WorldWideScience

Sample records for prematurely condensed g2

  1. High-LET radiation-induced aberrations in prematurely condensed G2 chromosomes of human fibroblasts

    Science.gov (United States)

    Kawata, T.; Gotoh, E.; Durante, M.; Wu, H.; George, K.; Furusawa, Y.; Cucinotta, F. A.; Dicello, J. F. (Principal Investigator)

    2000-01-01

    PURPOSE: To determine the number of initial chromatid breaks induced by low- or high-LET irradiations, and to compare the kinetics of chromatid break rejoining for radiations of different quality. MATERIAL AND METHODS: Exponentially growing human fibroblast cells AG1522 were irradiated with gamma-rays, energetic carbon (290MeV/u), silicon (490MeV/u) and iron (200 and 600 MeV/u). Chromosomes were prematurely condensed using calyculin A. Chromatid breaks and exchanges in G2 cells were scored. PCC were collected after several post-irradiation incubation times, ranging from 5 to 600 min. RESULTS: The kinetics of chromatid break rejoining following low- or high-LET irradiation consisted of two exponential components representing a rapid and a slow time constant. Chromatid breaks decreased rapidly during the first 10min after exposure, then continued to decrease at a slower rate. The rejoining kinetics were similar for exposure to each type of radiation. Chromatid exchanges were also formed quickly. Compared to low-LET radiation, isochromatid breaks were produced more frequently and the proportion of unrejoined breaks was higher for high-LET radiation. CONCLUSIONS: Compared with gamma-rays, isochromatid breaks were observed more frequently in high-LET irradiated samples, suggesting that an increase in isochromatid breaks is a signature of high-LET radiation exposure.

  2. PRR11 regulates late-S to G2/M phase progression and induces premature chromatin condensation (PCC)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chundong; Zhang, Ying; Li, Yi; Zhu, Huifang; Wang, Yitao; Cai, Wei [Department of Biochemistry and Molecular Biology, Chongqing Medical University, Chongqing 400016 (China); Molecular Medicine and Cancer Research Center, Chongqing Medical University, Chongqing 400016 (China); Zhu, Jiang [Molecular Medicine and Cancer Research Center, Chongqing Medical University, Chongqing 400016 (China); Ozaki, Toshinori [Laboratory of DNA Damage Signaling, Chiba Cancer Center Research Institute, 666-2 Nitona, Chuohku, Chiba 260-8717 (Japan); Bu, Youquan, E-mail: buyqcn@aliyun.com [Department of Biochemistry and Molecular Biology, Chongqing Medical University, Chongqing 400016 (China); Molecular Medicine and Cancer Research Center, Chongqing Medical University, Chongqing 400016 (China)

    2015-03-13

    Recently, we have demonstrated that proline-rich protein 11 (PRR11) is a novel tumor-related gene product likely implicated in the regulation of cell cycle progression as well as lung cancer development. However, its precise role in cell cycle progression remains unclear. In the present study, we have further investigated the expression pattern and functional implication of PRR11 during cell cycle in detail in human lung carcinoma-derived H1299 cells. According to our immunofluorescence study, PRR11 was expressed largely in cytoplasm, the amount of PRR11 started to increase in the late S phase, and was retained until just before mitotic telophase. Consistent with those observations, siRNA-mediated knockdown of PRR11 caused a significant cell cycle arrest in the late S phase. Intriguingly, the treatment with dNTPs further augmented PRR11 silencing-mediated S phase arrest. Moreover, knockdown of PRR11 also resulted in a remarkable retardation of G2/M progression, and PRR11-knockdown cells subsequently underwent G2 phase cell cycle arrest accompanied by obvious mitotic defects such as multipolar spindles and multiple nuclei. In addition, forced expression of PRR11 promoted the premature Chromatin condensation (PCC), and then proliferation of PRR11-expressing cells was massively attenuated and induced apoptosis. Taken together, our current observations strongly suggest that PRR11, which is strictly regulated during cell cycle progression, plays a pivotal role in the regulation of accurate cell cycle progression through the late S phase to mitosis. - Highlights: • PRR11 started to increase in the late S phase and was retained until just before mitotic telophase. • PRR11-knockdown caused a significant cell cycle arrest in the late S phase and G2 phase. • The treatment with dNTPs further augmented PRR11 silencing-mediated S phase arrest. • PRR11-knockdown led to multipolar spindles and multiple nuclei. • Forced expression of PRR11 promoted the PCC and inhibited

  3. Improved DNA condensation, stability, and transfection with alkyl sulfonyl-functionalized PAMAM G2

    Energy Technology Data Exchange (ETDEWEB)

    Rata-Aguilar, Azahara, E-mail: azahara@ugr.es; Maldonado-Valderrama, Julia; Jódar-Reyes, Ana Belén; Ortega-Vinuesa, Juan Luis [University of Granada, Biocolloid and Fluid Physics Group, Department of Applied Physics (Spain); Santoyo-Gonzalez, Francisco [University of Granada, Organic Chemistry Department, Institute of Biotechnology (Spain); Martín-Rodríguez, Antonio [University of Granada, Biocolloid and Fluid Physics Group, Department of Applied Physics (Spain)

    2015-04-15

    In this work, we have used a second-generation PAMAM grafted with octadecyl sulfonyl chains to condense plasmid DNA. The influence of this modification at different levels was investigated by comparison with original PAMAM G2. The condensation process and temporal stability of the complexes was studied with DLS, finding that the aliphatic chains influence DNA compaction via hydrophobic forces and markedly improve the formation and temporal stability of a single populated system with a hydrodynamic diameter below 100 nm. Interaction with a cell membrane model was also evaluated with a pendant drop tensiometer, resulting in further incorporation of the C18-PAMAM dendriplexes onto the interface. The improvement observed in transfection with our C18 grafted PAMAM is ascribed to the size, stability, and interfacial behavior of the complexes, which in turn are consequence of the DNA condensation process and the interactions involved.

  4. Comparison of clonogenic assay with premature chromosome condensation assay in prediction of human cell radiosensitivity

    Institute of Scientific and Technical Information of China (English)

    Zhuan-Zi Wang; Wen-Jian Li; Hong Zhang; Jian-She Yang; Rong Qiu; Xiao Wang

    2006-01-01

    AIM: To determine whether the number of non-rejoining G2-chromatid breaks can predict the radiosensitivity of human cell lines.METHODS: Cell lines of human ovary carcinoma cells (HO8910), human hepatoma cells (HepG2) and liver cells (L02) were irradiated with a range of doses and assessed both of cell survival and non-rejoining G2-chromatid breaks at 24 h after irradiation. Cell survival was documented by a colony assay. Non-rejoining G2-chromatid breaks were measured by counting the number of non-rejoining G2 chromatid breaks at 24 h after irradiation, detected by the prematurely chromosome condensed (PCC) technique.RESULTS: A linear-quadratic survival curve was observed in three cell lines, and HepG2 was the most sensitive to y-radiation. A dose-dependent linear increase was observed in radiation-induced non-rejoining G2-PCC breaks measured at 24 h after irradiation in all cell lines, and HepG2 was the most susceptible to induction of non-rejoining G2-PCC breaks. A close correlation was found between the clonogenic radiosensitivity and the radiation-induced non-rejoining G2-PCC breaks (r= 0.923). Furthermore, survival-aberration correlations for two or more than two doses lever were also significant.CONCLUSION: The number of non-rejoining G2 PCC breaks holds considerable promise for predicting the radiosensitivity of normal and tumor cells when two or more than two doses lever is tested.

  5. DOSE RESPONSE CURVE OF 60Co FOR PREMATURE CONDENSED CHROMOSOME FRAGMENTS OF HUMAN LYMPHOCYTES

    Institute of Scientific and Technical Information of China (English)

    高锦声; 郑斯英; 等

    1995-01-01

    The dose-response curves obtained by premature condensed chromosome(PCC) and conventional cellular genetic methods can be represented by two linear equations.The ratio of the slopes,KPCC/KM1,is about 28,In compartison to the conventional method.The PCC method has many advantages;e.g.it is faster,simopler,more sensitive and accurate.Its significance in the study of radiation damage is also discussed.

  6. Assessing the applicability of FISH-based prematurely condensed dicentric chromosome assay in triage biodosimetry.

    Science.gov (United States)

    Suto, Yumiko; Gotoh, Takaya; Noda, Takashi; Akiyama, Miho; Owaki, Makiko; Darroudi, Firouz; Hirai, Momoki

    2015-03-01

    The dicentric chromosome assay (DCA) has been regarded as the gold standard of radiation biodosimetry. The assay, however, requires a 2-d peripheral blood lymphocyte culture before starting metaphase chromosome analyses to estimate biological doses. Other biological assays also have drawbacks with respect to the time needed to obtain dose estimates for rapid decision on the correct line of medical treatment. Therefore, alternative technologies that suit requirements for triage biodosimetry are needed. Radiation-induced DNA double strand breaks in G0 lymphocytes can be detected as interphase chromosome aberrations by the cell fusion-mediated premature chromosome condensation (PCC) method. The method, in combination with fluorescence in situ hybridization (FISH) techniques, has been proposed in early studies as a powerful tool for obtaining biological dose estimates without 2-d lymphocyte culture procedures. The present work assesses the applicability of FISH-based PCC techniques using pan-centromeric and telomeric peptide nucleic acid (PNA) probes in triage mode biodosimetry and demonstrates that an improved rapid procedure of the prematurely condensed dicentric chromosome (PCDC) assay has the potential for evaluating exposed radiation doses in as short as 6 h after the collection of peripheral blood specimens.

  7. The use of premature chromosome condensation to study in interphase cells the influence of environmental factors on human genetic material

    Directory of Open Access Journals (Sweden)

    Vasiliki I. Hatzi

    2006-01-01

    Full Text Available Nowadays, there is a constantly increasing concern regarding the mutagenic and carcinogenic potential of a variety of harmful environmental factors to which humans are exposed in their natural and anthropogenic environment. These factors exert their hazardous potential in humans' personal (diet, smoking, pharmaceuticals, cosmetics and occupational environment that constitute part of the anthropogenic environment. It is well known that genetic damage due to these factors has dramatic implications for human health. Since most of the environmental genotoxic factors induce arrest or delay in cell cycle progression, the conventional analysis of chromosomes at metaphase may underestimate their genotoxic potential. Premature Chromosome Condensation (PCC induced either by means of cell fusion or specific chemicals, enables the microscopic visualization of interphase chromosomes whose morphology depends on the cell cycle stage, as well as the analysis of structural and numerical aberrations at the G1 and G2 phases of the cell cycle. The PCC has been successfully used in problems involving cell cycle analysis, diagnosis and prognosis of human leukaemia, assessment of interphase chromosome malformations resulting from exposure to radiation or chemicals, as well as elucidation of the mechanisms underlying the conversion of DNA damage into chromosomal damage. In this report, particular emphasis is given to the advantages of the PCC methodology used as an alternative to conventional metaphase analysis in answering questions in the fields of radiobiology, biological dosimetry, toxicogenetics, clinical cytogenetics and experimental therapeutics.

  8. Truly incomplete and complex exchanges in prematurely condensed chromosomes of human fibroblasts exposed in vitro to energetic heavy ions

    Science.gov (United States)

    Wu, Honglu; Durante, Marco; Furusawa, Yoshiya; George, Kerry; Kawata, Tetsuya; Cucinotta, Francis A.

    2003-01-01

    Confluent human fibroblast cells (AG1522) were irradiated with gamma rays, 490 MeV/nucleon silicon ions, or iron ions at either 200 or 500 MeV/nucleon. The cells were allowed to repair at 37 degrees C for 24 h after exposure, and a chemically induced premature chromosome condensation (PCC) technique was used to condense chromosomes in the G2 phase of the cell cycle. Incomplete and complex exchanges were analyzed in the irradiated samples. To verify that chromosomal breaks were truly unrejoined, chromosome aberrations were analyzed using a combination of whole-chromosome specific probes and probes specific for the telomere region of the chromosome. Results showed that the frequency of unrejoined chromosome breaks was higher after irradiation with the heavy ions of high LET, and consequently the ratio of incomplete to complete exchanges increased steadily with LET up to 440 keV/microm, the highest LET included in the present study. For samples exposed to 200 MeV/nucleon iron ions, chromosome aberrations were analyzed using the multicolor FISH (mFISH) technique, which allows identification of both complex and truly incomplete exchanges. Results of the mFISH study showed that 0.7 and 3 Gy iron ions produced similar ratios of complex to simple exchanges and incomplete to complete exchanges; these ratios were higher than those obtained after exposure to 6 Gy gamma rays. After 0.7 Gy of iron ions, most complex aberrations were found to involve three or four chromosomes, which is a likely indication of the maximum number of chromosome domains traversed by a single iron-ion track.

  9. Dose response of multiple parameters for calyculin A-induced premature chromosome condensation in human peripheral blood lymphocytes exposed to high doses of cobalt-60 gamma-rays.

    Science.gov (United States)

    Lu, Xue; Zhao, Hua; Feng, Jiang-Bin; Zhao, Xiao-Tao; Chen, De-Qing; Liu, Qing-Jie

    2016-09-01

    Many studies have investigated exposure biomarkers for high dose radiation. However, no systematic study on which biomarkers can be used in dose estimation through premature chromosome condensation (PCC) analysis has been conducted. The present study aims to screen the high-dose radiation exposure indicator in calyculin A-induced PCC. The dose response of multiple biological endpoints, including G2/A-PCC (G2/M and M/A-PCC) index, PCC ring (PCC-R), ratio of the longest/shortest length (L/L ratio), and length and width ratio of the longest chromosome (L/B ratio), were investigated in calyculin A-induced G2/A-PCC spreads in human peripheral blood lymphocytes exposed to 0-20Gy (dose-rate of 1Gy/min) cobalt-60 gamma-rays. The G2/A-PCC index was decreased with enhanced absorbed doses of 4-20Gy gamma-rays. The G2/A PCC-R at 0-12Gy gamma-rays conformed to Poisson distribution. Three types of PCC-R were scored according to their shape and their solidity or hollowness. The frequencies of hollow PCC-R and PCC-R including or excluding solid ring in G2/A-PCC spreads were enhanced with increased doses. The length and width of the longest chromosome, as well as the length of the shortest chromosome in each G2/M-PCC or M/A-PCC spread, were measured. All L/L or L/B ratios in G2/M-PCC or M/A-PCC spread increased with enhanced doses. A blind test with two new irradiated doses was conducted to validate which biomarker could be used in dose estimation. Results showed that hollow PCC-R and PCC-R including solid ring can be utilized for accurate dose estimation, and that hollow PCC-R was optimal for practical application.

  10. Drug-induced premature chromosome condensation (PCC) protocols: cytogenetic approaches in mitotic chromosome and interphase chromatin.

    Science.gov (United States)

    Gotoh, Eisuke

    2015-01-01

    Chromosome analysis is a fundamental technique which is used in wide areas of cytogenetic study including karyotyping species, hereditary diseases diagnosis, or chromosome biology study. Chromosomes are usually prepared from mitotic cells arrested by colcemid block protocol. However, obtaining mitotic chromosomes is often hampered under several circumstances. As a result, cytogenetic analysis will be sometimes difficult or even impossible in such cases. Premature chromosome condensation (PCC) (see Note 1) is an alternative method that has proved to be a unique and useful way in chromosome analysis. Former, PCC has been achieved following cell fusion method (cell-fusion PCC) mediated either by fusogenic viruses (e.g., Sendai virus) or cell fusion chemicals (e.g., polyethylene glycol), but the cell fusion PCC has several drawbacks. The novel drug-induced PCC using protein phosphatase inhibitors was introduced about 20 years ago. This method is much simpler and easier even than the conventional mitotic chromosome preparation protocol use with colcemid block and furthermore obtained PCC index (equivalent to mitotic index for metaphase chromosome) is usually much higher than colcemid block method. Moreover, this method allows the interphase chromatin to be condensed to visualize like mitotic chromosomes. Therefore drug-induced PCC has opened the way for chromosome analysis not only in metaphase chromosomes but also in interphase chromatin. The drug-induced PCC has thus proven the usefulness in cytogenetics and other cell biology fields. For this second edition version, updated modifications/changes are supplemented in Subheadings 2, 3, and 4, and a new section describing the application of PCC in chromosome science fields is added with citation of updated references.

  11. Biodosimetry of ionizing radiation by selective painting of prematurely condensed chromosomes in human lymphocytes

    Science.gov (United States)

    Durante, M.; George, K.; Yang, T. C.

    1997-01-01

    Painting of interphase chromosomes can be useful for biodosimetric purposes in particular cases such as radiation therapy, accidental exposure to very high radiation doses and exposure to densely ionizing radiation, for example during space missions. Biodosimetry of charged-particle radiation is analyzed in the present paper. Target cells were human peripheral blood lymphocytes irradiated in vitro with gamma rays, protons and iron ions. After exposure, lymphocytes were incubated for different times to allow repair of radiation-induced damage and then fused to mitotic hamster cells to promote premature condensation in the interphase chromosomes. Chromosome spreads were then hybridized with whole-chromosome DNA probes labeled with fluorescent stains. Dose-response curves for the induction of chromatin fragments shortly after exposure, as well as the kinetics of rejoining and misrejoining, were not markedly dependent on linear energy transfer. However, after exposure to heavy ions, more aberrations were scored in the interphase cells after incubation for repair than in metaphase samples harvested at the first postirradiation mitosis. On the other hand, no significant differences were observed in the two samples after exposure to sparsely ionizing radiation. These results suggest that interphase chromosome painting can be a useful tool for biodosimetry of particle radiation.

  12. Premature translation of protamine 1 mRNA causes precocious nuclear condensation and arrests spermatid differentiation in mice.

    Science.gov (United States)

    Lee, K; Haugen, H S; Clegg, C H; Braun, R E

    1995-01-01

    Translational control is a major form of regulating gene expression during gametogenesis and early development in many organisms. We sought to determine whether the translational repression of the protamine 1 (Prm1) mRNA is necessary for normal spermatid differentiation in mice. To accomplish this we generated transgenic animals that carry a Prm1 transgene lacking its normal 3' untranslated region. Premature translation of Prm1 mRNA caused precocious condensation of spermatid nuclear DNA, abnormal head morphogenesis, and incomplete processing of Prm2 protein. Premature accumulation of Prm1 within syncytial spermatids in mice hemizygous for the transgene caused dominant male sterility, which in some cases was accompanied by a complete arrest in spermatid differentiation. These results demonstrate that correct temporal synthesis of Prm1 is necessary for the transition from nucleohistones to nucleoprotamines. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:8618919

  13. Simple biodosimetry method for cases of high-dose radiation exposure using the ratio of the longest/shortest length of Giemsa-stained drug-induced prematurely condensed chromosomes (PCC).

    Science.gov (United States)

    Gotoh, E; Tanno, Y

    2005-05-01

    The aim was to develop a simple biodosimetry method for as rapid as possible estimation of absorbed radiation doses in victims of radiation accidents, in particular after high-dose exposure. Human peripheral blood lymphocytes (PBL) were gamma-irradiated in vitro with several doses up to 40 Gy stimulated with phytohaemagglutinin-P (PHA-P) for 2 days and their chromosomes condensed prematurely using 50 nm calyculin A. Chromosome lengths of Giemsa-stained G2 prematurely condensed chromosomes (PCC) were measured using image analysing software and the ratio of the longest/shortest chromosome length was calculated. The length ratio (LR) of the longest/shortest Giemsa-stained chromosome s increased with a good correlation to the square root of the radiation dose (D) up to 40 Gy, i.e. LR = (4.90 x D0.5) + 2.14. The LR of the longest/shortest chromosome might be used as an index for estimating the radiation dose. The blood samples should not be cooled until the start of separation/stimulation of the lymphocytes. A rapid and easy estimation of large doses after whole-body exposure was identified by measuring the ratio of the longest/shortest length of Giemsa-stained G2-PCC induced by calyculin A. This simple protocol will be particularly useful for making therapy decisions for victims of ionizing radiation exposure and has potential for use as a biodosimeter for partial-body exposure accidents.

  14. Detection and Automated Scoring of Dicentric Chromosomes in Nonstimulated Lymphocyte Prematurely Condensed Chromosomes After Telomere and Centromere Staining

    Energy Technology Data Exchange (ETDEWEB)

    M' kacher, Radhia [Laboratoire de Radiobiologie et Oncologie, Commissariat à l' Energie Atomique, Fontenay-aux-Roses (France); El Maalouf, Elie [Laboratoire de Radiobiologie et Oncologie, Commissariat à l' Energie Atomique, Fontenay-aux-Roses (France); Laboratoire Modélisation Intelligence Processus Systèmes (MIPS)–Groupe TIIM3D, Université de Haute-Alsace, Mulhouse (France); Terzoudi, Georgia [Laboratory of Radiobiology & Biodosimetry, National Center for Scientific Research Demokritos, Athens (Greece); Ricoul, Michelle [Laboratoire de Radiobiologie et Oncologie, Commissariat à l' Energie Atomique, Fontenay-aux-Roses (France); Heidingsfelder, Leonhard [MetaSystems, Altlussheim (Germany); Karachristou, Ionna [Laboratory of Radiobiology & Biodosimetry, National Center for Scientific Research Demokritos, Athens (Greece); Laplagne, Eric [Pole Concept, Paris (France); Hempel, William M. [Laboratoire de Radiobiologie et Oncologie, Commissariat à l' Energie Atomique, Fontenay-aux-Roses (France); Colicchio, Bruno; Dieterlen, Alain [Laboratoire Modélisation Intelligence Processus Systèmes (MIPS)–Groupe TIIM3D, Université de Haute-Alsace, Mulhouse (France); Pantelias, Gabriel [Laboratory of Radiobiology & Biodosimetry, National Center for Scientific Research Demokritos, Athens (Greece); Sabatier, Laure, E-mail: laure.sabatier@cea.fr [Laboratoire de Radiobiologie et Oncologie, Commissariat à l' Energie Atomique, Fontenay-aux-Roses (France)

    2015-03-01

    Purpose: To combine telomere and centromere (TC) staining of premature chromosome condensation (PCC) fusions to identify dicentrics, centric rings, and acentric chromosomes, making possible the realization of a dose–response curve and automation of the process. Methods and Materials: Blood samples from healthy donors were exposed to {sup 60}Co irradiation at varying doses up to 8 Gy, followed by a repair period of 8 hours. Premature chromosome condensation fusions were carried out, and TC staining using peptide nucleic acid probes was performed. Chromosomal aberration (CA) scoring was carried out manually and automatically using PCC-TCScore software, developed in our laboratory. Results: We successfully optimized the hybridization conditions and image capture parameters, to increase the sensitivity and effectiveness of CA scoring. Dicentrics, centric rings, and acentric chromosomes were rapidly and accurately detected, leading to a linear-quadratic dose–response curve by manual scoring at up to 8 Gy. Using PCC-TCScore software for automatic scoring, we were able to detect 95% of dicentrics and centric rings. Conclusion: The introduction of TC staining to the PCC fusion technique has made possible the rapid scoring of unstable CAs, including dicentrics, with a level of accuracy and ease not previously possible. This new approach can be used for biological dosimetry in radiation emergency medicine, where the rapid and accurate detection of dicentrics is a high priority using automated scoring. Because there is no culture time, this new approach can also be used for the follow-up of patients treated by genotoxic therapy, creating the possibility to perform the estimation of induced chromosomal aberrations immediately after the blood draw.

  15. Evaluation of radiosensitivity of human tumor cells after irradiation of γ-rays based on G2-chromosome aberrations

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The aim of the present investigation is to determine initial G2-chromosome aberrations and to validate whether the G2-chromosome aberrations can predict the cellular clonogenic survival in human tumor cell lines. Cell lines of human ovary carcinoma cells (HO8910) and human hepatoma cells (HepG2) were irradiated with a range of doses and assessed both for initial G2-chromosome aberrations and for cell survival after γ-irradiation. The initial G2-chromosome aberrations were measured by counting the number of G2-chromatid breaks after irradiation, detected by the premature chromosome condensation technique, and the G2-assay method. Cell survival was documented by a colony formation assay. A linear-quadratic survival curve was observed in both cell lines. The dose-response results show that the numbers of G2-chromatid breaks increase with the increase in dose in the two cell lines. At higher doses (higher than 4 Gy) of irradiation, the number of G2-chromatid breaks for the G2-assay method cannot be determined because too few cells reach mitosis, and hence their detection is difficult. A good correlation is found between the clonogenic survival and the radiation-induced initial G2-chromatid breaks per cell (r=0.9616). The present results suggest that the premature chromosome condensation technique may be useful for determining chromatid breaks in G2 cells, and the number of initial G2-chromatid breaks holds promise for predicting the radiosensitivity of tumor cells.

  16. Establishment of Dose-response Curves for Dicentrics and Premature Chromosome Condensation for Radiological Emergency Preparedness in Thailand

    Science.gov (United States)

    Rungsimaphorn, Benchawan; Rerkamnuaychoke, Budsaba; Sudprasert, Wanwisa

    2016-01-01

    The in vitro dose calibration curves using conventional biological dosimetry – dicentric chromosome assay (DCA) and premature chromosome condensation (PCC) assay – were performed for the first time in Thailand for reconstruction of radiation dose in the exposed individuals. The peripheral blood lymphocyte samples from healthy donors were irradiated with 137Cs source at a dose rate of 0.652 Gy/min to doses of 0.1, 0.25, 0.5, 0.75, 1, 2, 3, 4, and 5 Gy for DCA technique, and 5, 10, 15, 20, and 25 Gy for PCC technique. The blood samples were cultured and processed following the standard procedure as prescribed in the International Atomic Energy Agency report with slight modifications. The yield of dicentrics with dose from at least 1000 metaphases or 100 dicentrics was fitted to a linear quadratic model using Chromosome Aberration Calculation Software (CABAS, version 2.0) whereas those of PCC rings with dose from 100 rings was fitted to a linear quadratic equation at doses from 0 to 15 Gy. These curves will be useful for in vitro dose reconstruction and can support the preparedness for overexposure to radiation among public or occupational workers and eventual radiological accident in Thailand. PMID:28217284

  17. Stress induced by premature chromatin condensation triggers chromosome shattering and chromothripsis at DNA sites still replicating in micronuclei or multinucleate cells when primary nuclei enter mitosis.

    Science.gov (United States)

    Terzoudi, Georgia I; Karakosta, Maria; Pantelias, Antonio; Hatzi, Vasiliki I; Karachristou, Ioanna; Pantelias, Gabriel

    2015-11-01

    Combination of next-generation DNA sequencing, single nucleotide polymorphism array analyses and bioinformatics has revealed the striking phenomenon of chromothripsis, described as complex genomic rearrangements acquired in a single catastrophic event affecting one or a few chromosomes. Via an unproven mechanism, it is postulated that mechanical stress causes chromosome shattering into small lengths of DNA, which are then randomly reassembled by DNA repair machinery. Chromothripsis is currently examined as an alternative mechanism of oncogenesis, in contrast to the present paradigm that considers a stepwise development of cancer. While evidence for the mechanism(s) underlying chromosome shattering during cancer development remains elusive, a number of hypotheses have been proposed to explain chromothripsis, including ionizing radiation, DNA replication stress, breakage-fusion-bridge cycles, micronuclei formation and premature chromosome compaction. In the present work, we provide experimental evidence on the mechanistic basis of chromothripsis and on how chromosomes can get locally shattered in a single catastrophic event. Considering the dynamic nature of chromatin nucleoprotein complex, capable of rapid unfolding, disassembling, assembling and refolding, we first show that chromatin condensation at repairing or replicating DNA sites induces the mechanical stress needed for chromosome shattering to ensue. Premature chromosome condensation is then used to visualize the dynamic nature of interphase chromatin and demonstrate that such mechanical stress and chromosome shattering can also occur in chromosomes within micronuclei or asynchronous multinucleate cells when primary nuclei enter mitosis. Following an aberrant mitosis, chromosomes could find themselves in the wrong place at the wrong time so that they may undergo massive DNA breakage and rearrangement in a single catastrophic event. Specifically, our results support the hypothesis that premature chromosome

  18. Effects of inhibitors of DNA, RNA, and protein synthesis on frequencies and types of premature chromosome condensation from x-ray induced micronuclei. [Cytosine arabinoside, azathioprine, thymidine, trenimon

    Energy Technology Data Exchange (ETDEWEB)

    Madle, S.; Nowak, J.; Obe, G.

    1976-10-28

    Cells containing x-ray induced micronuclei were treated for a few hours before fixation with inhibitors of DNA synthesis (cytosine arabinoside; azathioprine; thymidine; trenimon), of RNA synthesis (actinomycin D; ethidium bromide), and of protein synthesis (puromycin). Only the inhibitors of DNA synthesis lead to a significant suppression of the frequencies of mitoses with micronucleus derived premature chromosome condensation (PCC). We tend to interpret the result as follows: Micronuclei that are in the G1 phase of their cell cycles are accumulated at the G1/S border or in the early S phase of their cell cycles under the influence of the inhibitors of the DNA synthesis. Micronuclei blocked in this way cannot be induced to undergo PCC and seem to disappear from the cells.

  19. Rapid assessment of high-dose radiation exposures through scoring of cell-fusion-induced premature chromosome condensation and ring chromosomes.

