples at sub-nanomolar levels
International Nuclear Information System (INIS)
Whiticar, M.J.; Eek, M.
2001-01-01
Recent refinements to instrumentation and methodology have facilitated measurement of 13 C/ 12 C of individual compounds within complex biogeochemical mixtures by CF-IRMS. Specific challenges such as instrument performance, effective compound partitioning, efficient combustion, effective water removal, and isotope effects during online preparation of gases are discussed and practical improvements are presented. (author)
International Nuclear Information System (INIS)
Yoshida, Chisato; Tsuji, Atsushi B.; Sudo, Hitomi; Sugyo, Aya; Sogawa, Chizuru; Inubushi, Masayuki; Uehara, Tomoya; Fukumura, Toshimitsu; Koizumi, Mitsuru; Arano, Yasushi; Saga, Tsuneo
2011-01-01
Introduction: C-kit is an important diagnostic and therapeutic target molecule for several malignancies, and c-kit-targeted drugs have been used clinically. Because abundant c-kit expression in tumors is a prerequisite for successful c-kit-targeted therapy, imaging of c-kit expression is expected to play a pivotal role in the therapeutic decision for each patient. We evaluated 64 Cu-labeled Fab of anti-c-kit antibody 12A8 as a positron emission tomography (PET) imaging probe. Methods: 111 In- or 125 I-Labeled 12A8 Fab was evaluated in vitro by cell binding, competitive inhibition and cellular internalization assays, and in vivo by biodistribution in mice bearing c-kit-expressing and -non-expressing tumors. Next, Fab fragment was labeled with the positron emitter 64 Cu and evaluated by PET. Results: Radiolabeled 12A8 Fab showed specific binding to c-kit-expressing cells with high affinity and internalized into cells after binding to c-kit on cell surface. Although tumor accumulation of [ 111 In]Fab was lower than that of [ 111 In]IgG, the faster blood clearance of [ 111 In]Fab provided higher tumor-to-blood ratio at 6 h postinjection onwards. Blood clearance of 64 Cu-labeled 12A8 Fab was slower than that of [ 111 In]Fab, but PET using [ 64 Cu]Fab clearly visualized the tumor at 6 h postinjection onwards. Conclusion: The 64 Cu-labeled 12A8 Fab could be used for c-kit-specific PET imaging and might help in selecting appropriate patients for c-kit-targeted treatments.
An orthogonality condition model treatment of elastic and inelastic (α, 12C) scattering
International Nuclear Information System (INIS)
Suzuki, Y.; Imanishi, B.
1981-02-01
Elastic and inelastic scattering of α-particles on the deformed nucleus 12 C are investigated in the range of incident α-particle energies of 9 to 11 MeV by using the coupled-channel method with orthogonality condition. A doubly folded potential generated by the shell model wave functions of the α-particle and the deformed nucleus 12 C is employed for the relative motion between the α-particle and 12 C. Good agreement between theory and experiment is obtained for the elastic and inelastic angular distributions and the resonance structures. It is found, from the Born series expansion of the T-matrix, that the orthogonality constraint stresses the effects of the channel-coupling between the elastic and inelastic processes, and it indicates that the DWBA does not work well in this system. (author)
Pace, David; Khatami, Ameneh; Attard-Montalto, Simon; Voysey, Merryn; Finn, Adam; Faust, Saul N; Heath, Paul T; Borrow, Ray; Snape, Matthew D; Pollard, Andrew J
2016-12-07
Use of a polysaccharide vaccine challenge to demonstrate immunologic memory after priming with capsular group C meningococcal conjugate vaccines (MenCC) risks induction of immunologic hyporesponsiveness. For this reason, MenCC vaccines are now used as probes of immunologic memory, however, no studies have demonstrated their ability to distinguish primed from unprimed children. This study was part of a randomised controlled trial investigating the immunogenicity of a booster dose of the combined Haemophilus influenzae type b and MenC-tetanus toxoid vaccine (Hib-MenC-TT) in infants receiving reduced dose MenCC vaccine priming schedules (one MenC-CRM/MenC-TT or two MenC-CRM vaccine doses) compared with an unprimed group. Antibody kinetics were studied in a subset of 269 children by measuring changes in the MenC serum bactericidal antibody, using rabbit complement, (MenC rSBA) titres and MenC specific IgG memory B-cells before and at 6 and 28days following the 12month booster vaccination. At 6days after the 12monthMenCC vaccine, the rise in MenC rSBA titres and MenC specific IgG memory B-cells of the primed groups were significantly higher than the infant MenCC naïve group. Participants primed with one MenC-TT dose had the highest increase in MenC rSBA titres compared with all other groups. The MenC rSBA titres at the 28th compared with the 6th day after boosting was significantly higher in those primed with a single MenC-TT/MenC-CRM vaccine in infancy compared with those who were not primed or who were primed with two doses of the MenC-CRM vaccine. Immunologic memory can be demonstrated by a MenCC booster vaccination but is affected by the type and number of MenCC doses used for infant priming. The MenC rSBA responses can be used to demonstrate successful immunologic priming. Copyright © 2016 Elsevier Ltd. All rights reserved.
Preparation of no-carrier-added [1-11C]ethylene and [1-11C]1,2-dibromoethane as new labelling agents
International Nuclear Information System (INIS)
Shah, F.; Pike, V.W.; Dowsett, K.
1997-01-01
A method is described for the preparation of NCA [1- 11 C] ethylene based on the passage of [1- 11 C]ethanol over heated (550 o C) quartz glass in a stainless steel tube (in preference to dehydration by catalysis on γ-alumina or pyrolysis). The [1- 11 C]ethanol is prepared from cyclotron-produced NCA [ 11 C]carbon dioxide by 11 C-carboxylation of methylmagnesium bromide, freshly prepared in dibutyl ether, and reduction of the adduct with lithium aluminium hydride in diglyme. The use of involatile solvents avoids the formation of carrier ethylene and radioactive and stable diethyl ether by cracking processes over the heated catalyst. The preparation takes 21 min from the end of radionuclide production and has a radiochemical yield of 44%, decay-corrected from [ 11 C]carbon dioxide. NCA [1- 11 C] ethylene is converted quantitatively into [1- 11 C]1,2-dibromoethane when collected in a solution of bromine in carbon tetrachloride. The NCA [1- 11 C]ethylene and [1- 11 C]1,2-dibromoethane may serve as new and useful labelling agents. (Author)
Indiana University High Energy Physics Group, Task C
International Nuclear Information System (INIS)
Bower, C.; Heinz, R.; Mufson, S.; Musser, J.
1993-01-01
The Indiana University Task C group is participating in the experiments GEM at the SSC and MACRO at the Gran Sasso. After an introduction to GEM in paragraph II, a detailed report is presented on the work done during the current contract period on the design of the outer region of the GEM Central Tracker. The Central Tracker Monte Carlo, which was the other significant GEM activity by the group, is included. In paragraph III is introduced MACRO and a brief status report is given. Muon Astronomy analysis done using MACRO data is also presented
Fang, F; Pan, J; Su, G H; Xu, L X; Li, G; Li, Z H; Zhao, H; Wang, J
2015-11-30
Numerous studies have focused on the relationship be-tween alcohol dehydrogenase 1C gene (ADH1C) *1/*2 polymorphism (Ile350Val, rs698, also known as ADH1C *1/*2) and pancreatitis risk, but the results have been inconsistent. Thus, we conducted a meta-anal-ysis to more precisely estimate this association. Relevant publications were searched in several widely used databases and 9 eligible studies were included in the meta-analysis. Pooled odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to evaluate the strength of the association. Significant associations between ADH1C *1/*2 poly-morphism and pancreatitis risk were observed in both overall meta-analysis for 12 vs 22 (OR = 1.53, 95%CI = 1.12-2.10) and 11 + 12 vs 22 (OR = 1.44, 95%CI = 1.07-1.95), and the chronic alcoholic pancre-atitis subgroup for 12 vs 22 (OR = 1.64, 95%CI = 1.17-2.29) and 11 + 12 vs 22 (OR = 1.53, 95%CI = 1.11-2.11). Significant pancreatitis risk variation was also detected in Caucasians for 11 + 12 vs 22 (OR = 1.45, 95%CI = 1.07-1.98). In conclusion, the ADH1C *1/*2 polymorphism is likely associated with pancreatitis risk, particularly chronic alcoholic pancreatitis risk, with the *1 allele functioning as a risk factor.