    Science.gov (United States)

    Lamadrid Boada, A I; Romero Aguilera, I; Terzoudi, G I; González Mesa, J E; Pantelias, G; García, O

    2013-09-18

    Analysis of premature chromosome condensation (PCC) mediated by fusion of G0-lymphocytes with mitotic CHO cells in combination with rapid visualization and quantification of rings (PCC-Rf) is proposed as an alternative technique for dose assessment of radiation-exposed individuals. Isolated lymphocytes or whole blood from six individuals were γ-irradiated with 5, 10, 15 and 20Gy at a dose rate of 0.5Gy/min. Following either 8- or 24-h post-exposure incubation of irradiated samples at 37°C, chromosome spreads were prepared by standard PCC cytogenetic procedures. The protocol for PCC fusion proved to be effective at doses as high as 20Gy, enabling the analysis of ring chromosomes and excess PCC fragments. The ring frequencies remained constant during the 8-24-h repair time; the pooled dose relationship between ring frequency (Y) and dose (D) was linear: Y=(0.088±0.005)×D. During the repair time, excess fragments decreased from 0.91 to 0.59 chromatid pieces per Gy, revealing the importance of information about the exact time of exposure for dose assessment on the basis of fragments. Compared with other cytogenetic assays to estimate radiation dose, the PCC-Rf method has the following benefits: a 48-h culture time is not required, allowing a much faster assessment of dose in comparison with conventional scoring of dicentrics and rings in assays for chemically-induced premature chromosome condensation (PCC-Rch), and it allows the analysis of heavily irradiated lymphocytes that are delayed or never reach mitosis, thus avoiding the problem of saturation at high doses. In conclusion, the use of the PCC fusion assay in conjunction with scoring of rings in G0-lymphocytes offers a suitable alternative for fast dose estimation following accidental exposure to high radiation doses.

  20. Caffeine-Induced Premature Chromosome Condensation Results in the Apoptosis-Like Programmed Cell Death in Root Meristems of Vicia faba.

    Directory of Open Access Journals (Sweden)

    Dorota Rybaczek

    Full Text Available We have demonstrated that the activation of apoptosis-like programmed cell death (AL-PCD was a secondary result of caffeine (CF induced premature chromosome condensation (PCC in hydroxyurea-synchronized Vicia faba root meristem cells. Initiation of the apoptotic-like cell degradation pathway seemed to be the result of DNA damage generated by treatment with hydroxyurea (HU [double-stranded breaks (DSBs mostly] and co-treatment with HU/CF [single-stranded breaks (SSBs mainly]. A single chromosome comet assay was successfully used to study different types of DNA damage (neutral variant-DSBs versus alkaline-DSBs or SSBs. The immunocytochemical detection of H2AXS139Ph and PARP-2 were used as markers for DSBs and SSBs, respectively. Acridine orange and ethidium bromide (AO/EB were applied for quantitative immunofluorescence measurements of dead, dying and living cells. Apoptotic-type DNA fragmentation and positive TUNEL reaction finally proved that CF triggers AL-PCD in stressed V. faba root meristem cells. In addition, the results obtained under transmission electron microscopy (TEM further revealed apoptotic-like features at the ultrastructural level of PCC-type cells: (i extensive vacuolization; (ii abnormal chromatin condensation, its marginalization and concomitant degradation; (iii formation of autophagy-like vesicles (iv protoplast shrinkage (v fragmentation of cell nuclei and (vi extensive degeneration of the cells. The results obtained have been discussed with respect to the vacuolar/autolytic type of plant-specific AL-PCD.

  1. The g-2 ring

    CERN Multimedia

    1974-01-01

    The precise measurement of "g-2", the anomalous magnetic moment of the muon, required a special muon storage ring with electrostatic focussing and very accurate knowledge of the magnetic bending field. For more details see under photo 7405430.

  2. Direct analysis of radiation-induced chromosome fragments and rings in unstimulated human peripheral blood lymphocytes by means of the premature chromosome condensation technique.

    Science.gov (United States)

    Pantelias, G E; Maillie, H D

    1985-03-01

    Development of the procedure to stimulate peripheral blood lymphocytes has greatly facilitated the understanding of chromosome aberration formation and repair mechanisms in human cells. Yet, because radiation induces far more initial chromosome breaks than are observed as aberrations in metaphase, it has not been possible to examine the kinetics of primary chromosome breakage and rejoining with this procedure. An improved method to induce premature chromosome condensation in unstimulated lymphocytes has been used to study primary chromosome breakage, rejoining, and ring formation at various times after irradiation with up to 800 rad of X-rays. The dose-response relations for chromosome fragments analyzed immediately or 1, 2, or 24 h after exposure were found to be linear. Rapid rejoining of chromosome fragments, which takes place in the first 3 h after X-ray exposure, was not correlated with a simultaneous increase in the formation of rings. The yield of rings per cell scored 24 h after irradiation, however, increased significantly and fit a linear quadratic equation. Both chromosome fragment rejoining and ring formation were completed about 6 h after irradiation. The frequency distributions of rings among cells followed a Poisson distribution, whereas chromosome fragments were overdispersed.

  3. Prediction of human cell radiosensitivity: Comparison of clonogenic assay with chromosome aberrations scored using premature chromosome condensation with fluorescence in situ hybridization

    Energy Technology Data Exchange (ETDEWEB)

    Sasai, K.; Evans, J.W.; Kovacs, M.S. [Stanford Univ. School of Medicine, CA (United States)] [and others

    1994-12-01

    The purpose of the present investigation was to determine whether chromosome aberrations scored by premature chromosome condensation (PCC) and fluorescence in situ hybridization (FISH) can predict the radiosensitivity of human cell lines, thereby providing a possible means of assessing the in situ radiosensitivity of normal tissues and the radiocurability of individual human cancers. We used four cells lines of different radiosensitivity: normal human fibroblasts (AG1522), ataxia-telangiectasia fibroblasts (AT2052), a human fibrosarcoma cell line (HT1080), and a human melanoma cell line (melanoma 903). These were irradiated in plateau phase with a range of doses and assessed both for clonogenic cell survival and for aberrations in a single chromosome (number 4) immediately after, and 24 h after irradiation. The initial number of breaks in chromosome 4 was proportional to irradiation dose and was identical for all the different human cell lines, irrespective of radiosensitivity. On the other hand, the number of chromosome 4 breaks remaining 24 h after irradiation reflected the radiosensitivity of the cells such that the relationship between residual chromosome aberrations and cell survival was the same for the different cell lines. These results suggest that the scoring of chromosome aberrations in interphase using FISH with PCC holds considerable promise for predicting the radiosensitivity of normal and tumor tissues in situ. 28 refs., 4 figs.

  4. Open G(2) strings

    NARCIS (Netherlands)

    de Boer, J.; de Medeiros, P.; El-Showk, S.; Sinkovics, A.

    2008-01-01

    We consider an open string version of the topological twist previously proposed for sigma-models with G(2) target spaces. We determine the cohomology of open strings states and relate these to geometric deformations of calibrated submanifolds and to flat or anti-self-dual connections on such submani

  5. G2 gauge theories

    CERN Document Server

    Maas, Axel

    2012-01-01

    QCD can be formulated using any gauge group. One particular interesting choice is to replace SU(3) by the exceptional group G2. Conceptually, this group is the simplest group with a trivial center. It thus permits to study the conjectured relevance of center degrees of freedom for QCD. Practically, since all its representation are real, it is possible to perform lattice simulations for this theory also at finite baryon densities. It is thus an excellent environment to test methods and to investigate general properties of gauge theories at finite densities. We review the status of our understanding of gauge theories with the gauge group G2, including Yang-Mills theory, Yang-Mills-Higgs theory, and QCD both in the vacuum and in the phase diagram.

  6. UPSS and G2

    Science.gov (United States)

    Dito, Scott J.

    2014-01-01

    The Universal Propellant Servicing System (UPSS) is a dedicated mobile launcher propellant delivery method that will minimize danger and complexity in order to allow vehicles to be serviced and ultimately launched from a variety of locations previously not seen fit for space launch. The UPPS/G2 project is the development of a model, simulation, and ultimately a working application that will control and monitor the cryogenic fluid delivery to the rocket for testing purposes. To accomplish this, the project is using the programming language/environment Gensym G2. The environment is an all-inclusive application that allows development, testing, modeling, and finally operation of the unique application through graphical and programmatic methods. We have learned G2 through classes and trial-and-error, and are now in the process of building the application that will soon be able to be tested on apparatuses here at Kennedy Space Center, and eventually on the actual unit. The UPSS will bring near-autonomous control of launches to those that need it, as well it will be a great addition to NASA and KSC's operational viability and the opportunity to bring space launches to parts of the world, and in time constraints, once not thought possible.

  7. Muon g-2

    CERN Document Server

    Sichtermann, E P; Bousquet, B; Brown, H N; Bunce, G M; Carey, R M; Cushman, P B; Danby, G T; Debevec, P T; Deile, M; Deng, H; Deninger, W; Dhawan, S K; Druzhinin, V P; Duong, L; Efstathiadis, E F; Farley, F J M; Fedotovich, G V; Giron, S; Gray, F E; Grigoriev, D; Grosse-Perdekamp, M; Grossmann, A; Hare, M; Hertzog, D W; Huang, X; Hughes, V W; Iwasaki, M; Jungmann, Klaus; Kawall, D; Khazin, B I; Kindem, J; Krienen, F; Kronkvist, I J; Lam, A; Larsen, R; Lee, Y Y; Logashenko, I B; McNabb, R; Meng, W; Mi, J; Miller, J P; Morse, W M; Nikas, D; Onderwater, Gerco; Orlov, Yu F; Ozben; Paley, J M; Peng, Q; Polly, C C; Pretz, J; Prigl, R; zu Putlitz, Gisbert; Qian, T; Redin, S I; Rind, O; Roberts, B L; Ryskulov, N M; Shagin, P; Semertzidis, Y K; Shatunov, Yu M; Sichtermann, E P; Solodov, E; Sossong, M; Steinmetz, A; Sulak, L R; Trofimov, A; Urner, D; Von Walter, P; Warburton, D; Yamamoto, A

    2003-01-01

    The muon g-2 collaboration has measured the anomalous magnetic g value of the positive muon to within a relative uncertainty of 0.7 parts per million. The result, a_{\\mu^+} = 11 659 204(7)(5) x 10^{-10} is in good agreement with the preceding data on a_{\\mu^+} and a_{\\mu^-} and has about twice smaller uncertainty. The measurement tests standard model theory, which at the level of the experimental uncertainty involves quantum electrodynamics, quantum chromodynamics, and electroweak interaction in significant ways. The analysis of the anomalous magnetic g value of the negative muon is well underway.

  8. Premature Contractions

    Science.gov (United States)

    ... Peripheral Artery Disease Venous Thromboembolism Aortic Aneurysm More Premature Contractions - PACs and PVCs Updated:Dec 15,2016 ... You felt this more-forceful beat. Types of premature contractions Premature atrial contractions (PACs) start in the ...

  9. Premature infant

    Science.gov (United States)

    There are many support groups for parents of premature babies. Ask the social worker in the neonatal intensive care unit. ... Prematurity used to be a major cause of infant deaths. Improved ... Prematurity can have long-term effects. Many premature infants ...

  10. Dual Superconductivity in G2 group

    CERN Document Server

    Cossu, G; Di Giacomo, Adriano; Lucini, B; Pica, C

    2006-01-01

    We investigate the dual superconductivity mechanism in the exceptional group $G_2$. This is a centerless group (no 't Hooft flux vortices are allowed) and we check for the presence of a magnetic monopole condensate in the confined phase by measuring on the lattice a disorder parameter related to the vacuum expectation value of an operator carrying magnetic charge. The behaviour of the disorder parameter is consistent with the dual superconductor picture. A first step of an analysis on the thermodynamical properties of the theory is conducted by mean of this operator.

  11. Premature ejaculation

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/001524.htm Premature ejaculation To use the sharing features on this page, please enable JavaScript. Premature ejaculation is when a man has an orgasm ...

  12. Confinement: G(2) group case

    CERN Document Server

    Cossu, G; Di Giacomo, A; Lucini, B; Pica, C

    2007-01-01

    The gauge group being centreless, $G_2$ gauge theory is a good laboratory for studying the role of the centre of the group for colour confinement in Yang-Mills gauge theories. In this paper, we investigate $G_2$ pure gauge theory at finite temperature on the lattice. By studying the finite size scaling of the plaquette, the Polyakov loop and their susceptibilities, we show that a deconfinement phase transition takes place. The analysis of the pseudocritical exponents give strong evidence of the deconfinement transition being first order. Implications of our findings for scenarios of colour confinement are discussed.

  13. Mouse one-cell embryos undergoing a radiation-induced G2 arrest may re-enter S-phase in the absence of cytokinesis

    Energy Technology Data Exchange (ETDEWEB)

    Jacquet, P.; Buset, J. [Lab. of Radiobiology, Dept. of Radioprotection, CEN/SCK, Boeretang, Mol (Belgium); Vankerkom, J. [Div. of Environmental Research, VITO, Mol (Belgium); Baatout, S.; De Saint-Georges, L.; Schoonjans, W.; Desaintes, C. [Lab. of Radiobiology, Dept. of Radioprotection, CEN/SCK, Boeretang, Mol (Belgium)

    2002-07-01

    PCC (premature chromosome condensation) can be used for visualizing and scoring damage induced by radiation in the chromatin of cells undergoing a G1 or G2 arrest. A method involving the fusion of irradiated single embryonic cells with single MI oocytes was used to induce PCC in mouse zygotes of the BALB/c strain, which suffer a drastic G2 arrest after X-irradiation (dose used 2.5 Gy). Other G2-arrested embryos were exposed in vitro to the phosphatase inhibitor calyculin A. Both methods furnished excellent chromosome preparations of the G2-arrested embryos. The mean number of chromosome fragments did not change significantly during G2 arrest, suggesting that zygotes of this strain are unable to repair DNA damage leading to such aberrations. Forty to fifty percent of the irradiated embryos were unable to cleave after G2 arrest and remained blocked at the one-cell stage for a few days before dying. PCC preparations obtained from such embryos suggested that about 30% of them had undergone a late mitosis not followed by cytokinesis and had entered a new DNA synthesis. These results are discussed in the light of recent observations in irradiated human cells deficient in the p53/14-3-3{sigma} pathway. (author)

  14. Your Premature Baby

    Science.gov (United States)

    ... birth defects, premature birth and infant mortality. Solving premature birth Featured articles Accomplishments and lessons learned since ... Complications & Loss > Preterm labor & premature birth > Premature babies Premature babies E-mail to a friend Please fill ...

  15. Osteopenia - premature infants

    Science.gov (United States)

    Neonatal rickets; Brittle bones - premature infants; Weak bones - premature infants; Osteopenia of prematurity ... the baby. This helps the baby grow. A premature infant may not receive the proper amount of ...

  16. Premature delivery

    Directory of Open Access Journals (Sweden)

    Bernardita Donoso Bernales

    2012-09-01

    Full Text Available Preterm delivery is the single most important cause of perinatal morbidity and mortality. In Chile, preterm births have increased in the past decade, although neonatal morbidity and mortality attributable to it shows a downward trend, thanks to improvements in neonatal care of premature babies, rather than the success of obstetric preventive and therapeutic strategies. This article describes clinical entities, disease processes and conditions that constitute predisposing factors of preterm birth, as well as an outline for the prevention and clinical management of women at risk of preterm birth.

  17. Exceptional Confinement in G(2) Gauge Theory

    CERN Document Server

    Holland, K; Pepé, M; Wiese, U J

    2003-01-01

    We study theories with the exceptional gauge group G(2). The 14 adjoint "gluons" of a G(2) gauge theory transform as {3}, {3bar} and {8} under the subgroup SU(3), and hence have the color quantum numbers of ordinary quarks, anti-quarks and gluons in QCD. Since G(2) has a trivial center, a "quark" in the {7} representation of G(2) can be screened by "gluons". As a result, in G(2) Yang-Mills theory the string between a pair of static "quarks" can break. In G(2) QCD there is a hybrid consisting of one "quark" and three "gluons". In supersymmetric G(2) Yang-Mills theory with a {14} Majorana "gluino" the chiral symmetry is Z(4)_\\chi. Chiral symmetry breaking gives rise to distinct confined phases separated by confined-confined domain walls. A scalar Higgs field in the {7} representation breaks G(2) to SU(3) and allows us to interpolate between theories with exceptional and ordinary confinement. We also present strong coupling lattice calculations that reveal basic features of G(2) confinement. Just as in QCD, wher...

  18. Premature Ventricular Contractions (PVCs)

    Science.gov (United States)

    Diseases and Conditions Premature ventricular contractions (PVCs) By Mayo Clinic Staff Premature ventricular contractions (PVCs) are extra, abnormal heartbeats that begin in one of your heart's two ...

  19. Premature ejaculation

    Directory of Open Access Journals (Sweden)

    Chris G McMahon

    2007-01-01

    Full Text Available Premature ejaculation (PE is a common male sexual disorder. Recent normative data suggests that men with an intravaginal ejaculatory latency time (IELT of less than 1 minute have "definite" PE, while men with IELTs between 1 and 1.5 minutes have "probable" PE. Although there is insufficient empirical evidence to identify the etiology of PE, there is limited correlational evidence to suggest that men with PE have high levels of sexual anxiety and inherited altered sensitivity of central 5-HT (5-hydroxytryptamine, serotonin receptors. Pharmacological modulation of the ejaculatory threshold using off-label daily or on-demand selective serotonin re-uptake inhibitors is well tolerated and offers patients a high likelihood of achieving improved ejaculatory control within a few days of initiating treatment, consequential improvements in sexual desire and other sexual domains. Investigational drugs such as the ejaculo-selective serotonin transport inhibitor, dapoxetine represent a major development in sexual medicine. These drugs offer patients the convenience of on-demand dosing, significant improvements in IELT, ejaculatory control and sexual satisfaction with minimal adverse effects.

  20. Premature ejaculation.

    Science.gov (United States)

    McMahon, Chris G

    2007-04-01

    Premature ejaculation (PE) is a common male sexual disorder. Recent normative data suggests that men with an intravaginal ejaculatory latency time (IELT) of less than 1 minute have "definite" PE, while men with IELTs between 1 and 1.5 minutes have "probable" PE. Although there is insufficient empirical evidence to identify the etiology of PE, there is limited correlational evidence to suggest that men with PE have high levels of sexual anxiety and inherited altered sensitivity of central 5-HT (5-hydroxytryptamine, serotonin) receptors. Pharmacological modulation of the ejaculatory threshold using off-label daily or on-demand selective serotonin re-uptake inhibitors is well tolerated and offers patients a high likelihood of achieving improved ejaculatory control within a few days of initiating treatment, consequential improvements in sexual desire and other sexual domains. Investigational drugs such as the ejaculo-selective serotonin transport inhibitor, dapoxetine represent a major development in sexual medicine. These drugs offer patients the convenience of on-demand dosing, significant improvements in IELT, ejaculatory control and sexual satisfaction with minimal adverse effects.

  1. $\\rm G_2$ holonomy manifolds are superconformal

    CERN Document Server

    Díaz, Lázaro O Rodríguez

    2016-01-01

    We study the chiral de Rham complex (CDR) over a manifold $M$ with holonomy $\\rm G_2$. We prove that the vertex algebra of global sections of the CDR associated to $M$ contains two commuting copies of the Shatashvili-Vafa $\\rm G_2$ superconformal algebra. Our proof is a tour de force, based on explicit computations.

  2. Exceptional Deconfinement in G(2) Gauge Theory

    CERN Document Server

    Pepé, M

    2006-01-01

    The Z(N) center symmetry plays an important role in the deconfinement phase transition of SU(N) Yang-Mills theory at finite temperature. The exceptional group G(2) is the smallest simply connected gauge group with a trivial center. Hence, there is no symmetry reason why the low- and high-temperature regimes in G(2) Yang-Mills theory should be separated by a phase transition. Still, we present numerical evidence for the presence of a first order deconfinement phase transition at finite temperature. Via the Higgs mechanism, G(2) breaks to its SU(3) subgroup when a scalar field in the fundamental {7} representation acquires a vacuum expectation value v. Varying v we investigate how the G(2) deconfinement transition is related to the one in SU(3) Yang-Mills theory. Interestingly, the two transitions seem to be disconnected. We also discuss a potential dynamical mechanism that may explain this behavior.

  3. The G2+G2t complex as a fast and massive outflow?

    CERN Document Server

    Ballone, A; Burkert, A; Gillessen, S; Plewa, P M; Genzel, R; Pfuhl, O; Eisenhauer, F; Ott, T; George, E M; Habibi, M

    2016-01-01

    Observations of the gas component of the cloud G2 in the Galactic Center have revealed its connection to a tail (G2t) lying on the same orbit. More recent studies indicate a connection between G2 and G1, another cloud detected on the blueshifted side of G2's orbit, suggesting a scenario in which G2 is a denser clump in a stream of gas. In this Letter we show that a simulation of an outflow by a central source (possibly a T Tauri star) moving on G2's orbit and interacting with a hot atmosphere surrounding SgrA* can have G2 and G2t as a byproduct. G2 would be the bow-shock formed in the head of the source, while G2t might be the result of the stripping of the rest of the shocked material by the ram pressure of the surrounding hot gas and of its successive accumulation in the trailing region. Mock position-velocity diagrams for the Br$\\gamma$ emission for this simulation can indeed reproduce the correct position and velocity of G2t, as well as the more tenuous material in between. Though some tension between the...

  4. G_2 gauge theory at finite temperature

    CERN Document Server

    Cossu, Guido; Di Giacomo, Adriano; Lucini, Biagio; Pica, Claudio

    2007-01-01

    The gauge group being centreless, $G_2$ gauge theory is a good laboratory for studying the role of the centre of the group for colour confinement in Yang-Mills gauge theories. In this paper, we investigate $G_2$ pure gauge theory at finite temperature on the lattice. By studying the finite size scaling of the plaquette, the Polyakov loop and their susceptibilities, we show that a deconfinement phase transition takes place. The analysis of the pseudocritical exponents give strong evidence of the deconfinement transition being first order. Implications of our findings for scenarios of colour confinement are discussed.

  5. Establishment of a mouse model with misregulated chromosome condensation due to defective Mcph1 function.

    Directory of Open Access Journals (Sweden)

    Marc Trimborn

    Full Text Available Mutations in the human gene MCPH1 cause primary microcephaly associated with a unique cellular phenotype with premature chromosome condensation (PCC in early G2 phase and delayed decondensation post-mitosis (PCC syndrome. The gene encodes the BRCT-domain containing protein microcephalin/BRIT1. Apart from its role in the regulation of chromosome condensation, the protein is involved in the cellular response to DNA damage. We report here on the first mouse model of impaired Mcph1-function. The model was established based on an embryonic stem cell line from BayGenomics (RR0608 containing a gene trap in intron 12 of the Mcph1 gene deleting the C-terminal BRCT-domain of the protein. Although residual wild type allele can be detected by quantitative real-time PCR cell cultures generated from mouse tissues bearing the homozygous gene trap mutation display the cellular phenotype of misregulated chromosome condensation that is characteristic for the human disorder, confirming defective Mcph1 function due to the gene trap mutation. While surprisingly the DNA damage response (formation of repair foci, chromosomal breakage, and G2/M checkpoint function after irradiation appears to be largely normal in cell cultures derived from Mcph1(gt/gt mice, the overall survival rates of the Mcph1(gt/gt animals are significantly reduced compared to wild type and heterozygous mice. However, we could not detect clear signs of premature malignant disease development due to the perturbed Mcph1 function. Moreover, the animals show no obvious physical phenotype and no reduced fertility. Body and brain size are within the range of wild type controls. Gene expression on RNA and protein level did not reveal any specific pattern of differentially regulated genes. To the best of our knowledge this represents the first mammalian transgenic model displaying a defect in mitotic chromosome condensation and is also the first mouse model for impaired Mcph1-function.

  6. Retinopathy of Prematurity (ROP)

    Science.gov (United States)

    ... of Prematurity (ROP) Facts About Retinopathy of Prematurity (ROP) This information was developed by the National Eye ... blind from ROP. Are there different stages of ROP? Yes. ROP is classified in five stages, ranging ...

  7. M-theory and G_2 Manifolds

    CERN Document Server

    Becker, Katrin; Robbins, Daniel

    2015-01-01

    In this talk we report on recent progress in describing compactifications of string theory and M-theory on G_2 and Spin(7) manifolds. We include the infinite set of alpha'-corrections and describe the entire tower of massless and massive Kaluza-Klein modes resulting from such compactifications.

  8. Experimental measurement of muon (g-2)

    CERN Document Server

    Gray, F E

    2003-01-01

    The muon (g-2) experiment at Brookhaven National Laboratory has measured the anomalous magnetic moment of the positive muon with a precision of 0.7 ppm. This paper presents that result, concentrating on some of the important experimental issues that arise in extracting the anomalous precession frequency from the data.

  9. The Keplerian orbit of G2

    CERN Document Server

    Meyer, L; Witzel, G; Do, T; Phifer, K; Sitarski, B N; Morris, M R; Boehle, A; Yelda, S; Lu, J R; Becklin, E

    2013-01-01

    We give an update of the observations and analysis of G2 - the gaseous red emission-line object that is on a very eccentric orbit around the Galaxy's central black hole and predicted to come within 2400 Rs in early 2014. During 2013, the laser guide star adaptive optics systems on the W. M. Keck I and II telescopes were used to obtain three epochs of spectroscopy and imaging at the highest spatial resolution currently possible in the near-IR. The updated orbital solution derived from radial velocities in addition to Br-Gamma line astrometry is consistent with our earlier estimates. Strikingly, even ~6 months before pericenter passage there is no perceptible deviation from a Keplerian orbit. We furthermore show that a proposed "tail" of G2 is likely not associated with it but is rather an independent gas structure. We also show that G2 does not seem to be unique, since several red emission-line objects can be found in the central arcsecond. Taken together, it seems more likely that G2 is ultimately stellar in ...

  10. Pharmacotherapy for premature ejaculation

    NARCIS (Netherlands)

    Waldinger, Marcel D

    PURPOSE OF REVIEW: As there are various drugs and different treatment strategies to delay ejaculation, a review of the current drug treatments for premature ejaculation is relevant for daily clinical practice. RECENT FINDINGS: There are four premature ejaculation subtypes: lifelong premature

  11. Pharmacotherapy for premature ejaculation

    NARCIS (Netherlands)

    Waldinger, Marcel D

    2014-01-01

    PURPOSE OF REVIEW: As there are various drugs and different treatment strategies to delay ejaculation, a review of the current drug treatments for premature ejaculation is relevant for daily clinical practice. RECENT FINDINGS: There are four premature ejaculation subtypes: lifelong premature ejacula

  12. Health Issues of Premature Babies

    Science.gov (United States)

    ... Text Size Email Print Share Health Issues of Premature Babies Page Content Because premature babies are born before they are physically ready ... associated with prematurity. Because of these health concerns, premature babies are given extra medical attention and assistance ...

  13. Water Condensation

    DEFF Research Database (Denmark)

    Jensen, Kasper Risgaard; Fojan, Peter; Jensen, Rasmus Lund

    2014-01-01

    The condensation of water is a phenomenon occurring in multiple situations in everyday life, e.g., when fog is formed or when dew forms on the grass or on windows. This means that this phenomenon plays an important role within the different fields of science including meteorology, building physics......, and chemistry. In this review we address condensation models and simulations with the main focus on heterogeneous condensation of water. The condensation process is, at first, described from a thermodynamic viewpoint where the nucleation step is described by the classical nucleation theory. Further, we address...

  14. Probing Bino Contribution to Muon g-2

    CERN Document Server

    Endo, Motoi; Kikahara, Teppei; Yoshinaga, Takahiro

    2013-01-01

    We study SUSY models in which Bino contributions solve the muon $g-2$ anomaly. The contributions are enhanced by large left-right mixing of the smuons. However, it is constrained by the vacuum stability condition of the slepton--Higgs potential. Therefore, there are upper bounds on masses of sleptons and Bino. When the slepton soft masses are universal, the upper bound on the smuon mass becomes $330~(460)\\GeV$ in order to solve the $g-2$ anomaly at the $1\\sigma~(2\\sigma)$ level. It is within the reach of LHC and ILC. If the stau is heavier than the smuon, the bound can be as large as $1.4~(1.9)\\TeV$. Such non-universal slepton mass spectrum generically predicts too large LFV/CPV. We show that the models are expected to be probed by LHC/ILC and LFV/CPV complementarily in future.

  15. The "g-2" Muon Storage Ring

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    The "g-2" muon storage ring, shortly before completion in June 1974. Bursts of pions (from a target, hit by a proton beam from the 26 GeV PS) are injected and polarized muons from their decay are captured on a stable orbit. When the muons decay too, their precession in the magnetic field of the storage ring causes a modulation of the decay-electron counting rate, from which the muon's anomalous magnetic moment can be determined. In 1977, the "g-2" magnets were modified to build ICE (Initial Cooling Experiment), a proton and antiproton storage ring for testing stochastic and electron cooling. Later on, the magnets had a 3rd life, when the ion storage ring CELSIUS was built from them in Uppsala. For later use as ICE, see 7711282, 7802099, 7809081,7908242.

  16. Nonuniversal Gaugino Masses and Muon g-2

    CERN Document Server

    Gogoladze, Ilia; Shafi, Qaisar; Un, Cem Salih

    2014-01-01

    We consider two classes of supersymmetric models with nonuniversal gaugino masses at M_GUT in an attempt to resolve the apparent muon g-2 anomaly encountered in the Standard Model. We explore two distinct scenarios, one in which all gaugino masses have the same sign at M_GUT, and a second case with opposite sign gaugino masses. The sfermion masses in both cases are assumed to be universal at M_GUT. We exploit the non universality among gaugino masses to realize large mass splitting between the colored and non-colored sfermions. Thus, the sleptons can have masses in the few hundred GeV range, whereas the colored sparticles turn out to be an order of magnitude or so heavier. In both models the resolution of the muon g-2 anomaly is compatible, among other things, with a 125-126 GeV Higgs boson mass and the WMAP dark matter bounds.

  17. Solvability of the $G_2$ Integrable System

    CERN Document Server

    Capella, A; Turbiner, A V; Capella, Antonio; Rosenbaum, Marcos; Turbiner, Alexander

    1997-01-01

    It is shown that the 3-body trigonometric G_2 integrable system is exactly-solvable. If the configuration space is parametrized by certain symmetric functions of the coordinates then, for arbitrary values of the coupling constants, the Hamiltonian can be expressed as a quadratic polynomial in the generators of some Lie algebra of differential operators in a finite-dimensional representation. Four infinite families of eigenstates, represented by polynomials, and the corresponding eigenvalues are described explicitly.