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
Nuclear Landau-Zener phenomena and the fusion cross sections in the system 13C + 16O → 12C + 17O
International Nuclear Information System (INIS)
Imanishi, B.; Oertzen, W. von.
1990-07-01
Reaction mechanism of the system 13 C+ 16 O- 12 C+ 17 O is investigated with the use of the nucleon molecular-orbital model in the framework of the orthogonalized coupled-reaction-channel (OCRC) theory. The adiabatic potentials obtained are quite different from the diagonal potentials of the original OCRC basis. The Landau-Zener radial coupling explains the backward enhancement of measured differential cross sections of the transfer reaction 13 C( 16 O, 17 O) 12 C. In the OCRC calculation the fusion cross sections of the channel 13 C+ 16 O is enhanced at low bombarding energies, in agreement with the experimental data. (author)
The 12C+α reaction rate from the elastic 16O breakup
International Nuclear Information System (INIS)
Kiener, J.; Kraus, L.; Lefebvre, A.; Mittig, W.; Motobayashi, T.; De Oliveira-Santos, F.; Stephan, C.; Thibaud, J.P.
1997-01-01
Evidence for direct elastic breakup of 16 O into the α- 12 C continuum with relative energies ranging from 900 to 1800 keV has been obtained in the scattering of 1527 MeV 16 O projectiles off 208 Pb. An interpretation of E2 breakup including nuclear and Coulomb contributions leads to reduced electromagnetic transition probabilities and astrophysical S E2 factors in reasonable agreement with direct measurements, showing that the method can be applied to extract the E2 part of the 12 C(α,γ) reaction rate. (orig.)
High-lying 0+ and 3- levels in 12C
International Nuclear Information System (INIS)
Hanna, S.S.; Feldman, W.; Suffert, M.; Kurath, D.
1982-01-01
The γ decays of the levels at 17.77 and 18.36 MeV in 12 C are studied by proton capture and the assignments of (0 + ,1) and (3 - ,1), respectively, are confirmed. The very great strength of the decay of the (0 + ,1) level to the lower (1 + ,0) level at 12.71 MeV is consistent with a spin- and isospin-flip deuteronlike transition. The strong decay of the (3 - ,1) level to the lower (3 - 0,) level at 9.64 MeV is fairly typical of an analog to antianalog transition. The γ-decay widths of these levels are compared with shell-model calculations
Supporting students in professional socialisation: Guidelines for professional nurses and educators
Directory of Open Access Journals (Sweden)
Hester Cathrina (Rina de Swardt
2017-01-01
Full Text Available Professional socialisation of nursing students involves learning skills, attitudes, behaviour and professional roles, largely in the clinical area. During clinical accompaniment and reflective discussions with a group of undergraduate Baccalaureate nursing students in South Africa, students reported negative professional socialisation experiences, primarily in the clinical area. Such experiences could influence the quality of patient care. The objective of this study was to develop and validate guidelines to support professional nurses and educators in the professional socialisation of student nurses. Evidence was generated from an exploration and description of the perceptions of professional nurses regarding their role in the professional socialisation of students, the perceptions of nurse educators regarding the teaching and facilitation of professional socialisation of students, and the socialisation experiences of students. Following a sequential mixed-methods design, qualitative data guided the collection of quantitative data. All data and literature directed the development of these guidelines, which experts reviewed and validated according to a set of criteria. These guidelines focus on the clinical, nursing educational institution environment and values and beliefs of the nursing profession. Facilitation of sound work ethics, professional behaviour, cultural and gender awareness, role modelling and the application of a range of teaching strategies is proposed.
Sabancıogullari, Selma; Dogan, Selma
2015-12-01
The aim of this study was to evaluate the effects of the Professional Identity Development Program on the professional identity, job satisfaction and burnout levels of registered nurses. This study was conducted as a quasi-experimental one with 63 nurses working in a university hospital. Data were gathered using the Personal Information Questionnaire, the Professional Self Concept Inventory, Minnesota Job Satisfaction Inventory and the Maslach Burnout Inventory. The Professional Identity Development Program which consists of ten sessions was implemented to the study group once a week. The Program significantly improved the professional identity of the nurses in the study group compared to that of the control group. During the research period, burnout levels significantly decreased in the study group while those of the control group increased. The programme did not create any significant differences in the job satisfaction levels of the nurses. The programme had a positive impact on the professional identity of the nurses. It is recommended that the programme should be implemented in different hospitals with different samples of nurses, and that its effectiveness should be evaluated. © 2014 Wiley Publishing Asia Pty Ltd.
Energy Technology Data Exchange (ETDEWEB)
Tornow, W.; Woye, E.; Walter, R.L.
1987-02-01
Analysing-power data for elastic scattering of neutrons from /sup 12/C have been obtained at selected angles in small energy steps between incident energies of 15.55 and 17.35 MeV. The excitation energy, spin and parity of levels in /sup 13/C have been determined for excitation energies around 20 MeV via a phase-shift analysis of these data and of previously measured n-/sup 12/C total cross section data. In addition, an auxiliary phase-shift analysis has been performed in the neutron energy range from 12 to 15 MeV. All experimental data are well reproduced by the phase shifts obtained. The need for further experimental data is pointed out.
Five-nucleon simultaneous and sequential transfer in the 12C(11B,6Li)17O and 12C(d,7Li)7Be reactions
International Nuclear Information System (INIS)
Jarczyk, L.; Kamys, B.; Kistryn, M.; Magiera, A.; Rudy, Z.; Strzal/kowski, A.; Barna, R.; DAmico, V.; De Pasquale, D.; Italiano, A.; Licandro, M.
1996-01-01
Measurements of the angular distributions of the 12 C( 11 B, 6 Li) 17 O reaction were performed at three energies of a 11 B beam: 28, 35, and 40 MeV. The results were analyzed in the frame of the exact finite range distorted wave Born approximation of the first and the second order assuming the simultaneous and sequential transfer of the neutron and the α particle. Such an analysis was also performed for previously measured angular distributions of the 12 C(d, 7 Li) 7 Be reaction at E lab = 78 MeV. In both reactions under investigation dominance was found of the simultaneous transfer of the α particle and the nucleon correlated to the 5 He ( 5 Li) cluster in the ground or the first excited state. copyright 1996 The American Physical Society
International Nuclear Information System (INIS)
Hostachy, J.Y.
1987-01-01
The elastic and inelastic scattering angular distributions of 12 C on the targets 12 C and 208 Pb have been measured at the Laboratoire National Saturne (Saclay) using the spectrometer SPES 1. The data have been analysed in the framework of the optical model with Woods-Saxon potentials. A near side/far side decomposition of the cross-section has provided a more detailed insight into the refraction effects. These analysises show that the strong absorption radius, the reaction cross-section, and consequently the absorption in the surface region, decrease when the incident energy increases, allowing to probe the inner part of the ion-ion potential. The transparency region extends down to a radial internuclei distance of about 3 fm for the 12 C - 12 C system and 8 fm for the 12 C - 208 Pb system. The onset of a decrease of the imaginary potential has been deduced for the two systems. The real potential is also decreasing, but much more rapidly for the 12 C - 208 Pb system than for 12 C- 12 C. We have also developed a microscopic approach in the optical limit of the Glauber theory, including the Pauli-blocking, the Fermi motion and the nucleus finite size effects. For the intermediate energies, the calculations are in fair agreement with the experimental data [fr
Preliminary Study of 13C/12C Application for the Detection of Adulterated Honey
International Nuclear Information System (INIS)
Loestanatjaroen, S.