  18. FEI Tecnai G2 F20

    Directory of Open Access Journals (Sweden)

    Martina Luysberg

    2016-06-01

    Full Text Available The FEI Titan Tecnai G2 F20 is a versatile transmission electron microscope which is equipped with a Gatan Tridiem 863P post column image filter (GIF and a high angle energy dispersive X-ray (EDX detector. This set up allows for a variety of experiments such as conventional imaging and diffraction, recording of bright- and dark-field scanning transmission electron microscopy (STEM images, or acquiring elemental maps extracted from energy electron loss spectra (EELS or EDX signals.

  19. M-theory and G2 manifolds

    Science.gov (United States)

    Becker, Katrin; Becker, Melanie; Robbins, Daniel

    2015-11-01

    In this talk we report on recent progress in describing compactifications of string theory and M-theory on G2 and Spin(7) manifolds. We include the infinite set of α’-corrections and describe the entire tower of massless and massive Kaluza-Klein modes resulting from such compactifications. Contribution to the ‘Focus Issue on Gravity, Supergravity and Fundamental Physics: the Richard Arnowitt Symposium’, to be published in Physica Scripta. Based on a talk delivered by Becker at the workshop ‘Superstring Perturbation Theory’ at the Perimeter Institute, 22-24 April 2015.

  20. Status of the Fermilab (g-2) experiment

    CERN Document Server

    Kaspar, J

    2015-01-01

    The upcoming muon (g-2) experiment at Fermilab will measure the anomalous magnetic moment of the muon to a relative precision of 140 ppb, 4 times better than the previous experiment at BNL. The new experiment is motivated by the persistent 3-4 standard deviations difference between the experimental value and the Standard Model prediction, and it will have the statistical sensitivity necessary to either refute the claim or confirm it with a confidence level exceeding a discovery threshold. The experiment is under construction and scheduled to start running in early 2017.

  1. System Administration Support/SWORDS G2

    Science.gov (United States)

    Dito, Scott Joseph

    2014-01-01

    The Soldier-Warfighter Operationally Responsive Deployer for Space (SWORDS) rocket is a dedicated small satellite launcher that will minimize danger and complexity in order to allow soldiers in the field to put payloads of up to 25kg into orbit from the field. The SWORDSG2 project is the development of a model, simulation, and ultimately a working application that will control and monitor the cryogenic fluid delivery to the SWORDS rocket for testing purposes. To accomplish this, the project is using the programming language environment Gensym G2. The environment is an all-inclusive application that allows development, testing, modeling, and finally operation of the unique application through graphical and programmatic methods. In addition, observation of the current cryogenic fluid delivery system in the Kennedy Space Center Cry Lab has allowed me to gain valuable experience of fluid systems and propelant delivery that is valuable to our team when developing amd modeling our own system.The ultimate goal of having a test-ready application to show to the heads of the project, and demonstrating G2's capabilities, by late 2014 will require hard work and intense study and understanding of not only the programming aspect but also the physical phenomena we want to model, observe, and control.

  2. The Muon g-2 experiment at Fermilab

    Directory of Open Access Journals (Sweden)

    Anastasi A.

    2015-01-01

    Full Text Available There is a long standing discrepancy between the Standard Model prediction for the muon g-2 and the value measured by the Brookhaven E821 Experiment. At present the discrepancy stands at about three standard deviations, with a comparable accuracy between experiment and theory. Two new proposals – at Fermilab and J-PARC – plan to improve the experimental uncertainty by a factor of 4, and it is expected that there will be a significant reduction in the uncertainty of the Standard Model prediction. I will review the status of the planned experiment at Fermilab, E989, which will analyse 21 times more muons than the BNL experiment and discuss how the systematic uncertainty will be reduced by a factor of 3 such that a precision of 0.14 ppm can be achieved.

  3. The muon g-2 experiment at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Gohn, W. [Kentucky U.

    2016-11-15

    A new measurement of the anomalous magnetic moment of the muon, $a_{\\mu} \\equiv (g-2)/2$, will be performed at the Fermi National Accelerator Laboratory with data taking beginning in 2017. The most recent measurement, performed at Brookhaven National Laboratory and completed in 2001, shows a 3.5 standard deviation discrepancy with the standard model prediction of $a_\\mu$. The new measurement will accumulate 21 times those statistics using upgraded detection and storage ring systems, enabling a measurement of $a_\\mu$ to 140 ppb, a factor of 4 improvement in the uncertainty the previous measurement. This improvement in precision, combined with recent and ongoing improvements in the evaluation of the QCD contributions to the $a_\\mu$, could provide a 7.5$\\sigma$ discrepancy from the standard model if the current difference between experiment and theory is confirmed, a possible indication of new physics.

  4. The muon g-2 experiment at Fermilab

    CERN Document Server

    Gohn, W

    2016-01-01

    A new measurement of the anomalous magnetic moment of the muon, $a_{\\mu} \\equiv (g-2)/2$, will be performed at the Fermi National Accelerator Laboratory with data taking beginning in 2017. The most recent measurement, performed at Brookhaven National Laboratory and completed in 2001, shows a 3.5 standard deviation discrepancy with the standard model prediction of $a_\\mu$. The new measurement will accumulate 21 times those statistics using upgraded detection and storage ring systems, enabling a measurement of $a_\\mu$ to 140 ppb, a factor of 4 improvement in the uncertainty the previous measurement. This improvement in precision, combined with recent and ongoing improvements in the evaluation of the QCD contributions to the $a_\\mu$, could provide a 7.5$\\sigma$ discrepancy from the standard model if the current difference between experiment and theory is confirmed, a possible indication of new physics.

  5. Positronium contribution to the electron g-2

    Science.gov (United States)

    Fael, M.; Passera, M.

    2014-09-01

    The contribution of positronium to the electron g-2 (ae) has been computed in G. Mishima, arXiv:1311.7109, and found to be of the same order of α as that of five-loop perturbative QED. We confirm this result and correct a few errors in its first derivation. As recently calculated in K. Melnikov, A. Vainshtein, and M. Voloshin, arXiv:1402.5690, a continuum nonperturbative contribution to ae cancels one-half of the positronium one. We show by explicit calculation that the remaining half is already included in the five-loop perturbative result. We also show that it arises from the class I(i) of five-loop diagrams containing only one closed electron loop.

  6. Muon (g-2) Technical Design Report

    CERN Document Server

    Grange, J; Winter, P; Wood, K; Zhao, H; Carey, R M; Gastler, D; Hazen, E; Kinnaird, N; Miller, J P; Mott, J; Roberts, B L; Benante, J; Crnkovic, J; Morse, W M; Sayed, H; Tishchenko, V; Druzhinin, V P; Khazin, B I; Koop, I A; Logashenko, I; Shatunov, Y M; Solodov, E; Korostelev, M; Newton, D; Wolski, A; Bjorkquist, R; Eggert, N; Frankenthal, A; Gibbons, L; Kim, S; Mikhailichenko, A; Orlov, Y; Rubin, D; Sweigart, D; Allspach, D; Annala, G; Barzi, E; Bourland, K; Brown, G; Casey, B C K; Chappa, S; Convery, M E; Drendel, B; Friedsam, H; Gadfort, T; Hardin, K; Hawke, S; Hayes, S; Jaskierny, W; Johnstone, C; Johnstone, J; Kashikhin, V; Kendziora, C; Kiburg, B; Klebaner, A; Kourbanis, I; Kyle, J; Larson, N; Leveling, A; Lyon, A L; Markley, D; McArthur, D; Merritt, K W; Mokhov, N; Morgan, J P; Nguyen, H; Ostiguy, J-F; Para, A; Popovic, C C Polly M; Ramberg, E; Rominsky, M; Schoo, D; Schultz, R; Still, D; Soha, A K; Strigonov, S; Tassotto, G; Turrioni, D; Villegas, E; Voirin, E; Velev, G; Wolff, D; Worel, C; Wu, J-Y; Zifko, R

    2015-01-01

    The Muon (g-2) Experiment, E989 at Fermilab, will measure the muon anomalous magnetic moment a factor-of-four more precisely than was done in E821 at the Brookhaven National Laboratory AGS. The E821 result appears to be greater than the Standard-Model prediction by more than three standard deviations. When combined with expected improvement in the Standard-Model hadronic contributions, E989 should be able to determine definitively whether or not the E821 result is evidence for physics beyond the Standard Model. After a review of the physics motivation and the basic technique, which will use the muon storage ring built at BNL and now relocated to Fermilab, the design of the new experiment is presented. This document was created in partial fulfillment of the requirements necessary to obtain DOE CD-2/3 approval.

  7. A G2-QCD neutron star

    CERN Document Server

    Hajizadeh, Ouraman

    2016-01-01

    The determination of the properties of neutron stars from the underlying theory, QCD, is still an unsolved problem. This is mainly due to the difficulty to obtain reliable results for the equation of state for cold, dense QCD. As an alternative route to obtain qualitative insights, we determine the structure of a neutron star for a modified version of QCD: By replacing the gauge group SU(3) with the exceptional Lie group G2, it is possible to perform lattice simulations at finite density, while still retaining neutrons. Here, results of these lattice simulations are used to determine the mass-radius relation of a neutron star for this theory. The results show that phase changes express themselves in this relation. Also, the radius of the most massive neutron stars is found to vary very little, which would make radius determinations much simpler if this would also be true in QCD.

  8. Hadronic Contribution to $(g-2)_{\\mu}$

    CERN Document Server

    Höcker, A

    2001-01-01

    The recent precise measurement of the muon magnetic anomaly (g-2)_{mu} at BNL opens a window into possible new physics, provided the contribution from hadronic vacuum polarization is well understood. This talk summarizes the development in the evaluation of the leading order hadronic contributions. Significant improvement has been achieved in a series of analyses which is presented historically in three steps: (1), use of tau spectral functions in addition to e+e- cross sections, (2), extended use of perturbative QCD and (3), application of QCD sum rule techniques. The uncertainties, in particular concerning the CVC hypothesis used in step (1), and global quark-hadron duality employed in steps (2) and (3) are discussed. No new analysis results are given in these proceedings.

  9. Muon (g-2) Technical Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Grange, J. [Argonne National Lab. (ANL), Argonne, IL (United States); et al.

    2015-01-27

    The Muon (g-2) Experiment, E989 at Fermilab, will measure the muon anomalous magnetic moment a factor-of-four more precisely than was done in E821 at the Brookhaven National Laboratory AGS. The E821 result appears to be greater than the Standard-Model prediction by more than three standard deviations. When combined with expected improvement in the Standard-Model hadronic contributions, E989 should be able to determine definitively whether or not the E821 result is evidence for physics beyond the Standard Model. After a review of the physics motivation and the basic technique, which will use the muon storage ring built at BNL and now relocated to Fermilab, the design of the new experiment is presented. This document was created in partial fulfillment of the requirements necessary to obtain DOE CD-2/3 approval.

  10. Curcumin and trans-resveratrol exert cell cycle-dependent radioprotective or radiosensitizing effects as elucidated by the PCC and G2-assay

    Energy Technology Data Exchange (ETDEWEB)

    Sebastià, N., E-mail: natividad.sebastia@uv.es [Radiation Protection Service, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Montoro, A. [Radiation Protection Service, Universitary and Politechnic Hospital La Fe, Valencia (Spain); Grupo de Investigación Biomédica en Imagen GIBI230, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Unidad Mixta de Investigación en Endocrinología, Nutrición y Dietética Clínica, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Hervás, D. [Biostatistics Unit, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Pantelias, G.; Hatzi, V.I. [Institute of Nuclear and Radiological Sciences and Technology, Energy and Safety, National Centre for Scientific Research “Demokritos”, Aghia Paraskevi, Athens (Greece); Soriano, J.M. [Grupo de Investigación Biomédica en Imagen GIBI230, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Unidad Mixta de Investigación en Endocrinología, Nutrición y Dietética Clínica, IIS La Fe, Health Research Institute La Fe, Valencia (Spain); Department of Preventive Medicine and Public Health, Faculty of Pharmacy, University of Valencia, Burjassot, Valencia (Spain); Villaescusa, J.I. [Radiation Protection Service, Universitary and Politechnic Hospital La Fe, Valencia (Spain); and others

    2014-08-15

    Highlights: • Curcumin and trans-resveratrol can exert radioprotective or radiosensitizing effects. • The mechanisms underlying such dual action were elucidated using the PCC and G2-assay. • Radioprotection occurs in non-cycling cells exposed to curcumin and resveratrol. • Radiosensitization occurs in cycling cells exposed to the chemicals. • G2-checkpoint abrogation by the chemicals underlies the radiosensitizing mechanism. - Abstract: Curcumin and trans-resveratrol are well-known antioxidant polyphenols with radiomodulatory properties, radioprotecting non-cancerous cells while radiosensitizing tumor cells. This dual action may be the result of their radical scavenging properties and their effects on cell-cycle checkpoints that are activated in response to radiation-induced chromosomal damage. It could be also caused by their effect on regulatory pathways with impact on detoxification enzymes, the up-regulation of endogenous protective systems, and cell-cycle-dependent processes of DNA damage. This work aims to elucidate the mechanisms underlying the dual action of these polyphenols and investigates under which conditions they exhibit radioprotecting or radiosensitizing properties. The peripheral blood lymphocyte test system was used, applying concentrations ranging from 1.4 to 140 μM curcumin and 2.2 to 220 μM trans-resveratrol. The experimental design focuses first on their radioprotective effects in non-cycling lymphocytes, as uniquely visualized using cell fusion-mediated premature chromosome condensation, excluding, thus, cell-cycle interference to repair processes and activation of checkpoints. Second, the radiosensitizing potential of these chemicals on the induction of chromatid breaks in cultured lymphocytes following G2-phase irradiation was evaluated by a standardized G2-chromosomal radiosensitivity predictive assay. This assay uses caffeine for G2-checkpoint abrogation and it was applied to obtain an internal control for radiosensitivity

  11. Essentials of the muon g-2

    Energy Technology Data Exchange (ETDEWEB)

    Jegerlehner, F. [Humboldt-Universitaet, Berlin (Germany). Inst. fuer Physik]|[Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2007-03-15

    The muon anomalous magnetic moment is one of the most precisely measured quantities in particle physics. Recent high precision measurements (0.54 ppm) at Brookhaven reveal a ''discrepancy'' by 3 standard deviations from the electroweak Standard Model which could be a hint for an unknown contribution from physics beyond the Standard Model. This triggered numerous speculations about the possible origin of the ''missing piece''. The remarkable 14-fold improvement of the previous CERN experiment, actually animated a multitude of new theoretical efforts which lead to a substantial improvement of the prediction of a{sub {mu}}. The dominating uncertainty of the prediction, caused by strong interaction effects, could be reduced substantially, due to new hadronic cross section measurements in electron-positron annihilation at low energies. After an introduction and a brief description of the principle of the experiment, I present a major update and review the status of the theoretical prediction and discuss the role of the hadronic vacuum polarization effects and the hadronic light-by-light scattering contribution. Prospects for the future are briefly discussed. As, in electroweak precision physics, the muon g-2 shows the largest established deviation between theory and experiment at present, it will remain one of the hot topics for further investigations. (orig.)

  12. G2 Checkpoint Responses in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    Britt, Anne

    2013-03-18

    This project focused on the mechanism and biological significance of the G2 arrest response to replication stress in plants. We employed both forward and reverse genetic approaches to identify genes required for this response. A total of 3 different postdocs, 5 undergraduates, and 2 graduate students participated in the project. We identified several genes required for damage response in plants, including homologs of genes previously identified in animals (ATM and ATR), novel, a plant-specific genes (SOG1) and a gene known in animals but previously thought to be missing from the Arabidopsis genome (ATRIP). We characterized the transcriptome of gamma-irradiated plants, and found that plants, unlike animals, express a robust transcriptional response to damage, involving genes that regulate the cell cycle and DNA metabolism. This response requires both ATM and the transcription factor SOG1. We found that both ATM and ATR play a role in meiosis in plants. We also found that plants have a cell-type-specific programmed cell death response to ionizing radiation and UV light, and that this response requires ATR, ATM, and SOG1. These results were published in a series of 5 papers.

  13. Condensation Polymerization

    Indian Academy of Sciences (India)

    S Ramakrishnan

    2017-04-01

    The very idea that large polymer molecules can indeed existwas hotly debated during the early part of the 20th century.As highlighted by Sivaram in his articles on Carothersand Flory, Staudinger’s macromolecular hypothesis was finallyaccepted, and the study of polymers gained momentumbecause of the remarkable efforts of the these two individualswho laid down the foundations concerning the processes thatled to the formation of large polymer molecules, and to thosethat led to an understanding of many of their extraordinaryphysical properties. Condensation polymerizations, as thename suggests, utilizes bond-forming reactions that generatea small molecule condensate, which often needs to be continuouslyremoved to facilitate the formation of the polymer. Inthis article, I shall describe some of the essential principles ofcondensation polymerizations or more appropriately calledstep-growth polymerizations; and I will also describe someinteresting extensions that lead to the formation of polymernetworks and highly branched polymers.

  14. Micafungin in Premature and Non-premature Infants

    Science.gov (United States)

    Wu, Chunzhang; Tweddle, Lorraine; Roilides, Emmanuel

    2014-01-01

    Background: Invasive fungal infections cause excessive morbidity and mortality in premature neonates and severely ill infants. Methods: Safety and efficacy outcomes of micafungin were compared between prematurely and non-prematurely born infants premature [birth weight (BW) premature, received ≥1 dose of micafungin. Among premature patients, 14.5% were low BW (1500–2499 g), 36.4% very low BW (1000–1499 g) and 49.1% extremely low BW (premature)] died. Significantly more non-premature than premature patients discontinued treatment (P = 0.003). Treatment-related adverse events were recorded in 23% of patients with no difference between groups. More extremely low BW (n = 4, 15%) and very low BW (n = 8, 40%) infants experienced treatment-related adverse events than low BW (n = 0) and there was no relation to micafungin dose or duration. For a subgroup of 30 patients with invasive candidiasis, treatment success was achieved in 73% in both premature and non-premature groups. Prophylaxis was successful in 4/5 non-premature hematopoietic stem cell transplant patients. Conclusion: Micafungin has a safe profile in premature and non-premature infants with substantial efficacy. PMID:24892849

  15. Comparative study of visual functions in premature pre-school children with and without retinopathy of prematurity

    Directory of Open Access Journals (Sweden)

    Lígia Beatriz Bonotto

    2014-01-01

    Full Text Available Purpose: Observe whether there are differences in visual functions among premature infants with treated retinopathy of prematurity (ROP in relation to preterm infants with ROP and spontaneous regression; and among these two groups with ROP and the control group without ROP. Methods: Crosssectional observational no blind study. Premature infants were born between 06/199206/2006 and were exam between 06/200912/2010; registered in data of Hospital de Olhos Sandalla Amin Ghanem; with gestational age less than or equal to 32 weeks and 1,599 g born weigh; without ROP and ROP stages II or III, in one of the eyes, with spontaneous regression or with treatment; at least three visits during the selection period at maximum 6 months in the first exam and minimum 4 years of age in reassessment (chronological age were include. Premature that did not respond or were not located for reassessment and those that did not have conditions to do the exams were exclude. Study's groups: G1 ROP posttreatment; G2ROP postspontaneous regression; G3 without ROP (control. Visual function evaluated with visual acuity (VA, contrast sensitivity test (CST, color test (CT, eye movement, stereopsis. Results: Overall, there were 24 premature infants and 48 eyes. Normal VA: 64.28% (G1, 87.5% (G2 and 100% (G3; Normal CST: 66.67% (G1, 100% (G2 and 55.56% (G3; Normal Ishihara CT: 100% (G1 and G2 and 86% (G3; Normal Farnsworth CT: 20% (G1, 75% (G2 and 50% (G3. Normal stereoacuity: 0.00% (G1; 25% (G2 and 3.5% (G3. Strabismus: 37% (G2, 0.00% (G1 and G3. The prevalent tendency for lower response in CST and CT between the premature children in group G3 and Farnsworth color test in G1 is a curious result of this work and more study is necessary about these visual functions in older premature children. Conclusion: The visual functions showed no statistically significant difference among the groups studied.

  16. Harmonic maps of finite uniton number into $G_2$

    CERN Document Server

    Correia, N

    2010-01-01

    We establish explicit formulae for canonical factorizations of extended solutions corresponding to harmonic maps of finite uniton number into the exceptional Lie group $G_2$ in terms of the Grassmannian model for the group of based algebraic loops in $G_2$. A description of the ``Frenet frame data" for such harmonic maps is given. In particular, we show that harmonic spheres into $G_2$ correspond to solutions of certain algebraic systems of quadratic and cubic equations.

  17. Condensation heat transfer

    Science.gov (United States)

    Rose, J. W.

    The paper gives a brief description of some of the better understood aspects of condensation heat transfer and includes discussion of the liquid-vapour interface, natural and forced convection laminar film condensation and dropwise condensation.

  18. Lifestyle influences on prematurity.

    Science.gov (United States)

    Creasy, R K

    1991-01-01

    It is apparent from this review that the lifestyle of an individual gravida can potentially lead to a premature delivery. Some of these adverse behavioral characteristics may be dealt with by education and motivation, and some with actual medical treatment. However, there also appears to be significant need for public policy reorientation if we are to make a significant impact on the problem of preterm delivery.

  19. Pro-apoptotic effects of tectorigenin on human hepatocellular carcinoma HepG2 cells

    Science.gov (United States)

    Jiang, Chun-Ping; Ding, Hui; Shi, Da-Hua; Wang, Yu-Rong; Li, Er-Guang; Wu, Jun-Hua

    2012-01-01

    AIM: To investigate the effects of tectorigenin on human hepatocellular carcinoma (HCC) HepG2 cells. METHODS: Tectorigenin, one of the main components of rhizome of Iris tectorum, was prepared by simple methods, such as extraction, filtration, concentration, precipitation and recrystallization. HepG2 cells were incubated with tectorigenin at different concentrations, and their viability was assessed by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Apoptosis was detected by morphological observation of nuclear change, agarose gel electrophoresis of DNA ladder, and flow cytometry with Hoechst 33342, Annexin V-EGFP and propidium iodide staining. Generation of reactive oxygen species was quantified using DCFH-DA. Intracellular Ca2+ was monitored by Fura 2-AM. Mitochondrial membrane potential was monitored using Rhodamine 123. Release of cytochrome c from mitochondria to cytosol was detected by Western blotting. Activities of caspase-3, -8 and -9 were investigated by Caspase Activity Assay Kit. RESULTS: The viability of HepG2 cells treated by tectorigenin decreased in a concentration- and time-dependent manner. The concentration that reduced the number of viable HepG2 cells by 50% (IC50) after 12, 24 and 48 h of incubation was 35.72 mg/L, 21.19 mg/L and 11.06 mg/L, respectively. However, treatment with tectorigenin at 20 mg/L resulted in a very slight cytotoxicity to L02 cells after incubation for 12, 24 or 48 h. Tectorigenin at a concentration of 20 mg/L greatly inhibited the viability of HepG2 cells and induced the condensation of chromatin and fragmentation of nuclei. Tectorigenin induced apoptosis of HepG2 cells in a time- and dose-dependent manner. Compared with the viability rate, induction of apoptosis was the main mechanism of the anti-proliferation effect of tectorigenin in HepG2 cells. Furthermore, tectorigenin-induced apoptosis of HepG2 cells was associated with the generation of reactive oxygen species, increased intracellular [Ca2+]i

  20. Small-x asymptotics of structure function $g_2$

    CERN Document Server

    Ermolaev, B I

    1997-01-01

    Nonsinglet structure function g_2(x) for deep inelastic scattering of a lepton on a constituent quark is calculated in the double logarithmic approximation at x<<1. Small-x asymptotics of g_2 is shown to have the same singular behaviour as asymptotics of the nonsinglet structure function g_1.

  1. The superconducting inflector for the BNL g-2 experiment

    NARCIS (Netherlands)

    Yamamoto, A; Makida, Y; Tanaka, K; Krieman, F; Roberts, BL; Brown, HN; Bunce, G; Danby, GT; G-Perdekamp, M; Hseuh, H; Jia, L.; Lee, YY; Mapes, M; Meng, W; Morse, W; Pai, C; Prigl, R; Sampson, W; Sandberg, J; Suenaga, M; Tallerico, T; Toldo, F; Woodle, K; Green, MA; Itoh, I.; Otsuka, H.; Saito, Y; Ozawa, T; Tachiya, Y; Tanaka, H; Grossmann, A; Jungmann, K; Putlitz, GZ; Deng, H; Dhawan, S; Hughes, Robert E; Kawall, D; Pretz, J; Redin, S; Sichtermann, E; Steinmetz, A

    2002-01-01

    The muon g-2 experiment at Brookhaven National Laboratory (BNL) has the goal of determining the muon anomalous magnetic moment, a(mu) (= (g-2)/2), to the very high precision of 0.35 parts per million and thus requires a storage ring magnet with great stability and homogeneity. A super-ferric storage

  2. 早熟凝集染色体环法在山西太原事故受照射者生物剂量估算中的应用%Biological dose estimation by prematurely condensed chromosomes ring assay for five victims in Shanxi Taiyuan radiation accident

    Institute of Scientific and Technical Information of China (English)

    姚波; 艾辉胜; 李玉芳; 白娟; 周振山; 王军良; 满秋红; 邱丽娟; 刘广贤; 郭梅

    2013-01-01

    OBJECTIVE: To investigate the value of prematurely drug induced condensed chromosomes ring (PCC-R) assay in estimating the biological doses in the victims of radiation accident. METHODS:Samples of peripheral blood were collected from the five victims (subjects 1-5) of the radiation accident of Taiyuan,Shanxi,16 hours after the accident. Bone marrow samples were collected 23 h after and peripheral blood sample 24 h after the accident from subject 1. The frequencies of PCC-R in PCC cells obtained by Okadaic acid (OA) induction were counted. A biological dose estimation was performed by a dose-effect curve of PCC-R (1-20 Gy). The frequencies of the PCC-R for the 4 victims (subjects 2-5) were analyzed 31 days after the accident. The results from PCC-R assay were verified by dicentrics plus centric rings (dic+r),Cytokinesis-block micronuclei (CBMN) assay and physical method. RESULTS:No or rare PCC cells were observed in the peripheral blood cultures from subject 1. However,PCC cells were obtained from bone marrow cultures in subject 1 and in peripheral blood cultures from subject 2-5. The doses estimated for subject 1-5 were 12.4,3.6,3.2,1.7 and 1.5 Gy, respectively. A decrease of PCC-R frequencies were observed 31 days after the accident,and the extent of the decrease were 51%,69%,69% and 44% for the subjects 2-5,respectively,compared with the data 16 h after the accident. The estimated doses were in accordance with those doses estimated by dic+r,CBMN assay,physical method and clinical symptoms. CONCLUSION:Drug induced PCC-R assay is convenient and rapid,and the new curve of PCC-R is accurate and reliable. It is especially suitable for estimating higher dose of irradiation. However,blood samples should be collected as soon as possible and should be done within one month after the accident.%目的:探讨药物诱导的早熟凝集染色体环 (prematurely condensed chromosomes ring,PCC-R)分析方法在辐射事故受照射者生

  3. Superconductivity in noncentrosymmetric A g2P d3S

    Science.gov (United States)

    Yoshida, H.; Okabe, H.; Matsushita, Y.; Isobe, M.; Takayama-Muromachi, E.

    2017-05-01

    We have successfully synthesized the single crystal of A g2P d3S , which exhibits superconductivity with the transition temperature of Tc=2.25 K . A g2P d3S crystallizes in the space group P 4132 with the filled β -Mn structure, which has no inversion symmetry. The value of the Ginzburg-Landau parameter κGL indicates that A g2P d3S is a type-II superconductor. Δ C (Tc) /γnTc=1.50 and 2 Δ /kBTc=3.48 from the heat-capacity analyses indicate that A g2P d3S is a weak-coupling Bardeen-Cooper-Schrieffer (BCS) superconductor with an isotropic superconducting gap. On the other hand, the violation of the Werthamer-Helfand-Hohenberg curve in the H -T phase diagram implies A g2P d3S is not a typical BCS superconductor.

  4. Viral infections and cell cycle G2/M regulation

    Institute of Scientific and Technical Information of China (English)

    Richard Y.ZHAO; Robert T.ELDER

    2005-01-01

    Progression of cells from G2 phase of the cell cycle to mitosis is a tightly regulated cellular process that requires activation of the Cdc2 kinase, which determines onset of mitosis in all eukaryotic cells. In both human and fission yeast(Schizosaccharomyces pombe) cells, the activity of Cdc2 is regulated in part by the phosphorylation status of tyrosine 15(Tyr15) on Cdc2, which is phosphorylated by Wee1 kinase during late G2 and is rapidly dephosphorylated by the Cdc25 tyrosine phosphatase to trigger entry into mitosis. These Cdc2 regulators are the downstream targets of two well-characterized G2/M checkpoint pathways which prevent cells from entering mitosis when cellular DNA is damaged or when DNA replication is inhibited. Increasing evidence suggests that Cdc2 is also commonly targeted by viral proteins,which modulate host cell cycle machinery to benefit viral survival or replication. In this review, we describe the effect of viral protein R (Vpr) encoded by human immunodeficiency virus type 1 (HIV-1) on cell cycle G2/M regulation. Based on our current knowledge about this viral effect, we hypothesize that Vpr induces cell cycle G2 arrest through a mechanism that is to some extent different from the classic G2/M checkpoints. One the unique features distinguishing Vpr-induced G2 arrest from the classic checkpoints is the role of phosphatase 2A (PP2A) in Vpr-induced G2 arrest.Interestingly, PP2A is targeted by a number of other viral proteins including SV40 small T antigen, polyomavirus T antigen, HTLV Tax and adenovirus E4orf4. Thus an in-depth understanding of the molecular mechanisms underlying Vpr-induced G2 arrest will provide additional insights into the basic biology of cell cycle G2/M regulation and into the biological significance of this effect during host-pathogen interactions.

  5. The partial characterization of the antibacterial peptide bacteriocin G2 produced by the probiotic bacteria Lactobacillus plantarum G2

    Directory of Open Access Journals (Sweden)

    SVETLANA L. ŠEATOVIĆ

    2011-05-01

    Full Text Available The aim of this study was the partial characterization of the antimicrobial peptide bacteriocin G2 produced by probiotic bacteria Lactobacillus plantarum G2, which was isolated from a clinical sample of a healthy person. Antimicrobial substance was secreted in the supernatant of an L. plantarum G2 culture, and showed a diverse spectrum of antimicrobial activity of all the tested strains of the genera Lactobacillus and the pathogenic bacteria Staphylococcus aureus and Salmonella аbony. Isoelectric focusing revealed that bacteriocin G2 is a cationic peptide (pI about 10 with a molecular mass of 2.2 kDa according to tricine–sodium dodecyl sulphate–polyacrylamide gel electrophoresis, SDS-PAGE. The antimicrobial activity of bacteriocin G2 was diminished by the proteolytic action of trypsin and proteinase K. Bacteriocin G2 preserved its biological activity in the temperature range 40–60 °C (15 min, which was lost at 80 °C. Bacteriocin G2 was stable in the pH range 2–9, while treatment with 1 % Tween 80 and 1 % urea resulted in increased antimicrobial activity. The probiotic strain L. plantarum G2 produces the antimicrobial substance proteinaceous in nature with bacteriocin characteristics. Bacteriocin production is one of the key properties of probiotic bacteria with clinical potential as anti-infective agents, which will increase the likelihood of its in vivo efficacy.

  6. The effect of natural adjuvants (G2, G2F on lung inflammation of sensitized guinea pigs

    Directory of Open Access Journals (Sweden)

    Ali Neamati

    2013-07-01

    Full Text Available Objective: The effects of natural adjuvants were examined on total and differential WBC counts in lung lavage of sensitized guinea pigs. Materials and Methods: In three sensitized groups of guinea pigs including: untreated sensitized animals (S, sensitized animals treated with adjuvant G2 (S+G2 and G2F (S+G2F as well as non-sensitized group (C (n=6 for each group, total and differential WBC counts of lung lavage were examined. Sensitization of animals was achieved by injection and inhalation of ovalbumin (OA. Results: The results showed increased total WBC, eosinophil, neutrophil, and basophil counts, and decreased lymphocytes in lung lavage of sensitized animals compared with the control group (pConclusion: These results indicate important preventive effects of two natural adjuvants, especially G2, on lung inflammation of sensitized guinea pigs.  

  7. Visualizing Vpr-induced G2 arrest and apoptosis.

    Directory of Open Access Journals (Sweden)

    Tomoyuki Murakami

    Full Text Available Vpr is an accessory protein of human immunodeficiency virus type 1 (HIV-1 with multiple functions. The induction of G2 arrest by Vpr plays a particularly important role in efficient viral replication because the transcriptional activity of the HIV-1 long terminal repeat is most active in G2 phase. The regulation of apoptosis by Vpr is also important for immune suppression and pathogenesis during HIV infection. However, it is not known whether Vpr-induced apoptosis depends on the ability of Vpr to induce G2 arrest, and the dynamics of Vpr-induced G2 arrest and apoptosis have not been visualized. We performed time-lapse imaging to examine the temporal relationship between Vpr-induced G2 arrest and apoptosis using HeLa cells containing the fluorescent ubiquitination-based cell cycle indicator2 (Fucci2. The dynamics of G2 arrest and subsequent long-term mitotic cell rounding in cells transfected with the Vpr-expression vector were visualized. These cells underwent nuclear mis-segregation after prolonged mitotic processes and then entered G1 phase. Some cells subsequently displayed evidence of apoptosis after prolonged mitotic processes and nuclear mis-segregation. Interestingly, Vpr-induced apoptosis was seldom observed in S or G2 phase. Likewise, visualization of synchronized HeLa/Fucci2 cells infected with an adenoviral vector expressing Vpr clearly showed that Vpr arrests the cell cycle at G2 phase, but does not induce apoptosis at S or G2 phase. Furthermore, time-lapse imaging of HeLa/Fucci2 cells expressing SCAT3.1, a caspase-3-sensitive fusion protein, clearly demonstrated that Vpr induces caspase-3-dependent apoptosis. Finally, to examine whether the effects of Vpr on G2 arrest and apoptosis were reversible, we performed live-cell imaging of a destabilizing domain fusion Vpr, which enabled rapid stabilization and destabilization by Shield1. The effects of Vpr on G2 arrest and subsequent apoptosis were reversible. This study is the first to

  8. Muon g-2 vs LHC in Supersymmetric Models

    CERN Document Server

    Endo, Motoi; Iwamoto, Sho; Yoshinaga, Takahiro

    2013-01-01

    There is more than 3 sigma deviation between the experimental and theoretical results of the muon g-2. This suggests that some of the SUSY particles have a mass of order 100 GeV. We study searches for those particles at the LHC with particular attention to the muon g-2. In particular, the recent results on the searches for the non-colored SUSY particles are investigated in the parameter region where the muon g-2 is explained. The analysis is independent of details of the SUSY models. Future prospects of the collider searches are also discussed.

  9. VLT Observations of the Gas Cloud G2

    Science.gov (United States)

    Gillessen, Stefan

    2014-01-01

    In 2011, we discovered a small, compact gas cloud G2 that is falling on a near-radial orbit toward the massive black hole in the Galactic Center. The orbit is well-constrained and the pericenter passage will occur in early 2014. Our data beautifully show that G2 gets tidally sheared apart due to the massive black hole's force. We expect that in addition to the tidal effects, hydrodynamics will become important when G2 collides with the hot ambient gas around Sgr A*. This might be a unique opportunity in the next years to observe how gas feeds a massive black hole.

  10. Theory of G2 Cloud Multi-Wavelength Emission

    CERN Document Server

    Shcherbakov, Roman V

    2013-01-01

    An object called G2 was recently discovered moving towards the supermassive black hole in the Galactic Center. G2 emits infrared (IR) lines and continuum, which allows constraining its properties. The question is still unresolved whether G2 has a central windy star or it is a coreless cloud. Assuming the object is a cloud originating near the apocenter I perform line/continuum IR diagnostics, revisit estimates of non-thermal emission from pericenter passage, and speculate about future observational prospects. This work is partially reported in arXiv:1309.2282 and partially consists of new ideas discussed at the conference.

  11. Premature aging syndrome.

    Science.gov (United States)

    Coppedè, Fabio

    2012-01-01

    Hutchinson-Gilford progeria syndrome and Werner syndrome are two of the best characterized human progeroid diseases with clinical features mimicking physiological aging at an early age. Both disorders have been the focus of intense research in recent years since they might provide insights into the pathology of normal human aging. The chapter contains a detailed description of the clinical features of both disorders and then it focuses on the genetics, the resulting biochemical alterations at the protein level and the most recent findings and hypotheses concerning the molecular basis of the premature aging phenotypes. A description of available diagnostic and therapeutic approaches is included.

  12. Confinement without a center the exceptional group G(2)

    CERN Document Server

    Holland, K; Pepé, M; Wiese, U J

    2002-01-01

    We discuss theories with the exceptional centerless gauge group G(2), paying attention to confinement and the pattern of chiral symmetry breaking. Exploiting the Higgs mechanism to break the symmetry down to SU(3), we also present how the familiar features of confinement and chiral symmetry breaking of SU(3) gauge theories reemerge. G(2) gauge theories show up as an unusual theoretical framework to study SU(3) gauge theories without the ``luxury'' of a center.

  13. Premature ovarian failure.

    Science.gov (United States)

    Shelling, Andrew N

    2010-11-01

    Premature ovarian failure (POF) is a common cause of infertility in women, and is characterised by amenorrhoea, hypo-oestrogenism and elevated gonadotrophin levels in women under the age of 40. Known causes include iatrogenic agents that cause permanent damage to the ovaries, such as chemotherapy, radiation therapy and surgery, autoimmune conditions, X-chromosome abnormalities and autosomal genetic conditions. However, few genes have been identified that can explain a substantial proportion of cases of POF. Most women with POF are deeply upset by the diagnosis, partly due to the unexpected menopausal symptoms, but also due to infertility. Therefore, early detection would provide better opportunity for early intervention, and furthermore, the identification of specific gene defects will help to direct potential targets for future treatment.

  14. Apnea of prematurity

    Directory of Open Access Journals (Sweden)

    Piermichele Paolillo

    2013-06-01

    Full Text Available Apnea of prematurity (AOP is one of the most frequent pathologies in the Neonatal Intensive Care Unit, with an incidence inversely related to gestational age. Its etiology is often multi factorial and diagnosis of idiopathic forms requires exclusion of other underlying diseases. Despite being a self-limiting condition which regresses with the maturation of the newborn, possible long-term effects of recurring apneas and the degree of desaturation and bradycardia who may lead to abnormal neurological outcome are not yet clarified. Therefore AOP needs careful evaluation of its etiology and adequate therapy that can be both pharmacological and non-pharmacological. Proceedings of the 9th International Workshop on Neonatology · Cagliari (Italy · October 23rd-26th, 2013 · Learned lessons, changing practice and cutting-edge research

  15. Premature ejaculation: A review

    Directory of Open Access Journals (Sweden)

    Sukumar Reddy Gajjala

    2014-01-01

    Full Text Available Premature ejaculation (PE is a common male sexual disorder. It is defined by the Diagnostic and statistical manual of mental disorders as "ejaculation occurring, without control, on or shortly after penetration and before the person wishes it, causing marked distress or interpersonal difficulty. [1] Although the timing of intravaginal ejaculatory latency time (IELT (i.e., time from penetration to ejaculation is not included in this definition, an IELT of <2 min, or ejaculation occurring before penetration, has been considered consistent with PE. [2] Management involves both the patient and his partner. Therapeutic options should suit both partners and be appropriate to their habit in planning and frequency of intercourse. Follow-up at appropriate intervals to judge efficacy, titrate dosage of pharmacological treatments and ascertain side effects is mandatory.

  16. Intrauterine infection and prematurity.

    Science.gov (United States)

    Gonçalves, Luís F; Chaiworapongsa, Tinnakorn; Romero, Roberto

    2002-01-01

    Intrauterine infection is a major cause of premature labor with and without intact membranes. Intrauterine infection is present in approximately 25% of all preterm births and the earlier the gestational age at delivery, the higher the frequency of intra-amniotic infection. Microorganisms may also gain access to the fetus before delivery. A fetal inflammatory response syndrome elicited in response to microbial products is associated with the impending onset of preterm labor and also with multi-systemic organ involvement in the human fetus and a higher rate of perinatal morbidity. The most common microorganisms involved in intrauterine infections are Ureaplasma urealyticum, Fusobacterium species and Mycoplasma hominis. The role of Chlamydia trachomatis and viruses in preterm labor remain to be determined. Use of molecular microbiology techniques to diagnose intrauterine infection may uncover the role of fastidious microorganisms that have not yet been discovered. Antibiotic administration to patients with asymptomatic bacteriuria is associated with a significant reduction in the rate of preterm birth. However, such benefit has not been demonstrated for patients with bacterial vaginosis, or women who carry Streptococcus agalactia, Ureaplasma urealyticum or Trichomonas vaginalis. Antibiotic administration to patients with preterm premature rupture of membranes is associated with prolongation of pregnancy and a reduction in the rate of clinical chorioamnionitis and neonatal sepsis. The benefit has not been demonstrated in patients with preterm labor and intact membranes. Major efforts are required to determine why some women develop an ascending intrauterine infection and others do not and also what interventions may reduce the deleterious effect of systemic fetal inflammation. Copyright 2002 Wiley-Liss, Inc.

  17. Apnea of Prematurity (For Parents)

    Science.gov (United States)

    ... other babies. The apnea of prematurity does not cause brain damage. A healthy baby who is apnea free for a week will probably never have AOP again. Although sudden infant death syndrome (SIDS) does happen more often in premature infants, no relationship between AOP and SIDS has ...

  18. A note on G2 log-aesthetic curves

    Science.gov (United States)

    Wo, Mei Seen; Gobithaasan R., U.; Miura, Kenjiro T.; Abbas, Muhammad

    2015-12-01

    Log-aesthetic curve (LAC) is a curve family composed of transcendental curves that includes logarithmic spiral, clothoid, circle involute and Nielsen's spiral. They have linear logarithmic curvature graphs (LCGs) and are highly aesthetic. In order to implement G2 LAC in industrial design successfully, one needs guidance on the existence and uniqueness whether a LAC segment satisfy given G2 Hermite data. This paper focuses shows the existence and uniqueness of solution for single segment G2 LAC. A LAC equation that incorporates both start and end curvatures, and end tangential angle is first derived. Then, the end points of the LAC segments are calculated using the derived LAC equation, which is also a representation of the solution region of LAC given a set of G2 Hermite data. The derived function is investigated for its existence and uniqueness. It is shown that the solution region is a curve that do not self-intersect anywhere, thus the solution of single segment G2 LAC is always unique.

  19. Infinitesimal moduli of G2 holonomy manifolds with instanton bundles

    CERN Document Server

    de la Ossa, Xenia; Svanes, Eirik Eik

    2016-01-01

    We describe the infinitesimal moduli space of pairs $(Y, V)$ where $Y$ is a manifold with $G_2$ holonomy, and $V$ is a vector bundle on $Y$ with an instanton connection. These structures arise in connection to the moduli space of heterotic string compactifications on compact and non-compact seven dimensional spaces, e.g. domain walls. Employing the canonical $G_2$ cohomology $H^*_{{\\check{\\rm d}}_E}(Y,E)$ developed by Reyes-Carri\\'on and Fern\\'andez and Ugarte, we show that the moduli space decomposes into the sum of the bundle moduli $H^1_{{\\check{\\rm d}}_A}(Y,{\\rm End}(V))$ plus the moduli of the $G_2$ structure preserving the instanton condition. The latter piece is contained in $H^1_{{\\check{\\rm d}}_\

  20. Effective Polyakov Loop Dynamics for Finite Temperature G(2) Gluodynamics

    CERN Document Server

    Wellegehausen, Bjoern H; Wozar, Christian

    2009-01-01

    Based on the strong coupling expansion we obtain effective 3-dimensional models for the Polyakov loop in finite-temperature G_2 gluodynamics. The Svetitsky-Jaffe conjecture relates the resulting continuous spin models with G_2 gluodynamics near phase transition points. In the present work we analyse the effective theory in leading order with the help of a generalised mean field approximation and with detailed Monte-Carlo simulations. In addition we derive a Potts-type discrete spin model by restricting the characters of the Polyakov loops to the three extremal points of the fundamental domain of G_2. Both the continuous and discrete effective models show a rich phase structure with a ferromagnetic, symmetric and several anti-ferromagnetic phases. The phase diagram contains first and second order transition lines and tricritical points. The modified mean field predictions compare very well with the results of our simulations.

  1. Performance analysis for the new G-2 experiment

    CERN Document Server

    Stratakis, D; Johnstone, C; Johnstone, J; Morgan, J P; Syphers, M J; Crmkovic, J D; Morse, W M; Tishchenko, V; Froemming, N S; Korostelev, M

    2016-01-01

    The new g-2 experiment at Fermilab aims to measure the muon anomalous magnetic moment by a fourfold improvement in precision compared to the BNL experiment. Achieving this goal requires the delivery of highly polarized 3.094 GeV/c muons with a narrow +-0.5% {\\Delta}p/p acceptance to the storage ring. In this study, we describe a muon capture and transport scheme that should meet this requirement. First, we present the conceptual design of our proposed scheme wherein we describe its basic features. Then, we detail our numerical model and present a complete end-to-end simulation of all g-2 beamlines.

  2. The new (g-2)mu experiment at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Casey, Brendan C.K.; /Fermilab

    2009-01-01

    We present a proposal to measure the anomalous magnetic moment of the muon to 0.14 ppm precision. This new g-2 experiment will be hosted by Fermilab making use of minor modifications to the existing accelerator complex. The experiment will recycle several components from the previous g-2 experiment E821 hosted at Brookhaven. In particular, the entire storage ring and magnet will be shipped to Fermilab. We cover the motivation for the experiment and review the measurement technique. We then focus on a new in-vacuo straw tracking system planned for the new experiment and its impact on searching for a permanent electric dipole moment of the muon.

  3. NEW RESULTS FROM THE MUON G - 2 EXPERIMENT.

    Energy Technology Data Exchange (ETDEWEB)

    SICHTERMANN,E.P.BENNETT,G.W.BOUSQUET,B.BROWN,H.N.BUNCE,G.CAREY,R.M.ET ALMUON G - 2 COLLABORATION

    2002-09-09

    The Muon g-2 collaboration has measured the anomalous magnetic g value, a = (g-2)/2, of the positive muon with an unprecedented uncertainty of O.7parts per million. The result a{sub {mu}{sup +}}(expt) = 11 659 204(7)(5) x 10{sup -10}, based on data collected in the year 2000 at Brookhaven National Laboratory, is in good agreement with the preceding data on a{sub {mu}{sup +}} and a{sub {mu}{sup -}}. The measurement tests standard model theory, which at the level of the current experimental uncertainty involves quantum electrodynamics, quantum chromodynamics, and electroweak interaction in a significant way.

  4. Muon g-2 Anomaly and Dark Leptonic Gauge Boson

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hye-Sung [W& M

    2014-11-01

    One of the major motivations to search for a dark gauge boson of MeV-GeV scale is the long-standing muon g-2 anomaly. Because of active searches such as fixed target experiments and rare meson decays, the muon g-2 favored parameter region has been rapidly reduced. With the most recent data, it is practically excluded now in the popular dark photon model. We overview the issue and investigate a potentially alternative model based on the gauged lepton number or U(1)_L, which is under different experimental constraints.

  5. Overview of the Fermilab Muon g-2 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kim, SeungCheon [Cornell U., Phys. Dept.

    2015-01-01

    The measurement of the anomalous magnetic moment of muon provides a precision test of the Standard Model. The Brookhaven muon g-2 experiment (E821) measured the muon magnetic moment anomaly with 0.54 ppm precision, a more than 3 deviation from the Standard Model predictions, spurring speculation about the possibility of new physics. The new g-2 experiment at Fermilab (E989) will reduce the combined statistical and systematic error of the BNL experiment by a factor of 4. An overview of the new experiment is described in this article.

  6. A genetic screen identifies BRCA2 and PALB2 as key regulators of G2 checkpoint maintenance

    DEFF Research Database (Denmark)

    Menzel, Tobias; Nähse-Kumpf, Viola; Kousholt, Arne Nedergaard;

    2011-01-01

    To identify key connections between DNA-damage repair and checkpoint pathways, we performed RNA interference screens for regulators of the ionizing radiation-induced G2 checkpoint, and we identified the breast cancer gene BRCA2. The checkpoint was also abrogated following depletion of PALB2......, an interaction partner of BRCA2. BRCA2 and PALB2 depletion led to premature checkpoint abrogation and earlier activation of the AURORA A-PLK1 checkpoint-recovery pathway. These results indicate that the breast cancer tumour suppressors and homologous recombination repair proteins BRCA2 and PALB2 are main...

  7. G2 Autonomous Control for Cryogenic Delivery Systems

    Science.gov (United States)

    Dito, Scott J.

    2014-01-01

    The Independent System Health Management-Autonomous Control (ISHM-AC) application development for cryogenic delivery systems is intended to create an expert system that will require minimal operator involvement and ultimately allow for complete autonomy when fueling a space vehicle in the time prior to launch. The G2-Autonomous Control project is the development of a model, simulation, and ultimately a working application that will control and monitor the cryogenic fluid delivery to a rocket for testing purposes. To develop this application, the project is using the programming language/environment Gensym G2. The environment is an all-inclusive application that allows development, testing, modeling, and finally operation of the unique application through graphical and programmatic methods. We have learned G2 through training classes and subsequent application development, and are now in the process of building the application that will soon be used to test on cryogenic loading equipment here at the Kennedy Space Center Cryogenics Test Laboratory (CTL). The G2 ISHM-AC application will bring with it a safer and more efficient propellant loading system for the future launches at Kennedy Space Center and eventually mobile launches from all over the world.

  8. The Polarized Structure Function $g_{2} A Lattice Study Revisited

    CERN Document Server

    Göckeler, M; Kürzinger, W; Oelrich, H; Rakow, P; Schierholz, G

    1999-01-01

    A recent lattice calculation of the spin-dependent structure function g_2 is revisited. It has been recognized that the twist-three operator, which gives rise to d_2, mixes non-perturbatively with operators of lower dimensions under renormalization. This changes the results substantially.

  9. Fermilab Muon Campus g-2 Cryogenic Distribution Remote Control System

    CERN Document Server

    Pei, L; Klebaner, A; Soyars, W; Bossert, R

    2015-01-01

    The Muon Campus (MC) is able to measure Muon g-2 with high precision and comparing its value to the theoretical prediction. The MC has four 300 KW screw compressors and four liquid helium refrigerators. The centerpiece of the Muon g-2 experiment at Fermilab is a large, 50-foot-diameter superconducting muon storage ring. This one-of-a-kind ring, made of steel, aluminum and superconducting wire, was built for the previous g-2 experiment at Brookhaven. Due to each subsystem has to be far away from each other and be placed in the distant location, therefore, Siemens Process Control System PCS7-400, Automation Direct DL205 & DL05 PLC, Synoptic and Fermilab ACNET HMI are the ideal choices as the MC g-2 cryogenic distribution real-time and on-Line remote control system. This paper presents a method which has been successfully used by many Fermilab distribution cryogenic real-time and On-Line remote control systems.

  10. Bound State Effect on the Electron g-2

    CERN Document Server

    Mishima, Go

    2013-01-01

    We evaluate a non-perturbative QED contribution to the electron g-2 which comes from virtual positronium. We find it to be 9.0*10^{-14}. This value is comparable to the five-loop contribution of usual perturbative calculation, and several times larger than the electroweak correction.

  11. Measuring the performance of G2G services in Iran

    Science.gov (United States)

    Zarei, Behrouz; Safdari, Maryam

    To highlight the growth of e-government and the importance of its services it is essential to evaluate the performance of the service delivery to customers. Research indicates that traditional performance indexes are not suitable for this evaluation; moreover, it is noticeable that the e-government services are intangible and invisible. Among different e-government services, measurement of quality government to government (G2G) services has been less attractive for researchers while crucial for government policy-makers. This calls for a better understanding of the specific needs of users of these services in order to provide appropriate type and level of services that meets those needs. In this paper, the performance of the G2G services is measured in the Iranian context. For this purpose, SERVQUAL, which is a well-known method for assessing service quality, is employed. This study proposes and tests a five-factor of SERVQUAL instrument to explain user satisfaction and gap analysis, between expectations and perceptions of its customers, consisting thirty ministries and main governmental organizations. Based on a Chi-square test, factor analysis, gap analysis and correlations, it is concluded the gap between expectations and perceptions of G2G customers is significant and customer satisfaction of G2G services is at low level.

  12. A 4D gravity theory and G2-holonomy manifolds

    CERN Document Server

    Herfray, Yannick; Scarinci, Carlos; Shtanov, Yuri

    2016-01-01

    Bryant and Salamon gave a construction of metrics of G2 holonomy on the total space of the bundle of anti-self-dual (ASD) 2-forms over a 4-dimensional self-dual Einstein manifold. We generalise it by considering the total space of an SO(3) bundle (with fibers R^3) over a 4-dimensional base, with a connection on this bundle. We make essentially the same ansatz for the calibrating 3-form, but use the curvature 2-forms instead of the ASD ones. We show that the resulting 3-form defines a metric of G2 holonomy if the connection satisfies a certain second-order PDE. This is exactly the same PDE that arises as the field equation of a certain 4-dimensional gravity theory formulated as a diffeomorphism-invariant theory of SO(3) connections. Thus, every solution of this 4-dimensional gravity theory can be lifted to a G2-holonomy metric. Unlike all previously known constructions, the theory that we lift to 7 dimensions is not topological. Thus, our construction should give rise to many new metrics of G2 holonomy. We des...

  13. Oncogenic pathways impinging on the G2-restriction point

    NARCIS (Netherlands)

    Foijer, F; Simonis, M; van Vliet, M; Wessels, L; Kerkhoven, R; Sorger, P K; Te Riele, H

    2008-01-01

    In the absence of mitogenic stimuli, cells normally arrest in G(1/0), because they fail to pass the G1-restriction point. However, abrogation of the G1-restriction point (by loss of the retinoblastoma gene family) reveals a second-restriction point that arrests cells in G2. Serum-starvation-induced

  14. G2Cdb: the Genes to Cognition database

    Science.gov (United States)

    Croning, Mike D. R.; Marshall, Michael C.; McLaren, Peter; Armstrong, J. Douglas; Grant, Seth G. N.

    2009-01-01

    Neuroscience databases linking genes, proteins, (patho)physiology, anatomy and behaviour across species will be valuable in a broad range of studies of the nervous system. G2Cdb is such a neuroscience database aiming to present a global view of the role of synapse proteins in physiology and disease. G2Cdb warehouses sets of genes and proteins experimentally elucidated by proteomic mass spectroscopy of signalling complexes and proteins biochemically isolated from mammalian synapse preparations, giving an experimentally validated definition of the constituents of the mammalian synapse. Using automated text-mining and expert (human) curation we have systematically extracted information from published neurobiological studies in the fields of synaptic signalling electrophysiology and behaviour in knockout and other transgenic mice. We have also surveyed the human genetics literature for associations to disease caused by mutations in synaptic genes. The synapse proteome datasets that G2Cdb provides offer a basis for future work in synapse biology and provide useful information on brain diseases. They have been integrated in a such way that investigators can rapidly query whether a gene or protein is found in brain-signalling complex(es), has a phenotype in rodent models or whether mutations are associated with a human disease. G2Cdb can be freely accessed at http://www.genes2cognition.org. PMID:18984621

  15. Hydrodynamical simulations of a compact source scenario for G2

    CERN Document Server

    Ballone, A; Burkert, A; Gillessen, S; Genzel, R; Fritz, T K; Eisenhauer, F; Pfuhl, O; Ott, T

    2013-01-01

    The origin of the dense gas cloud G2 discovered in the Galactic Center (Gillessen et al. 2012) is still a debated puzzle. G2 might be a diffuse cloud or the result of an outflow from an invisible star embedded in it. We present here detailed simulations of the evolution of winds on G2's orbit. We find that the hydrodynamic interaction with the hot atmosphere present in the Galactic Center and the extreme gravitational field of the supermassive black hole must be taken in account when modeling such a source scenario. We find that the hydrodynamic interaction with the hot atmosphere present in the Galactic Center and the extreme gravitational field of the supermassive black hole must be taken in account when modeling such a source scenario. We also find that in this scenario most of the Br\\gamma\\ luminosity is expected to come from the highly filamentary densest shocked wind material. G2's observational properties can be used to constrain the properties of the outflow and our best model has a mass outflow rate ...

  16. Perfect Crystals of $U_{q}(G_{2}^{(1)})$

    CERN Document Server

    Yamane, S

    1997-01-01

    The notion of perfect crystals was introduced in "Perfect Crystal and Vertex Models", (Internat. J. Modern Phys. A7(1992)449-484) by S-J. Kang et al. In this paper, we give a series of perfect crystals of $U_q(G_2^{(1)})$.

  17. Test results of the g-2 superconducting solenoid magnet system

    NARCIS (Netherlands)

    Bunce, G; Morse, WM; Benante, J; Cullen, MH; Danby, GT; Endo, K; Fedotovich, GV; Geller, J; Green, MA; Grossmann, A; GrossePerdckamp, M; Haeberlen, U; Hseuh, H; Hirabayashi, H; Hughes, VW; Jackson, JW; Jia, LX; Jungmann, K; Krienen, F; Larsen, R; Khazin, B; Kawall, D; Meng, W; Pai, C; Polk, T.; Prigl, R; Putlitz, GZ; Redin, S; Roberts, BL; Ryskulov, N; Semertzidas, Y; Shutt, R; Snydstrup, L; Tallerico, T; vonWalter, P; Woodle, K; Yamamoto, A

    The g-2 experiment dipole consists of a single 48 turn, 15.1 meter diameter outer solenoid and a pair of 24 turn inner solenoids, 13.4 meters in diameter. The inner solenoids are hooked in series and are run at a polarity that is opposite that of the outer solenoid, thus creating a dipole field in

  18. Performance Analysis for the New g-2 Experiment at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Stratakis, Diktys [Fermilab; Convery, Mary [Fermilab; Crmkovic, J. [RIKEN BNL; Froemming, Nathan [CENPA, Seattle; Johnstone, Carol [Fermilab; Johnstone, John [Fermilab; Korostelev, Maxim [Lancaster U.; Morgan, James [Fermilab; Morse, William [RIKEN BNL; Syphers, Michael [Fermilab; Tishchenko, Vladimir [RIKEN BNL

    2016-06-01

    The new g-2 experiment at Fermilab aims to measure the muon anomalous magnetic moment to a precision of ±0.14 ppm - a fourfold improvement over the 0.54 ppm precision obtained in the g-2 BNL E821experiment. Achieving this goal requires the delivery of highly polarized 3.094 GeV/c muons with a narrow ±0.5% Δp/p acceptance to the g-2 storage ring. In this study, we describe a muon capture and transport scheme that should meet this requirement. First, we present the conceptual design of our proposed scheme wherein we describe its basic features. Then, we detail its performance numerically by simulating the pion production in the (g-2) production target, the muon collection by the downstream beamline optics as well as the beam polarization and spin-momentum correlation up to the storage ring. The sensitivity in performance of our proposed channel against key parameters such as magnet apertures and magnet positioning errors is analyzed

  19. Fermilab Muon Campus g-2 Cryogenic Distribution Remote Control System

    Energy Technology Data Exchange (ETDEWEB)

    Pei, L.; Theilacker, J.; Klebaner, A.; Soyars, W.; Bossert, R.