2014-01-01
Honey and pollen in natural products derived from the same plant both share the same carbon source; as a result their 13 C isotope signature should be identical. The majority of honey adulteration in Thailand was done particularly by adding cheap sugars such as high sucrose cane syrup (HSCS). The accepted differences in 13 C/ 12 C between honey and its associated protein extract is -1δ/ο deviation, which provides the international benchmark of 7% C4 sugar addition. This study reports the preliminary detection of adulterated Thai honey samples by using isotope ratio mass spectrometer coupled to elemental analyzer (EAIRMS). The 5 Thailand honey samples and the pure honey were adulterated with HSCS dilution as: 0, 0.5, 1, 5, 7, 10, 15 and 50%, respectively. The results were found that two of the Thai honey samples and of 10, 15, and 50% dilution were adulterated. The result of analyzed cane sugar of ten replicates were found -11.2 and -10.8 δdeviation, respectively.
Transforming physics educator identities: TAs help TAs become teaching professionals
Gretton, Anneke L.; Bridges, Terry; Fraser, James M.
2017-05-01
Research-based instructional strategies have been shown to dramatically improve student learning, but widespread adoption of these pedagogies remains limited. Post-secondary teaching assistants (TAs), with their current positions in course delivery and future roles as academic leaders, are an essential target group for teacher training. However, the literature suggests that successful TA professional development must address not only pedagogical practices but also the cultivation of physics educator identity. The primary goal of this study is to build a framework for TA professional development that strengthens the TA's identity as a physics educator. We base this framework on Etienne Wenger's model for communities of practice and Côté and Levine's personality and social structure identity perspective. We explore this framework in the context of a 12-week, low-cost, TA-led and TA-centered professional development intervention. Our qualitative and quantitative data suggest that this efficient community-based intervention strengthened TAs' identification as physics educators.
International Nuclear Information System (INIS)
Cherkaoui-Tadili, R.
1982-01-01
The total reaction cross-section σsub(R) for interactions between heavy ions is predicted to decrease rapidly with the energy of the incident projectile over the energy range 10 MeV/A - 100 MeV/A. We present here an experimental met σsub(R) to test the model based predictions. The method consists in counting the number of all incoming projectiles and the number of out going projectiles that did not interact with the target. The difference between these two numbers corresponds to the number of particles that reacted with the target nuclei and is therefore proportional to σsub(R). Values of σsub(R) have been measured for the system 12 C + 12 C at two incident energies of 112 MeV and 996 MeV. The results of 1444 +- 70 (112 MeV) and 994 +- 50 (996 MeV) show a total reaction cross-section decreasing with energy as predicted from the Glauber model and optical model fits to elastic scattering [fr
Cytoprotective Role of Nrf2 in Electrical Pulse Stimulated C2C12 Myotube.
Directory of Open Access Journals (Sweden)
Masaki Horie
Full Text Available Regular physical exercise is central to a healthy lifestyle. However, exercise-related muscle contraction can induce reactive oxygen species and reactive nitrogen species (ROS/RNS production in skeletal muscle. The nuclear factor-E2-related factor-2 (Nrf2 transcription factor is a cellular sensor for oxidative stress. Regulation of nuclear Nrf2 signaling regulates antioxidant responses and protects organ structure and function. However, the role of Nrf2 in exercise- or contraction-induced ROS/RNS production in skeletal muscle is not clear. In this study, using differentiated C2C12 cells and electrical pulse stimulation (EPS of muscle contraction, we explored whether Nrf2 plays a role in the skeletal muscle response to muscle contraction-induced ROS/RNS. We found that EPS (40 V, 1 Hz, 2 ms stimulated ROS/RNS accumulation and Nrf2 activation. We also showed that expression of NQO1, HO-1 and GCLM increased after EPS-induced muscle contraction and was remarkably suppressed in cells with Nrf2 knockdown. We also found that the antioxidant N-acetylcysteine (NAC significantly attenuated Nrf2 activation after EPS, whereas the nitric oxide synthetase inhibitor Nω-nitro-L-arginine methyl ester (L-NAME did not. Furthermore, Nrf2 knockdown after EPS markedly decreased ROS/RNS redox potential and cell viability and increased expression of the apoptosis marker Annexin V in C2C12 myotubes. These results indicate that Nrf2 activation and expression of Nrf2 regulated-genes protected muscle against the increased ROS caused by EPS-induced muscle contraction. Thus, our findings suggest that Nrf2 may be a key factor for preservation of muscle function during muscle contraction.