    2015-11-05

    The Muon Campus (MC) is able to measure Muon g-2 with high precision and comparing its value to the theoretical prediction. The MC has four 300 KW screw compressors and four liquid helium refrigerators. The centerpiece of the Muon g-2 experiment at Fermilab is a large, 50-foot-diameter superconducting muon storage ring. This one-of-a-kind ring, made of steel, aluminum and superconducting wire, was built for the previous g-2 experiment at Brookhaven. Due to each subsystem has to be far away from each other and be placed in the distant location, therefore, Siemens Process Control System PCS7-400, Automation Direct DL205 & DL05 PLC, Synoptic and Fermilab ACNET HMI are the ideal choices as the MC g-2 cryogenic distribution real-time and on-Line remote control system. This paper presents a method which has been successfully used by many Fermilab distribution cryogenic real-time and On-Line remote control systems.

  20. Prenatal Stress, Prematurity, and Asthma.

    Science.gov (United States)

    Medsker, Brock; Forno, Erick; Simhan, Hyagriv; Celedón, Juan C

    2015-12-01

    Asthma is the most common chronic disease of childhood, affecting millions of children in the United States and worldwide. Prematurity is a risk factor for asthma, and certain ethnic or racial minorities such as Puerto Ricans and non-Hispanic blacks are disproportionately affected by both prematurity and asthma. In this review, we examine current evidence to support maternal psychosocial stress as a putative link between prematurity and asthma, while also focusing on disruption of the hypothalamic-pituitary-adrenal (HPA) axis and immune responses as potential underlying mechanisms for stress-induced "premature asthma." Prenatal stress may cause not only abnormalities in the HPA axis but also epigenetic changes in the fetal glucocorticoid receptor gene (NR3C1), leading to impaired glucocorticoid metabolism. Moreover, maternal stress can alter fetal cytokine balance, favoring TH2 (allergic) immune responses characteristic of atopic asthma: interleukin 6 (IL-6), which has been associated with premature labor, can promote TH2 responses by stimulating production of IL-4 and IL-13. Given a link among stress, prematurity, and asthma, future research should include birth cohorts aimed at confirming and better characterizing "premature asthma." If confirmed, clinical trials of prenatal maternal stress reduction would be warranted to reduce the burden of these common comorbidities. While awaiting the results of such studies, sound policies to prevent domestic and community violence (eg, from firearms) are justified, not only by public safety but also by growing evidence of detrimental effects of violence-induced stress on psychiatric and somatic health.

  1. Condensation in insulated homes

    Energy Technology Data Exchange (ETDEWEB)

    Wiley, R A

    1978-05-28

    A research proposal on condensation in insulated homes is presented. Information is provided on: justification for condensation control; previous work and present outlook (good vapor barrier, condensation and retrofit insulation, vapor barrier decreases condensation, brick-veneer walls, condensation in stress-skin panels, air-conditioned buildings, retrofitting for conservation, study on mobile homes, high indoor relative humidity, report on various homes); and procedure (after funding has been secured). Measures are briefly described on opening walls, testing measures, and retrofitting procedures. An extensive bibliography and additional informative citations are included. (MCW)

  2. FEI Titan G2 60-300 HOLO

    Directory of Open Access Journals (Sweden)

    Chris Boothroyd

    2016-02-01

    Full Text Available The FEI Titan G2 60-300 HOLO is a unique fourth generation transmission electron microscope, which has been specifically designed for the investigation of electromagnetic fields of materials using off-axis electron holography. It has a Lorentz lens to allow magnetic field free imaging plus two electron biprisms, which in combination enable more uniform holographic fringes to be used. The instrument also has an ultra-wide objective lens pole piece gap which is ideal for in situ experiments. For these purposes, the FEI Titan G2 60-300 HOLO is equipped with a Schottky type high-brightness electron gun (FEI X-FEG, an image Cs corrector (CEOS, a post-column energy filter system (Gatan Tridiem 865 ER as well as a 4 megapixel CCD system (Gatan UltraScan 1000 XP. Typical examples of use and technical specifications for the instrument are given below.

  3. A supermembrane with central charges on a G2 manifold

    Energy Technology Data Exchange (ETDEWEB)

    Belhaj, A; Segui, A [Departamento de Fisica Teorica, Universidad de Zaragoza, 12, Pedro Cerbuna, 50009 Zaragoza (Spain); Moral, M P Garcia del [Dipartimento di Fisica Teorica, Universita di Torino and INFN-Sezione di Torino, Via P Giuria 1, I-10125 Torino (Italy); Restuccia, A [Max-Planck-Institut fuer Gravitationphysik, Albert-Einstein-Institut, Muelenberg 1, D-14476 Potsdam (Germany); Veiro, J P [Departamento de Matematicas Puras y Aplicadas, Universidad Simon BolIvar, Apartado 89000, Caracas 1080-A (Venezuela, Bolivarian Republic of)], E-mail: belhaj@unizar.es, E-mail: garcia@to.infn.it, E-mail: restucci@aei.mpg.de, E-mail: arestu@usb.ve, E-mail: segui@unizar.es, E-mail: pierre@ma.usb.ve

    2009-08-14

    We construct an 11D supermembrane with topological central charges induced through an irreducible winding on a G2 manifold realized from the T{sup 7}/Z{sup 3}{sub 2} orbifold construction. The Hamiltonian H of the theory on a T{sup 7} target has a discrete spectrum. Within the discrete symmetries of H associated with large diffeomorphisms, the Z{sub 2} x Z{sub 2} x Z{sub 2} group of automorphisms of the quaternionic subspaces preserving the octonionic structure is relevant. By performing the corresponding identification on the target space, the supermembrane may be formulated on a G2 manifold, preserving the discreteness of its supersymmetric spectrum. The corresponding 4D low energy effective field theory has N = 1 supersymmetry.

  4. Massive vectors and loop observables: the $g-2$ case

    CERN Document Server

    Biggio, Carla; Di Luzio, Luca; Ridolfi, Giovanni

    2016-01-01

    We discuss the use of massive vectors for the interpretation of some recent experimental anomalies. In order for loop observables, such as for example the muon $g-2$, to be finite (and hence to be predictable in terms of a renormalizable Lagrangian) the massive vector must be embedded into a spontaneously broken extended gauge symmetry. The latter, however, typically imposes strong constraints on the mass of the new vector boson and for the muon $g-2$ it basically rules out, barring the case of abelian gauge extensions, the explanation of the discrepancy in terms of a single vector extension of the standard model. We finally comment on the use of massive vectors for $B$-meson decay and di-photon anomalies.

  5. REPRESENTATIONS OF AFFINE HECKE ALGEBRAS OF TYPE G2

    Institute of Scientific and Technical Information of China (English)

    Xi Nanhua

    2009-01-01

    Let k be a field and q a nonzero element in k such that the square roots of q are in k.We use Hq to denote an affine Hecke algebra over k of type G2 with parameter q.The purpose of this paper is to study representations of Hq by using based rings of two-sided cells of an affine Weyl group W of type G2.We shall give the classification of irreducible representations of Hq.We also remark that a calculation in [11] actually shows that Theorem 2 in [1] needs a modification, a fact is known to Grojnowski and Tanisaki long time ago.In this paper we also show an interesting relation between Hq and an Hecke algebra corresponding to a certain Coxeter group.Apparently the idea in this paper works for all affine Weyl groups, but that is the theme of another paper.

  6. Premature ovarian failure

    Directory of Open Access Journals (Sweden)

    Vujović Svetlana

    2012-01-01

    Full Text Available Premature ovarian failure (POF is the occurrence of hypergonadotropic hypoestrogenic amenorrhea in women under the age of forty years. It is idiopathic in 74-90% patients. Known cases can be divided into primary and secondary POF. In primary POF genetic aberrations can involve the X chromosome (monosomy, trisomy, translocations, deletions or autosomes. Genetic mechanisms include reduced gene dosage and non-specific chromosome effects impairing meiosis, decreasing the pool of primordial follicles and increasing atresia due to apoptosis or failure of follicle maturation. Autoimmune ovarian damage is caused by alteration of T-cell subsets and T-cell mediated injury, increase of autoantibody producing B-cells, a low number of effector/cytotoxic lymphocyte, which decreases the number and activity of natural killer cells. Bilateral oophorectomy, chemotherapy, radiotherapy and infections cause the secondary POF. Symptoms of POF include irritability, nervousness, loss of libido, depression, lack of concentration, hot flushes, weight gaining, dry skin, vaginal dryness, frequent infections etc. The diagnosis is confirmed by the level of FSH of over 40 IU/L and estradiol below 50 pmol/L in women aged below 40 years. Biochemical and other hormonal analysis (free thyroxin, TSH, prolactin, testosterone, karyotype (<30 years of age, ultrasound of the breasts and pelvis are advisable. Optimal therapy is combined estrogen progestagen therapy given in a sequential rhythm, after excluding absolute contraindications. Testosterone can be added to adnexectomized women and those with a low libido. Sequential estrogen progestagen replacement therapy is the first line therapy for ovulation induction in those looking for pregnancy and after that oocyte donation will be advised. Appropriate estro-progestagen therapy improves the quality of life and prevents complications such as cardiovascular diseases, osteoporosis, stroke etc.

  7. Experimental Results and Theoretical Developments of Muon g-2

    CERN Document Server

    Deng, H; Bennett, G W; Bousquet, B; Brown, H N; Bunce, G; Carey, R M; Cushman, P; Danby, G T; Debevec, P T; Deile, M; Dhawan, S K; Druzhinin, V P; Duong, L; Farley, F J M; Fedotovich, G V; Gray, F E; Grigoriev, D; Grosse-Perdekamp, M; Grossmann, A; Hare, M; Hertzog, D W; Huang, X; Hughes, V W; Iwasaki, M; Jungmann, Klaus; Kawall, D; Khazin, B I; Krienen, F; Kronkvist, I J; Lam, A; Larsen, R; Lee, Y Y; Logashenko, I; McNabb, R; Meng, W; Miller, J P; Morse, W M; Nikas, D; Onderwater, Gerco; Orlov, Y; Ozben; Paley, J M; Peng, Q; Polly, C C; Pretz, J; Prigl, R; zu Putlitz, Gisbert; Qian, T; Redin, S I; Rind, O; Roberts, B L; Ryskulov, N M; Semertzidis, Y K; Shagin, P; Shatunov, Yu M; Sichtermann, E P; Solodov, E; Sossong, M; Sulak, L R; Trofimov, A; Von Walter, P; Yamamoto, A

    2004-01-01

    The anomalous magnetic moments of both positive and negative muons are measured to the precision of 0.7 parts per million. Two values are in good agreement. The standard model calculations of muon g-2 are under further studies, especially the descrepancies between $e^+e^-$ and $\\tau$ data. The differences between experimental result and the standard model calculations are $2.4\\sigma$ for $e^+e^-$ data and $0.9\\sigma$ for $\\tau$ data.

  8. Supergravity corrections to $(g-2)_l$ in differential renormalization

    CERN Document Server

    del Águila, F; Muñoz-Tàpia, R; Pérez-Victoria, M

    1997-01-01

    The method of differential renormalization is extended to the calculati= on of the one-loop graviton and gravitino corrections to $(g-2)_l$ in unbroken supergravity. Rewriting the singular contributions of all the diagrams in= terms of only one singular function, U(1) gauge invariance and supersymmetry ar= e preserved. We compare this calculation with previous ones which made use = of momentum space regularization (renormalization) methods.

  9. Interrelationship among g-2, EDMs and cLFV

    Science.gov (United States)

    Paradisi, Paride

    2014-03-01

    We summarize the status of charged lepton flavor violation (cLFV) in models beyond the SM. We stress that the current experimental bounds on cLFV processes are already constraining new physics (NP) scenarios more than the direct bounds from the LHC. On the other hand, the interrelationship among leptonic g-2, EDMs and cLFV will turn out to be of outmost importance to disentangle among different NP scenarios.

  10. Conjectures on counting associative 3-folds in $G_2$-manifolds

    CERN Document Server

    Joyce, Dominic

    2016-01-01

    There is a strong analogy between compact, torsion-free $G_2$-manifolds $(X,\\varphi,*\\varphi)$ and Calabi-Yau 3-folds $(Y,J,g,\\omega)$. We can also generalize $(X,\\varphi,*\\varphi)$ to 'tamed almost $G_2$-manifolds' $(X,\\varphi,\\psi)$, where we compare $\\varphi$ with $\\omega$ and $\\psi$ with $J$. Associative 3-folds in $X$, a special kind of minimal submanifold, are analogous to $J$-holomorphic curves in $Y$. Several areas of Symplectic Geometry -- Gromov-Witten theory, Quantum Cohomology, Lagrangian Floer cohomology, Fukaya categories -- are built using 'counts' of moduli spaces of $J$-holomorphic curves in $Y$, but give an answer depending only on the symplectic manifold $(Y,\\omega)$, not on the (almost) complex structure $J$. We investigate whether it may be possible to define interesting invariants of tamed almost $G_2$-manifolds $(X,\\varphi,\\psi)$ by 'counting' compact associative 3-folds $N\\subset X$, such that the invariants depend only on $\\varphi$, and are independent of the 4-form $\\psi$ used to def...

  11. Muon g - 2 in MSSM gauge mediation revisited

    Science.gov (United States)

    Yanagida, Tsutomu T.; Yokozaki, Norimi

    2017-09-01

    The Higgs boson of 125 GeV requires large stop masses, leading to the large μ-parameter in most cases of gauge mediation. On the other hand, the explanation for the muon g - 2 anomaly needs small slepton and neutralino/chargino masses. Such disparity in masses may be obtained from a mass splitting of colored and non-colored messenger fields. However, even if the required small slepton and neutralino/chargino masses are realized, all parameter regions consistent with the muon g - 2 are excluded by the recent updated ATLAS result on the wino search in the case that the messenger fields are in 5 + 5 bar representations of SU (5). It is also revealed that the messenger fields in 10 + 10 ‾ or 24 representation can not explain the muon g - 2 anomaly. We show, giving a simple example model, that the above confliction is solved if there is an additional contribution to the Higgs soft mass which makes the μ-parameter small. We also show that the required Higgs B-term for the electroweak symmetry breaking is consistently generated by radiative corrections from gaugino loops.

  12. Eurycomanone induce apoptosis in HepG2 cells via up-regulation of p53

    Directory of Open Access Journals (Sweden)

    Zakaria Yusmazura

    2009-06-01

    Full Text Available Abstract Background Eurycomanone is a cytotoxic compound found in Eurycoma longifolia Jack. Previous studies had noted the cytotoxic effect against various cancer cell lines. The aim of this study is to investigate the cytotoxicity against human hepato carcinoma cell in vitro and the mode of action. The cytotoxicity of eurycomanone was evaluated using MTT assay and the mode of cell death was detected by Hoechst 33258 nuclear staining and flow cytometry with Annexin-V/propidium iodide double staining. The protein expression Bax, Bcl-2, p53 and cytochrome C were studied by flow cytometry using a spesific antibody conjugated fluorescent dye to confirm the up-regulation of p53 and Bax in cancer cells. Results The findings suggested that eurycomanone was cytotoxic on cancerous liver cell, HepG2 and less toxic on normal cells Chang's liver and WLR-68. Furthermore, various methods proved that apoptosis was the mode of death in eurycomanone-treated HepG2 cells. The characteristics of apoptosis including chromatin condensation, DNA fragmentation and apoptotic bodies were found following eurycomanone treatment. This study also found that apoptotic process triggered by eurycomanone involved the up-regulation of p53 tumor suppressor protein. The up-regulation of p53 was followed by the increasing of pro-apoptotic Bax and decreasing of anti-apoptotic Bcl-2. The increased of cytochrome C levels in cytosol also results in induction of apoptosis. Conclusion The data suggest that eurycomanone was cytotoxic on HepG2 cells by inducing apoptosis through the up-regulation of p53 and Bax, and down-regulation of Bcl-2.

  13. Preterm labor and premature birth: Are you at risk?

    Science.gov (United States)

    ... labor and premature birth: Are you at risk? Preterm labor and premature birth: Are you at risk? ... for preterm labor and premature birth. What are preterm labor and premature birth? Preterm and premature mean ...

  14. Infinitesimal moduli of G2 holonomy manifolds with instanton bundles

    Science.gov (United States)

    de la Ossa, Xenia; Larfors, Magdalena; Svanes, Eirik E.

    2016-11-01

    We describe the infinitesimal moduli space of pairs ( Y, V) where Y is a manifold with G 2 holonomy, and V is a vector bundle on Y with an instanton connection. These structures arise in connection to the moduli space of heterotic string compactifications on compact and non-compact seven dimensional spaces, e.g. domain walls. Employing the canonical G 2 cohomology developed by Reyes-Carrión and Fernández and Ugarte, we show that the moduli space decomposes into the sum of the bundle moduli {H}_{{overset{ěe }{d}}_A}^1(Y,End(V)) plus the moduli of the G 2 structure preserving the instanton condition. The latter piece is contained in {H}_{overset{ěe }{d}θ}^1(Y,TY) , and is given by the kernel of a map overset{ěe }{F} which generalises the concept of the Atiyah map for holomorphic bundles on complex manifolds to the case at hand. In fact, the map overset{ěe }{F} is given in terms of the curvature of the bundle and maps {H}_{overset{ěe }{d}θ}^1(Y,TY) into {H}_{{overset{ěe }{d}}_A}^2(Y,End(V)) , and moreover can be used to define a cohomology on an extension bundle of TY by End( V). We comment further on the resemblance with the holomorphic Atiyah algebroid and connect the story to physics, in particular to heterotic compactifications on ( Y, V) when α' = 0.

  15. Revised value of the eighth-order electron g-2

    CERN Document Server

    Aoyama, T; Kinoshita, T; Nio, M

    2007-01-01

    The contribution to the eighth-order anomalous magnetic moment (g-2) of the electron from a set of diagrams without closed lepton loops is recalculated using a new FORTRAN code generated by an automatic code generator. Comparing the contributions of individual diagrams of old and new calculations, we found an inconsistency in the old treatment of infrared subtraction terms in two diagrams. Correcting this error leads to the revised value -1.9144 (35) (alpha/pi)^4 for the eighth-order term. This theoretical change induces the shift of the inverse of the fine structure constant by -6.41180(73)x10^{-7}.

  16. Status of the BNL Muon g-2 Experiment

    CERN Document Server

    Prigl, R; Bunce, G M; Carey, R M; Cushman, P B; Danby, G T; Debevec, P T; Deng, H; Deninger, W J; Dhawan, S K; Druzhinin, V P; Duong, L; Earle, W; Efstathiadis, E F; Farley, Francis J M; Fedotovich, G V; Giron, S; Gray, F; Grosse-Perdekamp, M; Grossmann, A; Haeberlen, U; Hare, M; Hazen, E S; Hertzog, D W; Hughes, V W; Iwasaki, M; Jungmann, Klaus; Kawall, D; Kawamura, M; Khazin, B I; Kindem, J; Krienen, F; Kronkvist, I J; Larsen, R; Lee, Y Y; Liu, W; Logashenko, I B; McNabb, R; Meng, W; Mi, J L; Miller, J P; Morse, W M; Neumayer, P; Nikas, D; Onderwater, Gerco; Orlov, Yu F; Ozben, C; Paley, J M; Pai, C; Polly, C; Pretz, J; zu Putlitz, Gisbert; Redin, S I; Rind, O; Roberts, B L; Ryskulov, N M; Sedykh, S N; Semertzidis, Y K; Shatunov, Yu M; Sichtermann, E P; Solodov, E P; Sossong, M; Steinmetz, A; Sulak, Lawrence R; Tanaka, M; Timmermans, C; Trofimov, A V; Urner, D; Warburton, D; Winn, D; Yamamoto, A; Zimmerman, D

    2000-01-01

    The muon g-2 experiment at Brookhaven has been taking data since 1997. Analyses of the data taken in 1997 and 1998, which include about 2% of the data taken so far, have improved the experimental accuracy in the muon anomalous magnetic moment to a(mu,expt) = 1 165 921(5) x 10**(-9) (4 ppm). The value agrees with standard theory. Analysis of the 1999 data, about 25% of the existing data set, is nearing completion and analysis of the 2000 data has started. The experiment is preparing for another major data taking run, this time storing negative instead of positive muon beams.

  17. Discrete Fourier Analysis and Chebyshev Polynomials with G2 Group

    Directory of Open Access Journals (Sweden)

    Huiyuan Li

    2012-10-01

    Full Text Available The discrete Fourier analysis on the 30°-60°-90° triangle is deduced from the corresponding results on the regular hexagon by considering functions invariant under the group G2, which leads to the definition of four families generalized Chebyshev polynomials. The study of these polynomials leads to a Sturm-Liouville eigenvalue problem that contains two parameters, whose solutions are analogues of the Jacobi polynomials. Under a concept of m-degree and by introducing a new ordering among monomials, these polynomials are shown to share properties of the ordinary orthogonal polynomials. In particular, their common zeros generate cubature rules of Gauss type.

  18. General Metrics of G_2 Holonomy and Contraction Limits

    CERN Document Server

    Chong, Z W; Gibbons, G W; Lü, H; Pope, C N; Wagner, P

    2002-01-01

    We obtain first-order equations for G_2 holonomy of a wide class of metrics with S^3\\times S^3 principal orbits and SU(2)\\times SU(2) isometry, using a method recently introduced by Hitchin. The new construction extends previous results, and encompasses all previously-obtained first-order systems for such metrics. We also study various group contractions of the principal orbits, focusing on cases where one of the S^3 factors is subjected to an Abelian, Heisenberg or Euclidean-group contraction. In the Abelian contraction, we recover some recently-constructed G_2 metrics with S^3\\times T^3 principal orbits. We obtain explicit solutions of these contracted equations in cases where there is an additional U(1) isometry. We also demonstrate that the only solutions of the full system with S^3\\times T^3 principal orbits that are complete and non-singular are either flat R^4 times T^3, or else the direct product of Eguchi-Hanson and T^3, which is asymptotic to R^4/Z_2\\times T^3. These examples are in accord with a ge...

  19. Split Sfermion Families, Yukawa Unification and Muon g-2

    CERN Document Server

    Ajaib, M Adeel; Shafi, Qaisar; Un, Cem Salih

    2014-01-01

    We consider two distinct classes of Yukawa unified supersymmetric SO(10) models with non-universal and universal soft supersymmetry breaking (SSB) gaugino masses at M_{\\rm GUT}. In both cases, we assume that the third family SSB sfermion masses at M_{\\rm GUT} are different from the corresponding sfermion masses of the first two families (which are equal). For the SO(10) model with essentially arbitrary (non-universal) gaugino masses at M_{\\rm GUT}, it is shown that t-b-\\tau Yukawa coupling unification is compatible, among other things, with the 125 GeV Higgs boson mass, the WMAP relic dark matter density, and with the resolution of the apparent muon g-2 anomaly. The colored sparticles in this case all turn out to be quite heavy, of order 5 TeV or more, but the sleptons (smuon and stau) can be very light, of order 200 GeV or so. For the SO(10) model with universal gaugino masses and NUHM2 boundary conditions, the muon g-2 anomaly cannot be resolved. However, the gluino in this class of models is not too heavy,...

  20. Inferring Toxicological Responses of HepG2 Cells from ...

    Science.gov (United States)

    Understanding the dynamic perturbation of cell states by chemicals can aid in for predicting their adverse effects. High-content imaging (HCI) was used to measure the state of HepG2 cells over three time points (1, 24, and 72 h) in response to 976 ToxCast chemicals for 10 different concentrations (0.39-200µM). Cell state was characterized by p53 activation (p53), c-Jun activation (SK), phospho-Histone H2A.x (OS), phospho-Histone H3 (MA), alpha tubulin (Mt), mitochondrial membrane potential (MMP), mitochondrial mass (MM), cell cycle arrest (CCA), nuclear size (NS) and cell number (CN). Dynamic cell state perturbations due to each chemical concentration were utilized to infer coarse-grained dependencies between cellular functions as Boolean networks (BNs). BNs were inferred from data in two steps. First, the data for each state variable were discretized into changed/active (> 1 standard deviation), and unchanged/inactive values. Second, the discretized data were used to learn Boolean relationships between variables. In our case, a BN is a wiring diagram between nodes that represent 10 previously described observable phenotypes. Functional relationships between nodes were represented as Boolean functions. We found that inferred BN show that HepG2 cell response is chemical and concentration specific. We observed presence of both point and cycle BN attractors. In addition, there are instances where Boolean functions were not found. We believe that this may be either

  1. Condensation Energy of a Spacetime Condensate

    CERN Document Server

    de Matos, Clovis Jacinto

    2010-01-01

    Starting from an analogy between the Planck-Einstein scale and the dual length scales in Ginzburg-Landau theory of superconductivity, and assuming that space-time is a condensate of neutral fermionic particles with Planck mass, we derive the baryonic mass of the universe. In that theoretical framework baryonic matter appears to be associated with the condensation energy gained by spacetime in the transition from its normal (symetric) to its (less symetric) superconducting-like phase. It is shown however that the critical transition temperature cannot be the Planck temperature. Thus leaving open the enigma of the microscopic description of spacetime at quantum level.

  2. An anilinoquinazoline derivative inhibits tumor growth through interaction with hCAP-G2, a subunit of condensin II.

    Directory of Open Access Journals (Sweden)

    Hirokazu Shiheido

    Full Text Available We screened 46 novel anilinoquinazoline derivatives for activity to inhibit proliferation of a panel of human cancer cell lines. Among them, Q15 showed potent in vitro growth-inhibitory activity towards cancer cell lines derived from colorectal cancer, lung cancer and multiple myeloma. It also showed antitumor activity towards multiple myeloma KMS34 tumor xenografts in lcr/scid mice in vivo. Unlike the known anilinoquinazoline derivative gefitinib, Q15 did not inhibit cytokine-mediated intracellular tyrosine phosphorylation. Using our mRNA display technology, we identified hCAP-G2, a subunit of condensin II complex, which is regarded as a key player in mitotic chromosome condensation, as a Q15 binding partner. Immunofluorescence study indicated that Q15 compromises normal segregation of chromosomes, and therefore might induce apoptosis. Thus, our results indicate that hCAP-G2 is a novel therapeutic target for development of drugs active against currently intractable neoplasms.

  3. The TSO Logic and G2 Software Product

    Science.gov (United States)

    Davis, Derrick D.

    2014-01-01

    This internship assignment for spring 2014 was at John F. Kennedy Space Center (KSC), in NASAs Engineering and Technology (NE) group in support of the Control and Data Systems Division (NE-C) within the Systems Hardware Engineering Branch. (NEC-4) The primary focus was in system integration and benchmarking utilizing two separate computer software products. The first half of this 2014 internship is spent in assisting NE-C4s Electronics and Embedded Systems Engineer, Kelvin Ruiz and fellow intern Scott Ditto with the evaluation of a newly piece of software, called G2. Its developed by the Gensym Corporation and introduced to the group as a tool used in monitoring launch environments. All fellow interns and employees of the G2 group have been working together in order to better understand the significance of the G2 application and how KSC can benefit from its capabilities. The second stage of this Spring project is to assist with an ongoing integration of a benchmarking tool, developed by a group of engineers from a Canadian based organization known as TSO Logic. Guided by NE-C4s Computer Engineer, Allen Villorin, NASA 2014 interns put forth great effort in helping to integrate TSOs software into the Spaceport Processing Systems Development Laboratory (SPSDL) for further testing and evaluating. The TSO Logic group claims that their software is designed for, monitoring and reducing energy consumption at in-house server farms and large data centers, allows data centers to control the power state of servers, without impacting availability or performance and without changes to infrastructure and the focus of the assignment is to test this theory. TSOs Aaron Rallo Founder and CEO, and Chris Tivel CTO, both came to KSC to assist with the installation of their software in the SPSDL laboratory. TSOs software is installed onto 24 individual workstations running three different operating systems. The workstations were divided into three groups of 8 with each group having its

  4. Systematic text condensation

    DEFF Research Database (Denmark)

    Malterud, Kirsti

    2012-01-01

    To present background, principles, and procedures for a strategy for qualitative analysis called systematic text condensation and discuss this approach compared with related strategies.......To present background, principles, and procedures for a strategy for qualitative analysis called systematic text condensation and discuss this approach compared with related strategies....

  5. Measure Guideline: Evaporative Condensers

    Energy Technology Data Exchange (ETDEWEB)

    German, A [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States); Dakin, B. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States); Hoeschele, M. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States)

    2012-03-01

    This measure guideline on evaporative condensers provides information on properly designing, installing, and maintaining evaporative condenser systems as well as understanding the benefits, costs, and tradeoffs. This is a prescriptive approach that outlines selection criteria, design and installation procedures, and operation and maintenance best practices.

  6. Status of the g-2 experiment at BNL

    CERN Document Server

    Grosse-Perdekamp, M; Brown, D H; Carey, R M; Earle, W; Efstathiadis, E F; Hare, M; Hazen, E S; Hughes, B J; Krienen, F; Logashenko, I B; Miller, J P; Monich, V A; Ouyang, J; Rind, O; Roberts, B L; Sulak, Lawrence R; Trofimov, A V; Varner, G S; Worstell, W A; Benante, J; Brown, H N; Bunce, G M; Cullen, J; Danby, G T; Geller, J; Hseuh, H C; Jackson, J W; Jia, L; Kochis, S; Larsen, R; Lee, Y Y; Mapes, M; Meng, W; Morse, W M; Pai, C; Pearson, C; Polk, I; Prigl, R; Rankowitz, S; Sandberg, J; Semertzidis, Y K; Shutt, R P; Snydstrup, L; Soukas, A; Stillman, A; Tanaka, T; Tallerico, T; Toldo, F; Von Lintig, R D; Warburton, D; Woodle, K; Chertovskikh, A; Druzhinin, V P; Fedotovich, G V; Grigoriev, D N; Golubev, V B; Khazin, B I; Maskimov, A; Merzliakov, Yu; Ryskulov, N M; Serednyakov, S I; Shatunov, Yu M; Solodov, E P; Orlov, Yu F; Winn, D; Gerhäuser, J; Grossmann, A; Jungmann, Klaus; Von Walter, P; zu Putlitz, Gisbert; Bunker, B D; Debevec, P T; Deninger, W J; Hertzog, D W; Jones, T; Poly, C; Sedykh, S N; Urner, D; Haeberlen, U; Endo, KI; Hirabayashi, H; Kurokawa, S; Yamamoto, A; Green, M A; Cushman, P B; Duong, L; Giron, S; Kindem, J; McNabb, R; Miller, D; Timmermans, C; Zimmerman, D; Mizumachi, Y; Iwasaki, M; Ahn, H E; Deng, H; Dhawan, S K; Disco, A; Farley, Francis J M; Fei, X; Hughes, V W; Kawall, D; Pretz, J; Redin, S I

    1999-01-01

    The muon g-2 experiment at Brookhaven has successfully completed two exploratory runs using pion injection and direct muon injection for checkout and initial data taking. The main components of the experiment, which include the pion beam line, the superconducting storage ring and inflector magnets, the muon kicker and the lead scintillating fiber calorimeters have been satisfactorily commissioned. First results on the anomalous magnetic moment of the positive muon from pion injection are in good agreement with previous experimental results for a/sub mu +/ and a/sub mu -/ from CERN and of comparable accuracy (13 ppm). Analysis of the 1998 muon injection run is in progress and expected to improve the precision to about 4 ppm. A first production run is scheduled for January 1999 with the goal of reaching the 1 ppm error level. (16 refs).

  7. Your Premature Baby: Low Birthweight

    Science.gov (United States)

    ... many low-birthweight babies are born prematurely, many risk factors for having a low-birthweight baby are the same for preterm labor and ... risk for having a low-birthweight baby. Medical risk factors for having a low-birthweight baby Preterm labor . This is labor that starts ...

  8. Music Therapy with Premature Infants

    Science.gov (United States)

    Standley, Jayne

    2003-01-01

    Over 20 years of research and clinical practice in music therapy with premature infants has been compiled into this text designed for Board Certified Music Therapists specializing in Neonatal Intensive Care clinical services, for NICU medical staff incorporating research-based music therapy into developmental care plans, and for parents of…

  9. Music Therapy with Premature Infants

    Science.gov (United States)

    Standley, Jayne

    2003-01-01

    Over 20 years of research and clinical practice in music therapy with premature infants has been compiled into this text designed for Board Certified Music Therapists specializing in Neonatal Intensive Care clinical services, for NICU medical staff incorporating research-based music therapy into developmental care plans, and for parents of…

  10. Sedimentary condensation and authigenesis

    Science.gov (United States)

    Föllmi, Karl

    2016-04-01

    Most marine authigenic minerals form in sediments, which are subjected to condensation. Condensation processes lead to the formation of well individualized, extremely thin ( 100ky), and which experienced authigenesis and the precipitation of glaucony, verdine, phosphate, iron and manganese oxyhydroxides, iron sulfide, carbonate and/or silica. They usually show complex internal stratigraphies, which result from an interplay of sediment accumulation, halts in sedimentation, sediment winnowing, erosion, reworking and bypass. They may include amalgamated faunas of different origin and age. Hardgrounds may be part of condensed beds and may embody strongly condensed beds by themselves. Sedimentary condensation is the result of a hydrodynamically active depositional regime, in which sediment accumulation, winnowing, erosion, reworking and bypass are processes, which alternate as a function of changes in the location and intensity of currents, and/or as the result of episodic high-energy events engendered by storms and gravity flow. Sedimentary condensation has been and still is a widespread phenomenon in past and present-day oceans. The present-day distribution of glaucony and verdine-rich sediments on shelves and upper slopes, phosphate-rich sediments and phosphorite on outer shelves and upper slopes, ferromanganese crusts on slopes, seamounts and submarine plateaus, and ferromanganese nodules on abyssal seafloors is a good indication of the importance of condensation processes today. In the past, we may add the occurrence of oolitic ironstone, carbonate hardgrounds, and eventually also silica layers in banded iron formations as indicators of the importance of condensation processes. Besides their economic value, condensed sediments are useful both as a carrier of geochemical proxies of paleoceanographic and paleoenvironmental change, as well as the product of episodes of paleoceanographic and paleoenvironmental change themselves.

  11. MODERN PRODUCTS FOR FEEDING PREMATURE BABIES

    National Research Council Canada - National Science Library

    A. V. Surzhik

    2012-01-01

    .... Adequate feeding is one of the fundamental factors of premature babies nursing. To ensure a premature baby with all necessary components for power saving in breast milk intake, breast milk fortifiers...

  12. Physics of condensed matter

    CERN Document Server

    Misra, Prasanta K

    2012-01-01

    Physics of Condensed Matter is designed for a two-semester graduate course on condensed matter physics for students in physics and materials science. While the book offers fundamental ideas and topic areas of condensed matter physics, it also includes many recent topics of interest on which graduate students may choose to do further research. The text can also be used as a one-semester course for advanced undergraduate majors in physics, materials science, solid state chemistry, and electrical engineering, because it offers a breadth of topics applicable to these majors. The book be

  13. Enhanced G2 chromatid radiosensitivity in dyskeratosis congenita fibroblasts

    Energy Technology Data Exchange (ETDEWEB)

    DeBauche, D.M.; Pai, G.S.; Stanley, W.S. (Medical Univ. of South Carolina, Charleston (USA))

    1990-02-01

    Dyskeratosis congenita (DC) is an inherited disorder characterized by reticular pigmentation of the skin, dystrophic nails, mucosal leukoplakia, and a predisposition to cancer in early adult life. In the majority of cases, DC is an X-linked recessive trait. However, one or more autosomal form(s) of DC may exist. Although excessive spontaneous chromatid breakage has been reported in DC, it is not a consistent cytological marker for this disorder. We examined the frequency and specificity of X-irradiation-induced G2 chromatid breakage in fibroblasts from three unrelated DC patients (two males and one female). Metaphase cells from DC patients had significantly more chromatid breaks (16-18-fold and 17-26-fold at 50 and 100 rad X-irradiation, respectively) and chromatid gaps (10-12-fold and 6-7-fold at 50 and 100 rad, respectively) than those from two different controls. Analysis of banded chromosomes revealed a nonrandom distribution of chromatid aberrations in DC but not in controls, a distribution corresponding to some of the known breakpoints for cancer-specific rearrangements, constitutive fragile sites, and/or loci for cellular proto-oncogenes. The significance of this finding for cancer predisposition in DC patients is uncertain, but the increased susceptibility of X-irradiation-induced chromatid breakage may serve as a cellular marker of diagnostic value.

  14. Nuclear Chk1 prevents premature mitotic entry.

    Science.gov (United States)

    Matsuyama, Makoto; Goto, Hidemasa; Kasahara, Kousuke; Kawakami, Yoshitaka; Nakanishi, Makoto; Kiyono, Tohru; Goshima, Naoki; Inagaki, Masaki

    2011-07-01

    Chk1 inhibits the premature activation of the cyclin-B1-Cdk1. However, it remains controversial whether Chk1 inhibits Cdk1 in the centrosome or in the nucleus before the G2-M transition. In this study, we examined the specificity of the mouse monoclonal anti-Chk1 antibody DCS-310, with which the centrosome was stained. Conditional Chk1 knockout in mouse embryonic fibroblasts reduced nuclear but not centrosomal staining with DCS-310. In Chk1(+/myc) human colon adenocarcinoma (DLD-1) cells, Chk1 was detected in the nucleus but not in the centrosome using an anti-Myc antibody. Through the combination of protein array and RNAi technologies, we identified Ccdc-151 as a protein that crossreacted with DCS-310 on the centrosome. Mitotic entry was delayed by expression of the Chk1 mutant that localized in the nucleus, although forced immobilization of Chk1 to the centrosome had little impact on the timing of mitotic entry. These results suggest that nuclear but not centrosomal Chk1 contributes to correct timing of mitotic entry.

  15. Data of evolutionary structure change: 1AQFB-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AQFB-3G2GD 1AQF 3G2G B D IQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTI...ISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGD...HQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP -QTQQLHAAMADTFLEHMC...VSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICAT...QMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPT

  16. Outcomes for Extremely Premature Infants

    Science.gov (United States)

    Glass, Hannah C.; Costarino, Andrew T.; Stayer, Stephen A.; Brett, Claire; Cladis, Franklyn; Davis, Peter J.

    2015-01-01

    Premature birth is a significant cause of infant and child morbidity and mortality. In the United States, the premature birth rate, which had steadily increased during the 1990s and early 2000s, has decreased annually for four years and is now approximately 11.5%. Human viability, defined as gestational age at which the chance of survival is 50%, is currently approximately 23–24 weeks in developed countries. Infant girls, on average, have better outcomes than infant boys. A relatively uncomplicated course in the intensive care nursery for an extremely premature infant results in a discharge date close to the prenatal EDC. Despite technological advances and efforts of child health experts during the last generation, the extremely premature infant (less than 28 weeks gestation) and extremely low birth weight infant (ELBW) (premature labor improved neonatal mortality and morbidity in the late 1990s. The recognition that chronic postnatal administration of steroids to infants should be avoided may have improved outcomes in the early 2000s. Evidence from recent trials attempting to define the appropriate target for oxygen saturation in preterm infants suggests arterial oxygen saturation between 91–95% (compared to 85–89%) avoids excess mortality. However, final analyses of data from these trials have not been published, so definitive recommendations are still pending The development of neonatal neurocognitive care visits may improve neurocognitive outcomes in this high-risk group. Long-term follow up to detect and address developmental, learning, behavioral, and social problems is critical for children born at these early gestational ages. The striking similarities in response to extreme prematurity in the lung and brain imply that agents and techniques that benefit one organ are likely to also benefit the other. Finally, since therapy and supportive care continue to change, the outcomes of ELBW infants are ever evolving. Efforts to minimize injury, preserve

  17. Outcomes for extremely premature infants.

    Science.gov (United States)

    Glass, Hannah C; Costarino, Andrew T; Stayer, Stephen A; Brett, Claire M; Cladis, Franklyn; Davis, Peter J

    2015-06-01

    Premature birth is a significant cause of infant and child morbidity and mortality. In the United States, the premature birth rate, which had steadily increased during the 1990s and early 2000s, has decreased annually for 7 years and is now approximately 11.39%. Human viability, defined as gestational age at which the chance of survival is 50%, is currently approximately 23 to 24 weeks in developed countries. Infant girls, on average, have better outcomes than infant boys. A relatively uncomplicated course in the intensive care nursery for an extremely premature infant results in a discharge date close to the prenatal estimated date of confinement. Despite technological advances and efforts of child health experts during the last generation, the extremely premature infant (less than 28 weeks gestation) and extremely low birth weight infant (death and disability with 30% to 50% mortality and, in survivors, at least 20% to 50% risk of morbidity. The introduction of continuous positive airway pressure, mechanical ventilation, and exogenous surfactant increased survival and spurred the development of neonatal intensive care in the 1970s through the early 1990s. Routine administration of antenatal steroids during premature labor improved neonatal mortality and morbidity in the late 1990s. The recognition that chronic postnatal administration of steroids to infants should be avoided may have improved outcomes in the early 2000s. Evidence from recent trials attempting to define the appropriate target for oxygen saturation in preterm infants suggests arterial oxygen saturation between 91% and 95% (compared with 85%-89%) avoids excess mortality; however, final analyses of data from these trials have not been published, so definitive recommendations are still pending. The development of neonatal neurocritical intensive care units may improve neurocognitive outcomes in this high-risk group. Long-term follow-up to detect and address developmental, learning, behavioral, and

  18. Measure Guideline: Evaporative Condensers

    Energy Technology Data Exchange (ETDEWEB)

    German, A.; Dakin, B.; Hoeschele, M.

    2012-03-01

    The purpose of this measure guideline on evaporative condensers is to provide information on a cost-effective solution for energy and demand savings in homes with cooling loads. This is a prescriptive approach that outlines selection criteria, design and installation procedures, and operation and maintenance best practices. This document has been prepared to provide a process for properly designing, installing, and maintaining evaporative condenser systems as well as understanding the benefits, costs, and tradeoffs.

  19. MODERN PRODUCTS FOR FEEDING PREMATURE BABIES

    Directory of Open Access Journals (Sweden)

    A. V. Surzhik

    2012-01-01

    Full Text Available In recent decades there has been substantial progress in the technology of premature infants nursing, especially with extremely low birth weight. Adequate feeding is one of the fundamental factors of premature babies nursing. To ensure a premature baby with all necessary components for power saving in breast milk intake, breast milk fortifiers — specifically developed additives that adjust the composition of food for premature babies, are used for more than 20 years (for premature babies receiving breast milk. On the one hand, to preserve all benefits of breastfeeding, on the other — to prevent the deficit development of necessary elements for adequate growth and development of nutrients.

  20. [Forensic importance of premature craniosynostosis].

    Science.gov (United States)

    Fehlow, P

    1991-01-01

    In agreement with Canabis craniosynostosis as a little known organic partial factor of sociopathy is demonstrated. A psychic syndrome of the frontal lobe with increased susceptibility in environmental damages is assumed to be basic disorder. In the criminals of the material sexual offenders were preponderating. Associated craniofacial dysplasias are a risk for psychic maldevelopment. The importance of premature craniosynostocis as a biological risk factor, incidence, diagnostic, indication for an operation, also in the meaning of a neurosurgical "Konflikttherapie" (cosmetical indication) are discussed.

  1. Ethanol Extract of Dianthus chinensis L. Induces Apoptosis in Human Hepatocellular Carcinoma HepG2 Cells In Vitro

    Directory of Open Access Journals (Sweden)

    Kyoung Jin Nho

    2012-01-01

    Full Text Available Dianthus chinensis L. is used to treat various diseases including cancer; however, the molecular mechanism by which the ethanol extract of Dianthus chinensis L. (EDCL induces apoptosis is unknown. In this study, the apoptotic effects of EDCL were investigated in human HepG2 hepatocellular carcinoma cells. Treatment with EDCL significantly inhibited cell growth in a concentration- and time-dependent manner by inducing apoptosis. This induction was associated with chromatin condensation, activation of caspases, and cleavage of poly (ADP-ribose polymerase protein. However, apoptosis induced by EDCL was attenuated by caspase inhibitor, indicating an important role for caspases in EDCL responses. Furthermore, EDCL did not alter the expression of bax in HepG2 cells but did selectively downregulate the expression of bcl-2 and bcl-xl, resulting in an increase in the ratio of bax:bcl-2 and bax:bcl-xl. These results support a mechanism whereby EDCL induces apoptosis through the mitochondrial pathway and caspase activation in HepG2 cells.

  2. Ethanol Extract of Dianthus chinensis L. Induces Apoptosis in Human Hepatocellular Carcinoma HepG2 Cells In Vitro.

    Science.gov (United States)

    Nho, Kyoung Jin; Chun, Jin Mi; Kim, Ho Kyoung

    2012-01-01

    Dianthus chinensis L. is used to treat various diseases including cancer; however, the molecular mechanism by which the ethanol extract of Dianthus chinensis L. (EDCL) induces apoptosis is unknown. In this study, the apoptotic effects of EDCL were investigated in human HepG2 hepatocellular carcinoma cells. Treatment with EDCL significantly inhibited cell growth in a concentration- and time-dependent manner by inducing apoptosis. This induction was associated with chromatin condensation, activation of caspases, and cleavage of poly (ADP-ribose) polymerase protein. However, apoptosis induced by EDCL was attenuated by caspase inhibitor, indicating an important role for caspases in EDCL responses. Furthermore, EDCL did not alter the expression of bax in HepG2 cells but did selectively downregulate the expression of bcl-2 and bcl-xl, resulting in an increase in the ratio of bax:bcl-2 and bax:bcl-xl. These results support a mechanism whereby EDCL induces apoptosis through the mitochondrial pathway and caspase activation in HepG2 cells.

  3. Evaluation of Radiation Dose Received by Premature Neonates Admitted to Neonatal Intensive Care Unit

    Science.gov (United States)

    Aramesh, Mohmmadreza; Zanganeh, Kobra Aria; Dehdashtian, Masoud; Malekian, Arash; Fatahiasl, Jafar

    2017-01-01

    Background This study aimed to evaluate the radiation dose received by premature neonates using diagnostic radiographies. Methods This cross-sectional study was conducted on 116 premature neonates with gestational age from 25 to 37 weeks; with the diagnosis of neonatal respiratory distress syndrome (NRDS) and tachypnea, they were admitted to a neonatal intensive care unit (NICU) at Ahvaz Imam Khomeini Hospital in 2015. For assessing the dose received, the model GR-200 thermoluminescent dosimeter (TLD) was used. For each premature neonate under radiation, three TLDs separately (one for each) were placed on surfaces of Ch1, T1, and G1 (chest, thyroid, and gonad of first newborn, respectively). Moreover, for the adjacent neonate at a distance of 60 - 100 cm, two TLDs were laid in the surfaces of T2 and G2 (thyroid and gonad of second newborn, respectively). The dose received by TLDs for any baby and the adjacent neonate under the entrance surface dose (ESD) was estimated. Results The mean of neonates’ weight under study was 1,950.78 ± 484.9 g. During the hospitalization period, minimum one and maximum three radiographies were done for any premature neonate. The doses received in the premature neonates to Ch1, T1 and G1 were 0.08 ± 0.01, 0.06 ± 0.01, and 0.05 ± 0.01 mSv, respectively and for adjacent infants for T2 and G2 were 0.003 ± 0.001 and 0.002 ± 0.0009 mSv, respectively. Conclusions In the study, radiation dose received by organs at risk of premature neonates was lower than the international criteria and standards, therefore, also due to the lack of radiation damage threshold, to limit collimator, and the use of the proper filtration, kilovoltage and time during radiography of premature neonates are recommended. PMID:28090228

  4. Hepatoma cell line HepG2.2.15 demonstrates distinct biological features compared with parental HepG2

    Institute of Scientific and Technical Information of China (English)

    Ran Zhao; Tian-Zhen Wang; Dan Kong; Lei Zhang; Hong-Xue Meng; Yang Jiang; Yi-Qi Wu; Zu-Xi Yu; Xiao-Ming Jin

    2011-01-01

    AIM: To investigate the biological features of hepatitis B virus (HBV)-transfected HepG2.2.15 cells. METHODS: The cell ultrastructure, cell cycle and apop-tosis, and the abilities of proliferation and invasion of HBV-transfected HepG2.2.15 and the parent HepG2 cells were examined by electron microscopy, flow cytometry, 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide and trans-well assay. Oncogenicity of the two cell lines was compared via subcutaneous injection and orthotopic injection or implantation in nude mice, and the pathological analysis of tumor formation was performed. Two cytoskeletal proteins were detected by Western blotting.RESULTS: Compared with HepG2 cells, HepG2.2.15 cells showed organelle degeneration and filopodia disappear-ance under electron microscope. HepG2.2.15 cells pro-liferated and migrated slowly in vitro, and hardly formed tumor and lung metastasis in nude mice. Flow cytom-etry showed that the majority of HepG2.2.15 cells were arrested in G1 phase, and apoptosis was minor in both cell lines. Furthermore, the levels of cytoskeletal pro-teins F-actin and Ezrin were decreased in HepG2.2.15 cells.CONCLUSION: HepG2.2.15 cells demonstrated a low-er proliferation and invasion ability than the HepG2 cells due to HBV transfection.

  5. CONDENSATION OF WATER VAPOR IN A VERTICAL TUBE CONDENSER

    Directory of Open Access Journals (Sweden)

    Jan Havlík

    2015-10-01

    Full Text Available This paper presents an analysis of heat transfer in the process of condensation of water vapor in a vertical shell-and-tube condenser. We analyze the use of the Nusselt model for calculating the condensation heat transfer coefficient (HTC inside a vertical tube and the Kern, Bell-Delaware and Stream-flow analysis methods for calculating the shell-side HTC from tubes to cooling water. These methods are experimentally verified for a specific condenser of waste process vapor containing air. The operating conditions of the condenser may be different from the assumptions adopted in the basic Nusselt theory. Modifications to the Nusselt condensation model are theoretically analyzed.

  6. Premature birth and diseases in premature infants: common genetic background?

    Science.gov (United States)

    Hallman, Mikko

    2012-04-01

    It has been proposed that during human evolution, development of obligate bipedalism, narrow birth canal cross-sectional area and the large brain have forced an adjustment in duration of pregnancy (scaling of gestational age; Plunkett 2011). Children compared to other mammals are born with proportionally small brains (compared to adult brains), suggesting shortening of pregnancy duration during recent evolution. Prevalence of both obstructed delivery and premature birth is still exceptionally high. In near term infants, functional maturity and viability is high, and gene variants predisposing to respiratory distress syndrome (RDS) are rare. Advanced antenatal and neonatal treatment practices during the new era of medicine allowed survival of also very preterm infants (gestation premature birth. Specific genes associating with diseases in preterm infants may also contribute to the susceptibility to preterm birth. Understanding and applying the knowledge of genetic interactions in normal and abnormal perinatal-neonatal development requires large, well-structured population cohorts, studies involving the whole genome and international interdisciplinary collaboration.

  7. The Oscillator Strengths of H2+, 1s\\sigma_{g}-2p\\sigma_{u}, 1s\\sigma_{g}-2p\\pi_{u}

    CERN Document Server

    Tsogbayar, Ts

    2010-01-01

    The oscillator strengths of the $H^+_2$ molecular ion, $1s\\sigma_{g}-2p\\sigma_{u}$, $1s\\sigma_{g}-2p\\pi_{u}$ are calculated within the Born-Oppenheimer approximation. The variational expansion with randomly chosen exponents has been used for numerical studies. The oscillator strengths obtained for the transitions $1s\\sigma_{g}-2p\\sigma_{u}$, $1s\\sigma_{g}-2p\\pi_{u}$ of $H^+_2$ are accurate up to ten significant digits. Results are given for the internuclear distances between 0.10 and 20.0 a.u.

  8. Condensed matter physics

    CERN Document Server

    Isihara, A

    2007-01-01

    More than a graduate text and advanced research guide on condensed matter physics, this volume is useful to plasma physicists and polymer chemists, and their students. It emphasizes applications of statistical mechanics to a variety of systems in condensed matter physics rather than theoretical derivations of the principles of statistical mechanics and techniques. Isihara addresses a dozen different subjects in separate chapters, each designed to be directly accessible and used independently of previous chapters. Topics include simple liquids, electron systems and correlations, two-dimensional

  9. [Premature ejaculation: pills or sexology?].

    Science.gov (United States)

    Wisard, M; Audette, N

    2008-03-26

    Premature ejaculation (PE) is a frequent male sexual complaint that affects 20 to 30% of men. The exact aetiology is unknown: psychological/behavioristic and biogenic etiologies have been proposed. The introduction of selective serotonin reuptake inhibitors (SSRI) was revolutionary in the medical treatment of PE. However precautions should be taken because of potential adverse side effects. There is no clear consensus as to whether SSRI may represent an eventual cure of PE or will be required for life. The sexocorporal approach is an other treatment of PE, but convincing scientific treatment data are also lacking.

  10. Positional moulding in premature hydrocephalics.

    Directory of Open Access Journals (Sweden)

    Kumar R

    2002-04-01

    Full Text Available Seven premature hydrocephalics presenting with lambdoid positional moulding (LPM were reviewed. All were treated for hydrocephalus secondary to aqueductal stenosis, Dandy Walker Syndrome and infection. Parenchymal hemorrhage, intraventricular bleed, cortical atrophy, septal agenesis, cortical anomalies and subdural hygroma were the other common associations. These children did not show expected improvement in their higher mental functions at 6 months to 5.4 years of follow-up, following the management of hydrocephalus. It was not the LPM but associated intracranial anomalies, which were most probably responsible for their poor outcome. The differentiation from posterior plagiocephaly is also highlighted.

  11. Metabolic bone disease of prematurity

    Directory of Open Access Journals (Sweden)

    Stacy E. Rustico, MD

    2014-09-01

    Full Text Available Metabolic bone disease (MBD of prematurity remains a significant problem for preterm, chronically ill neonates. The definition and recommendations for screening and treatment of MBD vary in the literature. A recent American Academy of Pediatrics Consensus Statement may help close the gap in institutional variation, but evidence based practice guidelines remain obscure due to lack of normative data and clinical trials for preterm infants. This review highlights mineral homeostasis physiology, current recommendations in screening and monitoring, prevention and treatment strategies, and an added perspective of a bone health team serving a high volume referral neonatal intensive care center.

  12. Current therapies for premature ejaculation.

    Science.gov (United States)

    Gur, Serap; Kadowitz, Philip J; Sikka, Suresh C

    2016-07-01

    Premature ejaculation (PE) subjectively affects 20-30% of men globally. Until recently, understanding of PE was hampered by the absence of a widely accepted definition, paucity of evidence-based clinical studies, and the absence of an appropriate animal model. Here, we elaborate on the current definition of PE, its pathogenesis, currently available therapies, and future treatment prospects. Most treatments for PE are 'off-label' and include selective serotonin reuptake inhibitors (SSRIs), topical anesthetics, tramadol, and phosphodiesterase type 5 (PDE5) inhibitors. Such knowledge of the benefit and limitations of each treatment will help to direct future drug design and formulations.

  13. Premature ventricular contractions associated with isotretinoin use.

    Science.gov (United States)

    Alan, Sevil; Ünal, Betül; Yildirim, Aytül

    2016-01-01

    Isotretinoin has been considered a unique drug for acne treatment. However, it is associated with numerous adverse effects. Isotretinoin can trigger premature ventricular contractions. This report describes a 33-year-old-woman who presented with palpitations for 1 week while undergoing 1-month isotretinoin treatment for mild-moderate facial acne. An electrocardiogram and Holter monitoring showed premature ventricular contractions during isotretinoin (Roaccutane, Roche) treatment. Isotretinoin-related premature ventricular contractions were strongly suggested in this case due to the existence of documented premature ventricular contractions on electrocardiograms and the disappearance of these premature ventricular contractions two weeks after termination of the treatment To the authors' knowledge, there has been 1 reported case of premature ventricular contractions linked to isotretinoin use; this report describes a second such case.

  14. Premature ventricular contractions associated with isotretinoin use*

    Science.gov (United States)

    Alan, Sevil; Ünal, Betül; Yildirim, Aytül

    2016-01-01

    Isotretinoin has been considered a unique drug for acne treatment. However, it is associated with numerous adverse effects. Isotretinoin can trigger premature ventricular contractions. This report describes a 33-year-old-woman who presented with palpitations for 1 week while undergoing 1-month isotretinoin treatment for mild-moderate facial acne. An electrocardiogram and Holter monitoring showed premature ventricular contractions during isotretinoin (Roaccutane, Roche) treatment. Isotretinoin-related premature ventricular contractions were strongly suggested in this case due to the existence of documented premature ventricular contractions on electrocardiograms and the disappearance of these premature ventricular contractions two weeks after termination of the treatment To the authors' knowledge, there has been 1 reported case of premature ventricular contractions linked to isotretinoin use; this report describes a second such case. PMID:28099609

  15. The G2/M DNA damage checkpoint inhibits mitosis through Tyr15 phosphorylation of p34cdc2 in Aspergillus nidulans.

    OpenAIRE

    Ye, X S; Fincher, R R; Tang, A; Osmani, S A

    1997-01-01

    It is possible to cause G2 arrest in Aspergillus nidulans by inactivating either p34cdc2 or NIMA. We therefore investigated the negative control of these two mitosis-promoting kinases after DNA damage. DNA damage caused rapid Tyr15 phosphorylation of p34cdc2 and transient cell cycle arrest but had little effect on the activity of NIMA. Dividing cells deficient in Tyr15 phosphorylation of p34cdc2 were sensitive to both MMS and UV irradiation and entered lethal premature mitosis with damaged DN...

  16. Simple Simulations of DNA Condensation

    Energy Technology Data Exchange (ETDEWEB)

    STEVENS,MARK J.

    2000-07-12

    Molecular dynamics simulations of a simple, bead-spring model of semiflexible polyelectrolytes such as DNA are performed. All charges are explicitly treated. Starting from extended, noncondensed conformations, condensed structures form in the simulations with tetravalent or trivalent counterions. No condensates form or are stable for divalent counterions. The mechanism by which condensates form is described. Briefly, condensation occurs because electrostatic interactions dominate entropy, and the favored Coulombic structure is a charge ordered state. Condensation is a generic phenomena and occurs for a variety of polyelectrolyte parameters. Toroids and rods are the condensate structures. Toroids form preferentially when the molecular stiffness is sufficiently strong.

  17. Preventing freezing of condensate inside tubes of air cooled condenser

    Energy Technology Data Exchange (ETDEWEB)

    Joo, Jeong A; Hwang, In Hwan; Lee, Dong Hwan [Chonbuk Nat' l Univ., Jeonju (Korea, Republic of); Cho, Young Il [Drexel Univ., Philadelphia (United States)

    2012-08-15

    An air cooled condenser is a device that is used for converting steam into condensate by using ambient air. The air cooled condenser is prone to suffer from a serious explosion when the condensate inside the tubes of a heat exchanger is frozen; in particular, tubes can break during winter. This is primarily due to the structural problem of the tube outlet of an existing conventional air cooled condenser system, which causes the backflow of residual steam and noncondensable gases. To solve the backflow problem in such condensers, such a system was simulated and a new system was designed and evaluated in this study. The experimental results using the simulated condenser showed the occurrence of freezing because of the backflow inside the tube. On the other hand, no backflow and freezing occurred in the advanced new condenser, and efficient heat exchange occurred.

  18. Condensed Matter Physics

    Science.gov (United States)

    Marder, Michael P.

    2000-01-01

    A modern, unified treatment of condensed matter physics This new work presents for the first time in decades a sweeping review of the whole field of condensed matter physics. It consolidates new and classic topics from disparate sources, teaching "not only about the effective masses of electrons in semiconductor crystals and band theory, but also about quasicrystals, dynamics of phase separation, why rubber is more floppy than steel, electron interference in nanometer-sized channels, and the quantum Hall effect." Six major areas are covered---atomic structure, electronic structure, mechanical properties, electron transport, optical properties, and magnetism. But rather than defining the field in terms of particular materials, the author focuses on the way condensed matter physicists approach physical problems, combining phenomenology and microscopic arguments with information from experiments. For graduate students and professionals, researchers and engineers, applied mathematicians and materials scientists, Condensed Matter Physics provides: * An exciting collection of new topics from the past two decades. * A thorough treatment of classic topics, including band theory, transport theory, and semiconductor physics. * Over 300 figures, incorporating many images from experiments. * Frequent comparison of theory and experiment, both when they agree and when problems are still unsolved. * More than 50 tables of data and a detailed index. * Ample end-of-chapter problems, including computational exercises. * Over 1000 references, both recent and historically significant.