Ferroelectric response in an achiral non-symmetric bent liquid crystal:C{sub 12}C{sub 10}
Energy Technology Data Exchange (ETDEWEB)
Subrahmanyam, S.V.; Chalapathi, P.V. [Department of Physics, University College of Engineering, Jawaharlal Nehru Technological University Kakinada, Kakinada 533003 (India); Mahabaleshwara, S.; Srinivasulu, M. [Department of Chemistry, Manipal Institute of Technology, Manipal University, Manipal 576104 (India); George, A.K. [Department of Physics, College of Sciences, Sultan Qaboos University, PO Box-36, PC-123, Muscat (Oman); Potukuchi, D.M., E-mail: potukuchidm@yahoo.com [Department of Physics, University College of Engineering, Jawaharlal Nehru Technological University Kakinada, Kakinada 533003 (India)
2014-10-01
An achiral Non-Symmetric Bent Liquid Crystal (BLC) with a Oxadiazole based hetero cyclic central moiety, abbreviated as C{sub 12}C{sub 10} viz., dodecyl[4-{5-(4′-decyloxy)biphenyl-4-yl}-1,2,4-oxadiazol-3-yl]benzoate, exhibiting FerroElectric (FE) response is reported. Product is confirmed by {sup 1}H NMR, {sup 13}C NMR and elemental analysis. Characterization of BLC phases is carried out by Polarized Optical Microscopy (POM), Differential Scanning Calorimetry (DSC), Spontaneous Polarization (P{sub S}) and Low Frequency (10 Hz–10 MHz) Dielectric Relaxation studies. C{sub 12}C{sub 10} exhibits enantiotropic LC SmA, FE B{sub 2}, SmG, SmE phase variance. I–SmA, B{sub 2}–SmG and SmG–SmE transitions are of first order nature. FE B{sub 2} phases exhibits a moderate P{sub S} of ∼80 nC cm{sup −2}. B{sub 2} phase exhibits Curie–Weiss behavior to confirm FE nature. Off-centered low frequency (KHz) dispersion infers a scissor mode and a high frequency (MHz) mode to reflect the distinct time-scale response. Dielectric Dispersion is relatively susceptible in lower frequency KHz region. Arrhenius shift in Relaxation Frequency (f{sub R}) infers higher activation energy (E{sub a}) in non-FE phases for HF mode and lower value for KHz mode. Trends of f{sub R}, dielectric strength Δε, α-parameter and E{sub a} are discussed in view of the data reported in other LC compounds.
The integrable quantum group invariant A2n-1(2) and Dn+1(2) open spin chains
Nepomechie, Rafael I.; Pimenta, Rodrigo A.; Retore, Ana L.
2017-11-01
A family of A2n(2) integrable open spin chains with Uq (Cn) symmetry was recently identified in arxiv:arXiv:1702.01482. We identify here in a similar way a family of A2n-1(2) integrable open spin chains with Uq (Dn) symmetry, and two families of Dn+1(2) integrable open spin chains with Uq (Bn) symmetry. We discuss the consequences of these symmetries for the degeneracies and multiplicities of the spectrum. We propose Bethe ansatz solutions for two of these models, whose completeness we check numerically for small values of n and chain length N. We find formulas for the Dynkin labels in terms of the numbers of Bethe roots of each type, which are useful for determining the corresponding degeneracies. In an appendix, we briefly consider Dn+1(2) chains with other integrable boundary conditions, which do not have quantum group symmetry.