  19. Soft condensed matter

    NARCIS (Netherlands)

    Frenkel, D.

    2002-01-01

    These lectures illustrate some of the concepts of soft-condensed matter physics, taking examples from colloid physics. Many of the theoretical concepts will be illustrated with the results of computer simulations. After a brief introduction describing interactions between colloids, the paper focuses

  20. Condensed landscape experience

    DEFF Research Database (Denmark)

    Earon, Ofri

    2011-01-01

    . This paper addresses the question of whether the sensation of landscape can be condensed in function or to the size of an urban building. It also discusses the benefits and potentials of the amalgamate, by underlining the unique qualities of such a hybrid. In an attempt to define the experience of landscape...

  1. Premature temporal theta (PT theta).

    Science.gov (United States)

    Hughes, J R; Fino, J J; Hart, L A

    1987-07-01

    A distinctive pattern called premature temporal theta (PT theta) was studied in 436 infants, ranging in age from 24 to 46 weeks. The pattern is seen in early prematurity, maximizes at 29-31 weeks and then diminishes and disappears near term. Usually the pattern is found independently on both temporal areas, but with a right-sided preference. Patients without PT theta or with a significantly low amount had either neurological or non-neurological (medical) conditions. With age there is a tendency for an increase in frequency and a decrease in amplitude. Five different peaks in the amount of this pattern are seen at approximately every month. Unilateral PT theta tends to be seen in older babies, more often on the right side and with an abnormal EEG. An abnormal EEG is usually associated with a delay in both the appearance and disappearance of this wave form. PT theta is also associated mainly with REM or active sleep. A polynomial rather than an exponential or power function best describes these data with changes of age. PT theta may arise from the inferior temporal gyrus and/or especially the transverse gyrus.

  2. Distribution of DNA and localization of rRNA transcription in G2 phase nucleolus of Physarum polycephalum

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Using electron microscopy, NAMA-Ur DNA selective staining and BrUTP incorporation, the nucleo lus ultrastructure, the distribution of DNA and the rRNA transcription sites in nucleolus of G2 phase Physarum poly cephalum were studied. The nucleolus was found to be different in structure from that of other plant cells. Fibrillar cen tern (FCs) were present in a large amount all over the nucleolus. DNA was distributed both in dense fibrillar components (DFC) and in FC. The DNA in the nucleolus was less condensed than that of the chromosome territory. These changes suggested that the transcription was active within the nucleolus. BrUTP incorporation localized the rRNA transcription in DFC and at the interface of FC and DFC, suggesting that the DNA in FC is in a storage form and only the rDNA in DFC is transcribed.

  3. Batch process. Batch plant scheduling using an intelligent system developing tool (G2); Interijento system kaihatsu tsuru ( G2 ) wo mochiita bacchi puranto sukejuringu

    Energy Technology Data Exchange (ETDEWEB)

    Fukuoka, H. [Itochu Technology Science Co. Ltd. (Japan)

    1997-09-05

    G2 is used in many industrial fields as a tool capable of forming in a comparatively short period of time various kinds of high-degree intelligent system including a scheduling system. This paper introduces G2, and then describes a batch scheduling system. The software techniques provided by G2 include the techniques concerning a real time system, an expert system, a graphic user interface, and object-oriented security network. G2 has a striking feature that it is a developing tool adapted to enable these software techniques to be utilized in a united environment. A program developed by G2 has a feature that it can be operated as it is without changing the source program at all even when the program is used in a machine of another OS. The paper introduces a beer production scheduling system as an actual example. 3 figs.

  4. Domains of Disoriented Chiral Condensate

    CERN Document Server

    Amado, R D; Lu, Yang

    1996-01-01

    The probability distribution of neutral pion fraction from independent domains of disoriented chiral condensate is characterized. The signal for the condensate is clear for a small number of domains but is greatly reduced for more than three.

  5. Data of evolutionary structure change: 1E0UC-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E0UC-3G2GD 1E0U 3G2G C D ----------------------------MKKTKIVCTIG...PKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKT------GKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVI--GNSEMVAVTYE...GFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIIS...KIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVAN...TAHQLVLSKGVVPQLV--KEITSTDDFYR----LGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL- QTQQLHAAMADTFLEHMCRLD

  6. Data of evolutionary structure change: 1F3WA-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1F3WA-3G2GD 1F3W 3G2G A D IQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTI...ISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGD...HQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP -QTQQLHAAMADTFLEHMC...VSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICAT...QMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPT

  7. Data of evolutionary structure change: 1F3XH-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1F3XH-3G2GD 1F3X 3G2G H D IQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTI...ISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGD...HQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP -QTQQLHAAMADTFLEHMC...VSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICAT...QMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPT

  8. Photon condensation: A new paradigm for Bose-Einstein condensation

    Science.gov (United States)

    Rajan, Renju; Ramesh Babu, P.; Senthilnathan, K.

    2016-10-01

    Bose-Einstein condensation is a state of matter known to be responsible for peculiar properties exhibited by superfluid Helium-4 and superconductors. Bose-Einstein condensate (BEC) in its pure form is realizable with alkali atoms under ultra-cold temperatures. In this paper, we review the experimental scheme that demonstrates the atomic Bose-Einstein condensate. We also elaborate on the theoretical framework for atomic Bose-Einstein condensation, which includes statistical mechanics and the Gross-Pitaevskii equation. As an extension, we discuss Bose-Einstein condensation of photons realized in a fluorescent dye filled optical microcavity. We analyze this phenomenon based on the generalized Planck's law in statistical mechanics. Further, a comparison is made between photon condensate and laser. We describe how photon condensate may be a possible alternative for lasers since it does not require an energy consuming population inversion process.

  9. 7 CFR 29.2290 - Premature primings.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Premature primings. 29.2290 Section 29.2290 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... 21) § 29.2290 Premature primings. Ground leaves harvested before reaching complete growth and...

  10. 28 CFR 51.22 - Premature submissions.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Premature submissions. 51.22 Section 51.22 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) PROCEDURES FOR THE ADMINISTRATION OF... § 51.22 Premature submissions. The Attorney General will not consider on the merits: (a) Any proposal...

  11. Premature infants' health at multiple induced pregnancy.

    Directory of Open Access Journals (Sweden)

    Chernenkov Yu.V.

    2015-09-01

    Full Text Available Objective: to define the risk factors adversely influencing prenatal development at premature birth at use of methods of assisted reproductive technology (ART; to estimate premature' infants health from multiple induced pregnancy according to Perinatal Center of Saratov for last 3 years. Material and Methods. Under supervision there were 139 pregnant women with application ART. 202 children (51 twins were born and 5 triplet babies, from them 83 premature infants born from multiple induced pregnancy have been analyzed. Results. The newborns examined by method ART, were distributed as follows: 22-28 weeks — 19 children; 29-32 weeks — 23; 33-36 weeks — 41. Asphyxia at birth was marked at all premature infants. Respiratory insufficiency at birth is revealed in 87,3% of cases. The most frequent pathologies in premature infants are revealed: neurologic infringements and bronchopulmonary pathology occured at all children, developmental anomaly — 33, 8%, retinopathies in premature infants — 26,5%. The mortality causes include: extreme immaturity, cerebral leukomalacia, IVN 3 degrees. Conclusion. The risk factors, premature birth at application of methods ART are revealed: aged primiparas, pharmacological influence, absence of physiological conditions of prenatal development; multifetation. The high percent of birth of children with ELBW and ULBW is revealed. RDCN with further BPD development, retinopathies in premature infants and CNS defeat is more often occured.

  12. ANTIPROLIFERATIVE AND APOPTOTIC EFFECTS OF THE ESSENTIAL OIL OF ORIGANUM ONITES AND CARVACROL ON HEP-G2 CELLS

    Directory of Open Access Journals (Sweden)

    Özlem TOMSUK

    2011-08-01

    Full Text Available The essential oil Origanum onites L. and its phenolic constituent carvacrol were examined for their cytotoxic and apoptotic effects in a human hepatocellular carcinoma cells Hep-G2. WST-1 and neutral red uptake assays were performed to determine the inhibitory effects of the oil and carvacrol on the growth of the cells. Possible induction of apoptosis by Origanum oil and carvacrol was further investigated by acridine orange/ethidium bromide (AO/EB staining. Results showed that the Ori- ganum oil and carvacrol was significantly cytotoxic and induced apoptosis in Hep-G2 cells. IC₅₀ value of essential oil and carvacrol was found about 0,009% (v/v and 500 μM, respectively. After incuba- tion of the cells with Origanum oil and carvacrol, characteristics of apoptotic morphology such as chromatin condensation, shrinkage of the cells and cytoplasmic blebbing was observed. In conclusion, both essential oil and its major constituent carvacrol significantly exhibited cytotoxic and apoptotic activities in hepatocellular carcinoma cells, indicating its potential for use as an anticancer agent.

  13. Condensed matter physics

    CERN Document Server

    Marder, Michael P

    2010-01-01

    This Second Edition presents an updated review of the whole field of condensed matter physics. It consolidates new and classic topics from disparate sources, teaching not only about the effective masses of electrons in semiconductor crystals and band theory, but also about quasicrystals, dynamics of phase separation, why rubber is more floppy than steel, granular materials, quantum dots, Berry phases, the quantum Hall effect, and Luttinger liquids.

  14. [Premature rupture of membranes and chorioamnionitis].

    Science.gov (United States)

    Lopez Garcia, R

    1988-01-01

    Despite advances in perinatal medicine in the past decade, the diagnosis and treatment of premature rupture of membranes remain controversial. Premature rupture occurs in 2.7-7.0% of pregnancies and most cases occur spontaneously without apparent cause. The disparity in reported rates of premature rupture is due to differences in the definition and diagnostic criteria for premature rupture and lack of comparability in the populations studied. Mexico's National Institute of Perinatology has adopted the definition of the American COllege of Gynecology and Obstetrics which views premature rupture as that occurring before regular uterine contractions that produce cervical dilation. 8.8% of its patients have premature rupture according to this definition. 20% of cases occur before the 36th week of pregnancy. Treatment of rupture occurring before 37 weeks must balance the threat of amniotic infection with the dangers of premature birth. Infections appear more common in low income patient populations. Chorioamnionitis is a serious complication of pregnancy and is the main argument against conservative treatment of premature rupture. The rate of maternal infection is directly related to the time elapsing between rupture of the membranes and birth. The rate increases after the 1st 24 hours and is at least 10 times higher after 72 hours. But recent studies suggest that there is no considerable increase in infection if vaginal explorations are avoided and careful techniques are used in treating the patient. Those who advise conservative treatment believe that prenatal outcomes are better because respiratory disease syndrome due to prematurity is avoided. Conservative management requires a white cell count at least every 24 hours and measurement of pulse, maternal temperature, and fetal heart rate ideally every 4 hours. Perinatal mortality rates due to premature rupture of membranes range from 2.5-50%. The principal causes are respiratory disease syndrome, infection, asphyxia

  15. Human milk for the premature infant

    Science.gov (United States)

    Underwood, Mark A.

    2012-01-01

    Synopsis Premature infants are a heterogeneous group with widely differing needs for nutrition and immune protection with risk of growth failure, developmental delays, necrotizing enterocolitis, and late-onset sepsis increasing with decreasing gestational age and birth weight. Human milk from women delivering prematurely has more protein and higher levels of many bioactive molecules compared to milk from women delivering at term. Human milk must be fortified for small premature infants to achieve adequate growth. Mother’s own milk improves growth and neurodevelopment and decreases the risk of necrotizing enterocolitis and late-onset sepsis and should therefore be the primary enteral diet of premature infants. Donor milk is a valuable resource for premature infants whose mothers are unable to provide an adequate supply of milk, but presents significant challenges including the need for pasteurization, nutritional and biochemical deficiencies and a limited supply. PMID:23178065

  16. Chaos of chiral condensate

    CERN Document Server

    Hashimoto, Koji; Yoshida, Kentaroh

    2016-01-01

    Assigning a chaos index for vacua of generic quantum field theories is a challenging problem. We find chaotic behavior of chiral condensates of a quantum gauge theory at strong coupling limit, by using the AdS/CFT correspondence. We evaluate the time evolution of homogeneous quark condensates and in an N=2 supersymmetric QCD with the SU(N_c) gauge group at large N_c and at large 't Hooft coupling lambda. At an equivalent classical gravity picture, a Lyapunov exponent is readily defined. We show that the condensates exhibit chaotic behavior for energy density E > (6x10^2) (N_c/lambda^2) (m_q)^4 where m_q is the quark mass. The energy region of the chaotic vacua of the N=2 supersymmetric QCD increases for smaller N_c or larger lambda. The Lyapunov exponent is calculated as a function of the theory (N_c,lambda,E), showing that the N=2 supersymmetric QCD is more chaotic for smaller N_c.

  17. Asymmetric condensed dark matter

    CERN Document Server

    Aguirre, Anthony

    2015-01-01

    We explore the viability of a boson dark matter candidate with an asymmetry between the number densities of particles and antiparticles. A simple thermal field theory analysis confirms that, under certain general conditions, this component would develop a Bose-Einstein condensate in the early universe that, for appropriate model parameters, could survive the ensuing cosmological evolution until now. The condensation of a dark matter component in equilibrium with the thermal plasma is a relativistic process, hence the amount of matter dictated by the charge asymmetry is complemented by a hot relic density frozen out at the time of decoupling. Contrary to the case of ordinary WIMPs, dark matter particles in a condensate can be very light, $10^{-22}\\,{\\rm eV} \\lesssim m \\lesssim 10^2\\,{\\rm eV}$; the lower limit arises from constraints on small-scale structure formation, while the upper bound ensures that the density from thermal relics is not too large. Big-Bang nucleosynthesis constrains the temperature of deco...

  18. Asymmetric condensed dark matter

    Science.gov (United States)

    Aguirre, Anthony; Diez-Tejedor, Alberto

    2016-04-01

    We explore the viability of a boson dark matter candidate with an asymmetry between the number densities of particles and antiparticles. A simple thermal field theory analysis confirms that, under certain general conditions, this component would develop a Bose-Einstein condensate in the early universe that, for appropriate model parameters, could survive the ensuing cosmological evolution until now. The condensation of a dark matter component in equilibrium with the thermal plasma is a relativistic process, hence the amount of matter dictated by the charge asymmetry is complemented by a hot relic density frozen out at the time of decoupling. Contrary to the case of ordinary WIMPs, dark matter particles in a condensate must be lighter than a few tens of eV so that the density from thermal relics is not too large. Big-Bang nucleosynthesis constrains the temperature of decoupling to the scale of the QCD phase transition or above. This requires large dark matter-to-photon ratios and very weak interactions with standard model particles.

  19. Polyethyleneimine-coated quantum dots for miRNA delivery and its enhanced suppression in HepG2 cells

    Directory of Open Access Journals (Sweden)

    Liang G

    2016-11-01

    Full Text Available Gaofeng Liang,1 Yang Li,1 Wenpo Feng,1 Xinshuai Wang,2 Aihua Jing,1 Jinghua Li,1 Kaiwang Ma1 1Department of Biomedical Engineering, School of Medical Technology & Engineering, 2Department of Oncology, The First Affiliated Hospital, Henan University of Science & Technology, Luoyang, People’s Republic of China Abstract: Quantum dots (QDs have been intensively investigated for bioimaging, drug delivery, and labeling probes because of their unique optical properties. In this study, CdSe/ZnS QDs-based nonviral vectors with the dual functions of delivering miR-26a plasmid and bioimaging were formulated by capping the surface of CdSe/ZnS QDs with polyethyleneimine (PEI. The PEI-coated QDs were capable of condensing miR-26a expression vector into nanocomplexes that can emit strong red luminescence when loaded with CdSe/ZnS QDs. Further results showed that PEI-modified nanoparticles (NPs could transfect miR-26a plasmid into HepG2 cells in vitro. Meanwhile, imaging of living cells could be achieved based on the CdSe/ZnS QDs. Further study suggested that miR-26a transfection up-regulated miR-26a expression, induced cycle arrest, and triggered proliferation inhibition in HepG2 cells. The results indicated that PEI-coated QD NPs possess the capability of bioimaging and gene delivery and could be a promising vehicle with the engineering of QD NPs for gene therapy in the future. Keywords: miR-26a, PEI/QDs, HepG2, gene delivery, bioimaging

  20. The G2/M DNA damage checkpoint inhibits mitosis through Tyr15 phosphorylation of p34cdc2 in Aspergillus nidulans.

    Science.gov (United States)

    Ye, X S; Fincher, R R; Tang, A; Osmani, S A

    1997-01-02

    It is possible to cause G2 arrest in Aspergillus nidulans by inactivating either p34cdc2 or NIMA. We therefore investigated the negative control of these two mitosis-promoting kinases after DNA damage. DNA damage caused rapid Tyr15 phosphorylation of p34cdc2 and transient cell cycle arrest but had little effect on the activity of NIMA. Dividing cells deficient in Tyr15 phosphorylation of p34cdc2 were sensitive to both MMS and UV irradiation and entered lethal premature mitosis with damaged DNA. However, non-dividing quiescent conidiospores of the Tyr15 mutant strain were not sensitive to DNA damage. The UV and MMS sensitivity of cells unable to tyrosine phosphorylate p34cdc2 is therefore caused by defects in DNA damage checkpoint regulation over mitosis. Both the nimA5 and nimT23 temperature-sensitive mutations cause an arrest in G2 at 42 degrees C. Addition of MMS to nimT23 G2-arrested cells caused a marked delay in their entry into mitosis upon downshift to 32 degrees C and this delay was correlated with a long delay in the dephosphorylation and activation of p34cdc2. Addition of MMS to nimA5 G2-arrested cells caused inactivation of the H1 kinase activity of p34cdc2 due to an increase in its Tyr15 phosphorylation level and delayed entry into mitosis upon return to 32 degrees C. However, if Tyr15 phosphorylation of p34cdc2 was prevented then its H1 kinase activity was not inactivated upon MMS addition to nimA5 G2-arrested cells and they rapidly progressed into a lethal mitosis upon release to 32 degrees C. Thus, Tyr15 phosphorylation of p34cdc2 in G2 arrests initiation of mitosis after DNA damage in A. nidulans.

  1. Effects of PRELI in Oxidative-Stressed HepG2 Cells.

    Science.gov (United States)

    Kim, Bo Yong; Cho, Min Ho; Kim, Kyung Joo; Cho, Kyung Jin; Kim, Suhng Wook; Kim, Hyun Sook; Jung, Woon-Won; Lee, Boo Hyung; Lee, Bong Hee; Lee, Seung Gwan

    2015-01-01

    Protein of relevant evolutionary and lymphoid interest (PRELI) is known for preventing apoptosis by mediating intramitochondrial transport of phosphatidic acid. However, the role of PRELI remains unclear. This study has demonstrated functions of PRELI through PRELI-knockdown in hepatocellular carcinoma (HepG2) cells exposed to oxidative stress by hydrogen peroxide. Results show that PRELI has three functions in HepG2 cells with regard to oxidative stress. First, PRELI affects expressional regulation of SOD-1 and caspase-3 genes in HepG2 cells. PRELI knockdown HepG2 cells have shown up-regulation of caspase-3 and down-regulation of SOD-1. Second, PRELI suppresses mitochondrial apoptosis in HepG2 cells. Fluorescence intensity related to mitochondrial apoptosis in PRELI-knockdown HepG2 cells increased more than two-fold compared to normal HepG2 cells. Third, PRELI suppresses senescence of HepG2 cells with oxidative stress. PRELI knockdown HepG2 cells showed higher levels of senescence than normal HepG2 cells. These results suggest that PRELI is a crucial protein in the suppression of apoptosis in HepG2 cells in response to oxidative stress. © 2015 by the Association of Clinical Scientists, Inc.

  2. Premature Ventricular Complexes and Premature Ventricular Complex Induced Cardiomyopathy.

    Science.gov (United States)

    Latchamsetty, Rakesh; Bogun, Frank

    2015-09-01

    Presentation, prognosis, and management of premature ventricular complexes (PVCs) vary significantly among patients and depend on PVC characteristics as well as patient comorbidities. Presentation can range from incidental discovery in an asymptomatic patient to debilitating heart failure. Prognosis depends on, among other factors, the presence or absence of structural heart disease, PVC burden and other factors detailed in this review. Our understanding of the clinical significance of frequent PVCs, particularly as it relates to development of cardiomyopathy, has advanced greatly in the past decade. In this article, we explore the mechanisms governing PVC initiation and discuss prevalence and frequency of PVCs in the general population. We also explore prognostic implications based on PVC frequency as well as the presence or absence of underlying heart disease. We then take a focused look at PVC-induced cardiomyopathy and identify predictors for developing cardiomyopathy. Finally, we discuss clinical evaluation and management of patients presenting with frequent PVCs. Management can include clinical observation, addressing reversible causes, lifestyle modification, pharmacotherapy, or catheter ablation.

  3. Psychosocial interventions for premature ejaculation

    Directory of Open Access Journals (Sweden)

    Tamara Melnik

    Full Text Available BACKGROUND: Premature ejaculation (PE is a very common sexual dysfunction among patients, and with varying prevalence estimates ranging from 3% to 20%. Although psychological issues are present in most patients with premature PE, as a cause or as a consequence, research on the effects of psychological approaches for PE has in general not been controlled or randomised and is lacking in long-term follow up. OBJECTIVE: To assess the efficacy of psychosocial interventions for PE. CRITERIA FOR CONSIDERING STUDIES FOR THIS REVIEW: Trials were searched in computerized general and specialized databases, such as: MEDLINE by PubMed (1966 to 2010; PsycINFO (1974 to 2010; EMBASE (1980 to 2010; LILACS (1982 to 2010; the Cochrane Central Register of Controlled Trials (Cochrane Library, 2010; and by checking bibliographies, and contacting manufacturers and researchers. SELECTION CRITERIA: Randomised or quasi-randomised controlled trials evaluating psychosocial interventions compared with different psychosocial interventions, pharmacological interventions, waiting list, or no treatment for PE. DATA COLLECTION AND ANALYSIS: Information on patients, interventions, and outcomes was extracted by at least two independent reviewers using a standard form. The primary outcome measure for comparing the effects of psychosocial interventions to waiting list and standard medications was improvement in IELT (i.e., time from vaginal penetration to ejaculation. The secondary outcome was change in validated PE questionnaires. MAIN RESULTS: In one study behavioral therapy (BT was significantly better than waiting list for duration of intercourse (MD (mean difference 407.90 seconds, 95% CI 302.42 to 513.38, and couples' sexual satisfaction (MD -26.10, CI -50.48 to -1.72. BT was also significantly better for a new functional-sexological treatment (FS (MD 412.00 seconds, 95% CI 305.88 to 518.12, change over time in subjective perception of duration of intercourse (Women: MD 2

  4. [Observation of radiobiological characteristics in a HepG2 cell line with mitochondrial DNA deletion].

    Science.gov (United States)

    Sun, Hengwen; Pan, Yi; Zeng, Zijun; Fang, Liangyi; Zhang, Hongdan; Xie, Songxi; Li, Weixiong; Xu, Jiabin

    2015-06-01

    To study the radiobiological characteristics of a HepG2 cell line with mitochondrial DNA (mtDNA) deletion. HepG2 cells were cultured in a medium containing ethidium bromide, acetylformic acid and uracil. The HepG2 cell line with mtDNA deletion (ρ(0)HepG2 cells) were acquired after 30 subcultures by limited dilution cloning. The cell survival was then observed in the absence of acetylformic acid and uracil, and the total mtDNA deletion in the cells was confirmed by PCR. The radiosensitivity of HepG2 and ρ(0)HepG2 cells was evaluated by exposure to gradient doses of 6 MV X ray irradiation. The cell apoptosis was assessed following a 2 Gy X-ray exposure with Hochest33342 staining, and the invasiveness of ρ(0)HepG2 cells was measured by Transwell assay. HepG2 cells could survive 30 subcultures in the presence of ethidium bromide, and massive cell death occurred after removal of acetylformic acid and uracil from the medium. PCR confirmed total mtDNA deletion from ρ(0)HepG2 cells, whose α/β value was significantly lower than that of HepG2 cells. ρ(0)Hep-G2 cells showed an obviously lowered cell apoptosis rate following X-ray exposure with enhanced cell invasiveness. HepG2 cells can be induced by ethidium bromide into ρ(0)HepG2 cells with an increased radiation resistance, anti-apoptosis ability and cell invasiveness.

  5. Condensed Matter Nuclear Science

    Science.gov (United States)

    Biberian, Jean-Paul

    2006-02-01

    1. General. A tribute to gene Mallove - the "Genie" reactor / K. Wallace and R. Stringham. An update of LENR for ICCF-11 (short course, 10/31/04) / E. Storms. New physical effects in metal deuterides / P. L. Hagelstein ... [et al.]. Reproducibility, controllability, and optimization of LENR experiments / D. J. Nagel -- 2. Experiments. Electrochemistry. Evidence of electromagnetic radiation from Ni-H systems / S. Focardi ... [et al.]. Superwave reality / I. Dardik. Excess heat in electrolysis experiments at energetics technologies / I. Dardik ... [et al.]. "Excess heat" during electrolysis in platinum/K[symbol]CO[symbol]/nickel light water system / J. Tian ... [et al.]. Innovative procedure for the, in situ, measurement of the resistive thermal coefficient of H(D)/Pd during electrolysis; cross-comparison of new elements detected in the Th-Hg-Pd-D(H) electrolytic cells / F. Celani ... [et al.]. Emergence of a high-temperature superconductivity in hydrogen cycled Pd compounds as an evidence for superstoihiometric H/D sites / A. Lipson ... [et al.]. Plasma electrolysis. Calorimetry of energy-efficient glow discharge - apparatus design and calibration / T. B. Benson and T. O. Passell. Generation of heat and products during plasma electrolysis / T. Mizuno ... [et al.]. Glow discharge. Excess heat production in Pd/D during periodic pulse discharge current in various conditions / A. B. Karabut. Beam experiments. Accelerator experiments and theoretical models for the electron screening effect in metallic environments / A. Huke, K. Czerski, and P. Heide. Evidence for a target-material dependence of the neutron-proton branching ratio in d+d reactions for deuteron energies below 20keV / A. Huke ... [et al.]. Experiments on condensed matter nuclear events in Kobe University / T. Minari ... [et al.]. Electron screening constraints for the cold fusion / K. Czerski, P. Heide, and A. Huke. Cavitation. Low mass 1.6 MHz sonofusion reactor / R. Stringham. Particle detection. Research

  6. Convective condensation heat transfer in a horizontal condenser tube

    Energy Technology Data Exchange (ETDEWEB)

    Sarma, P.K. [College of Engineering, GITAM, Visakhapatnam (India); Sastry, C.V.N.; Rao, V.D. [Andhra Univ., College of Engineering, Visakhapatnam (India); Kakac, S.; Liu, H. [Miami Univ., College of Engineering, FL (United States)

    2002-03-01

    The purpose of this article is to solve analytically the problem of convective condensation of vapors inside a horizontal condenser tube. Homogeneous model approach is employed in the estimation of shear velocity, which is subsequently, made use of in predicting local convective condensation heat transfer coefficients. The resulting analysis of the present study is compared with some of the available equations in the literature. It is observed that the agreement is reasonably satisfactory validating the assumptions and the theory presented. (authors)

  7. Superfluidity in polariton condensates

    Energy Technology Data Exchange (ETDEWEB)

    Amo, A; Lefrere, J; Adrados, C; Giacobino, E; Bramati, A [Laboratoire Kastler Brossel, UPMC, ENS and CNRS, 75005 Paris (France); Sanvitto, D; Laussy, F P; Ballarini, D; Valle, E del; MartIn, M D; Tejedor, C; Vina, L [SEMICUAM, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Pigeon, S; Ciuti, C [Laboratoire Materiaux et Phenomenes Quantiques, UMR 7162, Universite Paris Diderot-Paris 7 and CNRS, 75013 Paris (France); Carusotto, I [BEC-CNR-INFM and Dip. di Fisica, Universita di Trento, I-38050 Povo (Italy); Houdre, R [Institut de Photonique et d' Electronique Quantique, Ecole Polytechnique Federale de Lausanne, Station 3, CH-1015 Lausanne (Switzerland); LemaItre, A; Bloch, J [Laboratoire de Photonique et de Nanostructures, CNRS, Route de Nozay, 91460 Marcoussis (France); Krizhanovskii, D N; Skolnick, M S, E-mail: alberto.amo@spectro.jussieu.f [Department of Physics and Astronomy, University of Sheffield, S3 7RH, Sheffield (United Kingdom)

    2010-02-01

    Exciton-polaritons, two-dimensional composite bosons arising from the quantum mixture of excitons and photons, can manifest many-body quantum effects at liquid He temperatures (4 K). Interestingly, polaritons are predicted to behave as particular quantum fluids due to their out of equilibrium character, arising from their reduced lifetime (shorter than their thermalization time). Here we report the observation of superfluid motion of polaritons in semiconductor microcavities both under cw and pulsed excitation. Among other signatures, superfluidity is manifested via the absence of scattering of the polariton condensates when encountering a localized defect in their flow path.

  8. Nanocarbon condensation in detonation

    Science.gov (United States)

    Bastea, Sorin

    2017-01-01

    We analyze the definition of the Gibbs free energy of a nanoparticle in a reactive fluid environment, and propose an approach for predicting the size of carbon nanoparticles produced by the detonation of carbon-rich explosives that regards their condensation as a nucleation process and takes into account absolute entropy effects of the cluster population. The results are consistent with experimental observations and indicate that such entropy considerations are important for determining chemical equilibrium states in energetic materials that contain an excess of carbon. The analysis may be useful for other applications that deal with the nucleation of nanoparticles under reactive conditions. PMID:28176827

  9. Galaxies as condensates

    CERN Document Server

    Bugg, D V

    2012-01-01

    A novel interpretation of MOND is presented. For galactic data, in addition to Newtonian acceleration, there is an attractive acceleration peaking at Milgrom's parameter a_0. The peak lies within experimental error where a_0 = cH_0/2\\pi and H_0 is the present-time value of the Hubble constant. This peaking may be understood in terms of quantum mechanical mixing between Newtonian gravitation and the Hubble mechanism. There are five pointers towards galaxies being Fermi-Dirac condensates.

  10. Confinement Contains Condensates

    Energy Technology Data Exchange (ETDEWEB)

    Brodsky, Stanley J.; Roberts, Craig D.; Shrock, Robert; Tandy, Peter C.

    2012-03-12

    Dynamical chiral symmetry breaking and its connection to the generation of hadron masses has historically been viewed as a vacuum phenomenon. We argue that confinement makes such a position untenable. If quark-hadron duality is a reality in QCD, then condensates, those quantities that have commonly been viewed as constant empirical mass-scales that fill all spacetime, are instead wholly contained within hadrons; i.e., they are a property of hadrons themselves and expressed, e.g., in their Bethe-Salpeter or light-front wave functions. We explain that this paradigm is consistent with empirical evidence, and incidentally expose misconceptions in a recent Comment.

  11. Sexuality in pregnancy and premature labour.

    Science.gov (United States)

    Georgakopoulos, P A; Dodos, D; Mechleris, D

    1984-09-01

    The relation of sexual behaviour during pregnancy to the initiation of labour was investigated in 358 patients of whom 58 were delivered after premature labour and 300 were delivered spontaneously at term. In all patients the mean weekly coital frequency and the frequency of orgasm were investigated by means of a retrospective questionnaire. There was no significant difference in coital or orgasmic frequency between the women who had a premature labour and those who had a spontaneous delivery at term. This was also true when those having premature labour were divided into those starting labour with ruptured membranes and those starting with contractions.

  12. Acute appendicitis in a premature baby

    Energy Technology Data Exchange (ETDEWEB)

    Beluffi, Giampiero; Alberici, Elisa [Department of Radiodiagnosis, Section of Paediatric Radiology, IRCCS Policlinico S. Matteo, Piazzale Golgi 2, 27100 Pavia PV (Italy)

    2002-07-01

    A case of acute appendicitis in a premature baby in whom diagnosis was suggested on plain films of the abdomen is presented. In this baby air in a hollow viscus suspected of being an enlarged appendix was the clue to diagnosis. The diagnostic dilemma of this rare and life-threatening condition in premature babies and newborns is underlined. The relevance of different imaging modalities and of different findings in this age group is discussed. Awareness of this rare condition and possible differential diagnosis in newborns and premature babies is stressed. (orig.)

  13. [Premature newborn: a case presentation].

    Science.gov (United States)

    Pastor Rodríguez, Jesús David; Pastor Bravo, María Del Mar; López García, Visitación; Cotes Teruel, María Isabel; Mellado, Jesús Eulogio; Cárceles, José Jara

    2010-01-01

    A case is presented of a premature newborn of 27 weeks gestation and weighing 420 grams who was delivered as a result of a maternal pre-eclampsia and retarded intra-uterine growth. During the 125 days of hospitalisation, an individual care plan based on the Virginia Henderson model was devised and applied to both the child and her parents using NANDA diagnostics, interventions according to the NIC classification, and the expected results according to the NOC classification. The Marjory Gordon functional patterns were used for the initial assessment. By applying the pre-term newborn (PTNB) plan, all their needs were provided and were modified throughout the hospital stay, with new needs that were added to the established ones. These required a continuous assessment with the subsequent adapting of the care plan. Likewise, the care required by the parents varied from the initial grief due to the possible loss of their child to learning the alarm signs and the home care that their child would need. The child was finally discharged weighing 2900 grams and with normal neurological and psychomotor development, although with a lower weight appropriate to her age. Currently, at 2 years old, the child has a normal neurological and psychomotor development, but with weight and size lower than the P(3) percentile. She requires speech therapy treatment due to paralysis of the right vocal cord.

  14. Psychosexual therapy for premature ejaculation.

    Science.gov (United States)

    Althof, Stanley E

    2016-08-01

    Premature ejaculation (PE) is a male sexual dysfunction that creates considerable anguish for the man, his partner and their relationship. PE is not one disorder but includes the four subtypes (lifelong, acquired, natural and subjective) each with unique psychological concerns and issues. Psychological treatment for men and couples with PE addresses sexual skills/techniques but also focuses on issues of self-esteem, performance anxiety and interpersonal conflict. The outcome studies for psychotherapy alone are difficult to interpret and compare because of poor methodological design (lack of control groups, small sample size, poor outcome measures and lack of follow-up). However, the few studies that surmount these methodological hurdles suggest that psychological intervention offers men and couples a promising treatment option. Combination pharmaco- and psychotherapy is the most promising intervention for lifelong and acquired PE and offers superior efficacy to drug alone. This is because men and couples learn sexual skills, address the intrapsychic, interpersonal and cognitive issues that precipitate and maintain the dysfunction.

  15. The epidemiology of premature ejaculation.

    Science.gov (United States)

    Saitz, Theodore Robert; Serefoglu, Ege Can

    2016-08-01

    Vast advances have occurred over the past decade with regards to understanding the epidemiology, pathophysiology and management of premature ejaculation (PE); however, we still have much to learn about this common sexual problem. As a standardized evidence-based definition of PE has only recently been established, the reported prevalence rates of PE prior to this definition have been difficult to interpret. As a result, a large range of conflicting prevalence rates have been reported. In addition to the lack of a standardized definition and operational criteria, the method of recruitment for study participation and method of data collection have obviously contributed to the broad range of reported prevalence rates. The new criteria and classification of PE will allow for continued research into the diverse phenomenology, etiology and pathogenesis of the disease to be conducted. While the absolute pathophysiology and true prevalence of PE remains unclear, developing a better understanding of the true prevalence of the disease will allow for the completion of more accurate analysis and treatment of the disease.

  16. [Sexological intervention on premature ejaculation].

    Science.gov (United States)

    San Martín Blanco, C

    2014-07-01

    Strategies, recommendations and techniques proposed by sex therapy for intervention on premature ejaculation, have represented for nearly four decades the most effective model of intervention in this sexual dysfunction, which currently is complemented by the efficacy of dapoxetine drug treatment. Clinical experience and recent studies support that combined intervention offers the best therapeutic results. In addition in sex therapy, etiologic diagnosis is obtained from the analysis of the interrelationship of the couple. Diagnostic and therapeutic intervention has to be always centered in the relationship, so the techniques and resources must be applied with the expectation of being implemented in the sexual interaction. It will therefore be the relationship that receive treatment, even if medication is used for one of the members of the couple. On the other hand, this model of intervention can be implemented by a professional with training, although not necessarily a specialist. Copyright © 2014 Elsevier España, S.L.U. y Sociedad Española de Medicina Rural y Generalista (SEMERGEN). All rights reserved.

  17. Medical therapy for premature ejaculation

    Science.gov (United States)

    Mohee, Amar; Eardley, Ian

    2011-01-01

    Premature ejaculation (PE) is a common male sexual dysfunction. Advances in PE research have been hampered owing to a nonstandardized definition of PE, until the definition by the International Society of Sexual Medicine (ISSM) in 2009. Once the diagnosis of PE is established through a thorough history, a variety of medical therapies is available, including tricyclic antidepressants, selective serotonin reuptake inhibitors (SSRIs), centrally acting opiates, phosphodiesterase 5 inhibitors and topical desensitizing creams. Most of these treatments increase the intravaginal ejaculation latency time (IELT) and patient satisfaction scores, with the most convincing evidence for SSRIs and topical creams. Daily SSRIs such as paroxetine, although efficacious, do have a substantial and prolonged side effect profile. Dapoxetine, which is a on-demand SSRI, is the only licensed drug for the treatment of PE, increasing IELT by a factor of 2.5 to 3 with limited and tolerable side effects. In the near future, the topical aerosol PSD502 is due to be licensed for the treatment of PE, increasing IELT by up to a factor of 6 but having minimal local and negligible systemic side effects. PMID:22046199

  18. Sodium cantharidinate induces HepG2 cell apoptosis through LC3 autophagy pathway.

    Science.gov (United States)

    Tao, Ran; Sun, Wen-Yi; Yu, De-Hai; Qiu, Wei; Yan, Wei-Qun; Ding, Yan-Hua; Wang, Guang-Yi; Li, Hai-Jun

    2017-08-01

    The function of sodium cantharidinate on inducing hepatocellular carcinoma cell apoptosis was investigated for the first time. Sodium cantharidinate inhibits HepG2 cell growth mainly by LC3 autophagy pathway. MTT results show that sodium cantharidinate effectively inhibits the proliferation of HepG2 cells in a dose- and time-dependent manner and induce cell apoptosis by caspase-3 activity. The further western blotting and FACS detection show that sodium cantharidinate initiates HepG2 cell autophagy program by LC3 pathway. Autophagy-specific inhibitor 3-MA reduce sodium cantharidinate-induced caspase-3 activity and HepG2 cell apoptosis. Silence of the LC3 gene in HepG2 cell lines also reduce sodium cantharidinate-induced cell apoptosis. Collectively, our data indicate that sodium cantharidinate induces HepG2 cell apoptosis through LC3 autophagy pathway. Sodium cantharidinate has potential for development as a new drug for treatment of human HCC.

  19. Regulation of the mRNA levels of nimA, a gene required for the G2-M transition in Aspergillus nidulans

    OpenAIRE

    1987-01-01

    The temperature-sensitive cell cycle mutation nimA5 causes nuclei of Aspergillus nidulans to be blocked in late G2 at restrictive temperature. Under these conditions the spindle pole body divides but does not separate and the mitotic index drops to zero. If nimA5 is blocked for more than one doubling time and then shifted from restrictive to permissive temperature, nuclei immediately enter mitosis, the mitotic spindle forms, and the chromosomes condense (Oakley, B. R., and N. R. Morris, 1983,...

  20. Topology and Fermionic Condensate

    Science.gov (United States)

    Kulikov, I.; Pronin, P.

    The purpose of this paper is to investigate an influence of a space-time topology on the formation of fermionic condensate in the model with four-fermion interaction ()2. The value for the space-time with topology of R1 × R1 × S1 is found. Moreover a relation of the value of fermionic condensate to a periodic length is studied. In this connection the possibility of a relation of the topologic deposits to structure of hadrons is discussed.Translated AbstractTopologie und FermikondensatEs wird der Einfluß einer Raum-Zeittopologie auf die Bildung des Fermikondensats in einem Modell mit Vierfermionenwechselwirkung ()2 untersucht. Für eine Raum-Zeit mit der Topologie R1 × R2 × S1 werden die Parameter gegeben. Weiterhin wird die Relation der Größe des Fermikondensats zu einer periodischen Länge untersucht. In diesem Zusammenhang wird die Verbindung des topologischen Depots zur Struktur der Hadronen diskutiert.

  1. Study on preliminary mechanism of apoptosis in HepG-2 by CSA

    Institute of Scientific and Technical Information of China (English)

    YU Lei; MU Ke; WANG Wei; CUI Rong-tian; JI Yu-bin; ZOU Xiang

    2008-01-01

    t Objective To study on the mechanism of killing and apoptosis inducing effect of total alkaloid in the CSA(Capparis spinosa L. alkaloid, CSA)on human hepatoearcinoma cell Line HepG-2. Methods The killing effect of the CSA on human hepatoeareinoma cell Line HepG-2 was measured by MTT method. Morphological observation of the HepG-2 cells was completed by fluorescence microscope. The apoptosis indueing effect and changing of mitoehondria membrane potential of the CSA on the HepG-2 cells were measured by flow cytometry. In addition, effect of intraeellular Ca2+ level of the CSA on the HepG-2 cells was studied by laser confocal microscope. Results The CSA has obvious cytotoxicity on the HepG-2 and seems to be dose-dependent, and its IC50 value is 162.4 μg·mL-1. The HepG-2 cells have characteristic morphologic changes of apoptosis by the function of CSA, and the apoptosis percentage is higher than the natural one. The progress of cells cycle from S phase to G2 phase has been blocked, and the mitochondria membrane potential is markedly decreased, and the intraecllular Ca2+ level is increased by the function of CSA. Conclusions The CSA has obviously killing and apoptosis inducing effect on human hepatoearcinoma cell Line HepG-2 by the mechanism of decreasing the mitoehondria membrane potential and increasing the intracellular Ca2+ level.

  2. Polariton condensates put in motion

    Energy Technology Data Exchange (ETDEWEB)

    Sanvitto, D; Amo, A; Vina, L [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, E-28049, Madrid (Spain); Laussy, F P; Tejedor, C [Departamento de Fisica Teorica de la Materia Condensada, Universidad Autonoma de Madrid, E-28049, Madrid (Spain); LemaItre, A; Bloch, J, E-mail: daniele.sanvitto@uam.es [LPN/CNRS, Route de Nozay, F-91460, Marcoussis (France)

    2010-04-02

    We present several examples of the interesting phenomenology shown by a moving polariton condensate in semiconductor microcavities. The superfluid behavior is probed by colliding the polariton condensate against physical obstacles in the form of natural defects of the sample, demonstrating a clear suppression of scattering when the speed of the flow lies below the critical velocity. At higher velocities Cerenkov-like shock waves around the defect and disruption of the condensate are also observed.

  3. Quantitative assessment of DNA condensation.

    Science.gov (United States)

    Trubetskoy, V S; Slattum, P M; Hagstrom, J E; Wolff, J A; Budker, V G

    1999-02-15

    A fluorescent method is proposed for assessing DNA condensation in aqueous solutions with variety of condensing agents. The technique is based on the effect of concentration-dependent self-quenching of covalently bound fluorophores upon DNA collapse. The method allows a more precise determination of charge equivalency in titration experiments with various polycations. The technique's ability to determine the number of DNA molecules that are condensed together in close proximity is under further investigation.

  4. Maternal assessment of pain in premature infants

    Directory of Open Access Journals (Sweden)

    Maria Carolina Correia dos Santos

    2015-12-01

    Full Text Available Objective: to identify mothers' perceptions about the pain in their premature babies in the Neonatal Intensive Care Unit. Methods: evaluative, quantitative study with investigative nature conducted with 19 mothers of hospitalized premature newborns. Data were obtained from closed questions, answered by mothers. Results: from the participants, two (10.5% reported that newborns are unable to feel pain. From the 17 mothers who said that premature babies can feel pain, the majority (94.1% identified crying as a characteristic of pain sensation. Eleven (64.7% stated that uneasiness is a sign of pain in newborns. Conclusion: for the proper management of neonatal pain it is essential that mothers know the signs of pain in premature newborns, and that health professionals instruct this recognition, through the enhancement of the maternal presence and practice of effective communication between professionals and newborns’ families.

  5. Future Applications of Antioxidants in Premature Infants

    Science.gov (United States)

    Lee, Jennifer W.; Davis, Jonathan M.

    2012-01-01

    Purpose of Review This review will examine the unique susceptibility of premature infants to oxidative stress, the role of reactive oxygen species (ROS) in the pathogenesis of common disorders of the preterm infant, and potential for therapeutic interventions using enzymatic and/or non-enzymatic antioxidants. Recent Findings Oxidative stress is caused by an imbalance between the production of ROS and the ability to detoxify them with the help of antioxidants. The premature infant is especially susceptible to ROS-induced damage because of inadequate antioxidant stores at birth, as well as impaired upregulation in response to oxidant stress. Thus, the premature infant is at increased risk for the development of ROS-induced diseases of the newborn, such as bronchopulmonary dysplasia, retinopathy of prematurity, necrotizing enterocolitis, and periventricular leukomalacia. Summary Potential therapies for ROS-induced disease include both enzymatic and non-enzymatic antioxidant preparations. More research is required to determine the beneficial effects of supplemental antioxidant therapy. PMID:21150443

  6. Apnea of prematurity: challenges and solutions

    Directory of Open Access Journals (Sweden)

    Picone S

    2014-06-01

    Full Text Available Simonetta Picone, Roberto Aufieri, Piermichele PaolilloDivision of Neonatology and Neonatal Intensive Care, Department of Maternal and Child Health, Casilino General Hospital, Rome, ItalyAbstract: Apnea of prematurity is a developmental disorder that frequently affects preterm infants, especially those with lower gestational age. Even if apnea of prematurity is by definition a self-limiting condition, it can cause serious problems during the hospital stay and can potentially have long-term neurological and cognitive consequences depending on the severity and intensity of the episodes. The diagnosis of apnea of prematurity can be made only after excluding a number of diseases of the preterm infant in which apnea may be an epiphenomenon. Etiological diagnosis is essential for selection of appropriate treatment, which may be nonpharmacological or involve use of drugs.Keywords: apnea of prematurity, idiopathic and secondary apnea, caffeine

  7. Effect of Rb on Proliferation of HepG2 Cell Line%Rb对HepG2肝癌细胞系增殖的影响

    Institute of Scientific and Technical Information of China (English)

    刘清源; 施学忠; 李来生; 孙斌

    2006-01-01

    目的 研究Rb基因及其产物对HepG2肝癌细胞系增殖的影响.方法 转染pRb质粒进入HepG2肝癌细胞系,用MTT法检测转染前后细胞增殖的变化,并将转染pRb质粒的HepG2肝癌细胞接种在裸鼠皮下建立肝癌裸鼠种植瘤模型,观察转染pRb质粒前后裸鼠体内种植瘤生长的变化.结果 转染pRb质粒的HepG2肝癌细胞与未转染pRb质粒者相比细胞增殖受到抑制.成功建立HepG2肝癌细胞裸鼠体内种植瘤模型,转染pRb质粒的HepG2肝癌细胞的裸鼠体内种植瘤生长受抑制.转染组种植瘤体积第4周(429.7±114.987)mm3,第5周(657.90±187.27)mm3,第6周(892.56±258.73)mm3.结论 Rb在体内和体外均能抑制肝癌细胞的增殖.

  8. Premature dental eruption: report of case.

    LENUS (Irish Health Repository)

    McNamara, C M

    2011-08-05

    This case report reviews the variability of dental eruption and the possible sequelae. Dental eruption of the permanent teeth in cleft palate children may be variable, with delayed eruption the most common phenomenon. A case of premature dental eruption of a maxillary left first premolar is demonstrated, however, in a five-year-old male. This localized premature dental eruption anomaly was attributed to early extraction of the primary dentition, due to caries.

  9. Neuro-ophthalmic manifestations of prematurity

    OpenAIRE

    Preeti Patil Chhablani; Ramesh Kekunnaya

    2014-01-01

    Increasing rates of preterm births coupled with better survival of these infants have resulted in higher prevalence of systemic and ocular complications associated with prematurity. In addition to retinopathy of prematurity, infants who are born preterm may suffer from severe visual impairment as a result of hypoxic ischemic encephalopathy, hypoglycemia, and other metabolic imbalances. The effect of these processes on the anterior visual pathway may result in optic atrophy, optic nerve hypopl...

  10. PECULIARITIES OF BREAST FEEDING OF PREMATURE CHILDREN

    Directory of Open Access Journals (Sweden)

    V.К. Kotlukov

    2011-01-01

    Full Text Available The article presents main strategies of breast feeding of prematurely born infants support, such as use of Philips AVENT breast pumpfor lactation formation and feeding of the infant with native breast milk.Key words: premature infants, nursing mother, breast feeding support, modern accessories for breast feeding support. (Voprosy sovremennoi pediatrii — Current Pediatrics. 2011; 10 (6: 170–175

  11. The pathophysiology of acquired premature ejaculation

    OpenAIRE

    McMahon, Chris G; Jannini, Emmanuele A.; Serefoglu, Ege C.; Hellstrom, Wayne J.G.

    2016-01-01

    The second Ad Hoc International Society for Sexual Medicine (ISSM) Committee for the Definition of Premature Ejaculation defined acquired premature ejaculation (PE) as a male sexual dysfunction characterized by a the development of a clinically significant and bothersome reduction in ejaculation latency time in men with previous normal ejaculatory experiences, often to about 3 minutes or less, the inability to delay ejaculation on all or nearly all vaginal penetrations, and the presence of ne...

  12. Apoptosis and its pathway in X gene-transfected HepG2 cells

    Institute of Scientific and Technical Information of China (English)

    Na Lin; Hong-Ying Chen; Dan Li; Sheng-Jun Zhang; Zhi-Xin Cheng; Xiao-Zhong Wang

    2005-01-01

    AIM: To investigate the effect of hepatitis B virus (HBV) X gene on apoptosis and expressions of apoptosis factors in X gene-transfected HepG2 cells.METHODS: The HBV X gene eukaryon expression vector pcDNVA3-Xwas transiently transfected into HepG2 cells by lipid-media transfection. Untransfected HepG2 and HepG2 transfected with pcDNA3 were used as controls. Expression of HBx in HepG2 was identified by PT-PCR. MTT and TUNEL were employed to measure proliferation and apoptosis of cells in.three groups. Semi-quantified RT-PCR was used to evaluate the expression levels of Fas/FasL, Bax/Bcl-xL,and c-myc in each group.RESULTS: HBV X gene was transfected into HepG2 cells successfully. RT-PCR showed that HBx was only expressed in HepG2/pcDNA3-X cells, but not expressed in HepG2 and HepG2/pcDNA3 cells. Analyzed by MTT, cell proliferation capacity was obviously lower in HepG2/pcDNA3-X cells (0.08910±0.003164) than in HepG2 (0.14410±0.004927)and HepG2/pcDNA3 cells (0.12150±0.007159) (P<0.05and P<0.01). Analyzed by TUNEL, cell apoptosis was much more in HepG2/pcDNA3-X cells (980/2 000) than HepG2 (420/2 000), HepG2/pcDNA3 cells (520/2 000) (P<0.05 and P<0.01). Evaluated by semi-quantified RT-PCR, the expression level of Fas/FasL was significantly higher in HepG2 cells transfected with HBx than in HepG2 and HepG2/pcDNA3 cells (P<0.05 and P<0.01). Bax/Bcl-xL expression level was also elevated in HepG2/pcDNA3-X cells (P<0.05and P<0.01). Expression of c-myc was markedly higher in HepG2/pcDNA3-X cells than in HepG2 and HepG2/pcDNA3 cells (P<0.05 and P<0.01).CONCLUSION: HBV X gene can impair cell proliferation capacity, improve cell apoptosis, and upregulate expression of apoptosis factors. The intervention of HBV X gene on the expression of apoptosis factors may be a possible mechanism responsible for the change in cell apoptosis and proliferation.

  13. Analysis of the G2/M Checkpoint in fanconi anemia cells via examinating chromosomal instability during G2-phase and mitosis

    OpenAIRE

    Sauer, Rica

    2013-01-01

    Fanconi anemia is a genetical and phenotypical heterogenous disease, characterized through loss of one of the 15 identified genes of the Fanconi anemia pathway what causes congenital anomalies, bone marrow failure and solid tumors. In this work the G2/M checkpoint is analysed by use of the phosphatase inhibitor Calyculin A to examine the chromosomal instability, which is typical for fanconi anemia cells, not only in mitoses but also in the G2 phase of the cell cycle. It is proved that the che...

  14. 电子政务环境下的G2C模式分析%Mode Analysis of G2C on the E-government

    Institute of Scientific and Technical Information of China (English)

    邹凯; 罗卫; 何岸

    2005-01-01

    认为当前的国内外环境为我国开展电子政务打下了坚实基础,介绍政府对公民电子服务(government to citizen,G2C)模式的内涵.对G2C模式的成本效益、技术支持、战略构架和发展的制约因素进行分析,并就如何推进我国电子政务建设提出相应策略.

  15. Induction of apoptosis in HepG2 cells by polysaccharide MEP-II from the fermentation broth of Morchella esculenta.

    Science.gov (United States)

    Hu, Meili; Chen, Yan; Wang, Cui; Cui, Huali; Duan, Peilu; Zhai, Tianlong; Yang, Yuling; Li, Shaofei

    2013-01-01

    A novel polysaccharide, MEP-II, isolated from the fermentation broth of Morchella esculenta inhibited the proliferation of human hepatoma cell line (HepG2) through an apoptotic pathway. After HepG2 cells were treated with 150-600 μg MEP-II/ml, typical apoptotic characteristics including externalization of phosphatidylserine residues on the cell surface, nuclear fragmentation, chromatin condensation and cytoplasm shrinkage were observed. Furthermore, reactive oxygen species (ROS) burst and the collapse of mitochondrial membrane potential (Δψm) also occurred in HepG2 cells after incubation of 150-600 μg MEP-II/ml. The antioxidant, 1 mM N-acetyl-L-cysteine inhibited MEP-II-induced apoptosis, suggesting that ROS are the key mediators for MEP-II-induced apoptosis. MEP-II is therefore a potential anti-tumor agent that induces apoptosis of HepG2 cells through ROS generation.

  16. Two zebrafish G2A homologs activate multiple intracellular signaling pathways in acidic environment

    Energy Technology Data Exchange (ETDEWEB)

    Ichijo, Yuta; Mochimaru, Yuta [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan); Azuma, Morio [Laboratory of Regulatory Biology, Graduate School of Science and Engineering, University of Toyama, 3190-Gofuku, Toyama 930-8555 (Japan); Satou, Kazuhiro; Negishi, Jun [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan); Nakakura, Takashi [Department of Anatomy, Graduate School of Medicine, Teikyo University, 2-11-1 Itabashi-Ku, Tokyo 173-8605 (Japan); Oshima, Natsuki [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan); Mogi, Chihiro; Sato, Koichi [Laboratory of Signal Transduction, Institute for Molecular and Cellular Regulation, Gunma University, Maebashi 371-8512 (Japan); Matsuda, Kouhei [Laboratory of Regulatory Biology, Graduate School of Science and Engineering, University of Toyama, 3190-Gofuku, Toyama 930-8555 (Japan); Okajima, Fumikazu [Laboratory of Signal Transduction, Institute for Molecular and Cellular Regulation, Gunma University, Maebashi 371-8512 (Japan); Tomura, Hideaki, E-mail: tomurah@meiji.ac.jp [Laboratory of Cell Signaling Regulation, Department of Life Sciences, School of Agriculture, Meiji University, Kawasaki 214-8571 (Japan)

    2016-01-01

    Human G2A is activated by various stimuli such as lysophosphatidylcholine (LPC), 9-hydroxyoctadecadienoic acid (9-HODE), and protons. The receptor is coupled to multiple intracellular signaling pathways, including the G{sub s}-protein/cAMP/CRE, G{sub 12/13}-protein/Rho/SRE, and G{sub q}-protein/phospholipase C/NFAT pathways. In the present study, we examined whether zebrafish G2A homologs (zG2A-a and zG2A-b) could respond to these stimuli and activate multiple intracellular signaling pathways. We also examined whether histidine residue and basic amino acid residue in the N-terminus of the homologs also play roles similar to those played by human G2A residues if the homologs sense protons. We found that the zG2A-a showed the high CRE, SRE, and NFAT activities, however, zG2A-b showed only the high SRE activity under a pH of 8.0. Extracellular acidification from pH 7.4 to 6.3 ameliorated these activities in zG2A-a-expressing cells. On the other hand, acidification ameliorated the SRE activity but not the CRE and NFAT activities in zG2A-b-expressing cells. LPC or 9-HODE did not modify any activity of either homolog. The substitution of histidine residue at the 174{sup th} position from the N-terminus of zG2A-a to asparagine residue attenuated proton-induced CRE and NFAT activities but not SRE activity. The substitution of arginine residue at the 32nd position from the N-terminus of zG2A-a to the alanine residue also attenuated its high and the proton-induced CRE and NFAT activities. On the contrary, the substitution did not attenuate SRE activity. The substitution of the arginine residue at the 10th position from the N-terminus of zG2A-b to the alanine residue also did not attenuate its high or the proton-induced SRE activity. These results indicate that zebrafish G2A homologs were activated by protons but not by LPC and 9-HODE, and the activation mechanisms of the homologs were similar to those of human G2A. - Highlights: • Zebrafish two G2A homologs are proton

  17. Low dose actinomycin treatment induces HepG2 cell cycle G2 arrest%低浓度放线菌素D诱导HepG2细胞周期G2阻滞的分子机制研究

    Institute of Scientific and Technical Information of China (English)

    肖建勇; 刘相富; 云径平

    2012-01-01

    Objective; To explore the mechanism of HepG2 cell cycle G2 arrest caused by Actinomycin D treatment. Method: HepG2 cell treated with low dose Actinomycin D for different time durations was analyzed by Flow cytometry. The translocation of Nucleophosmin (NPM) /B23 after low dose Actinomycin D treatment wasobserved by immunofluorescence. The expression changes of B23, P53 and P21 with or without Actinomycin D treatment were detected by western blotting. Result; Low dose Actinomycin D inhibited HepG2 cell growth, and caused cell cycle G2 arrest When exposed to Actinomycin D, NPM translocated from nucleolus to plasma but its expression level showed no remarkable change . Actinomycin D treatment resulted in the upregulations of P53 and P21. Conclusion; Low dose Actinomycin D treatment caused HepG2 cell cycle G2 arrest whose underlying mechanism might relate to the translocation of NPM and upregulation of P53 and P21.%目的:探讨低浓度放线菌素D处理导致HepG2细胞周期G2阻滞的分子机制.方法:应用低浓度放线菌素D处理HepG2细胞不同时间,然后应用流式细胞仪检测HepG2生长周期变化;免疫荧光观察核磷蛋白B23(NPM)定位的变化;免疫印迹法检测NPM及其细胞周期相关蛋白P53和P21表达水平.结果:低浓度放线菌素D能够抑制HepG2细胞生长并使细胞周期阻滞于G2期;在放线菌素D作用下,NPM蛋白表达水平没有明显改变,但出现定位改变,即从核仁移位到核浆;放线菌素D处理引起P53和P21蛋白表达水平上调.结论:低浓度放线菌素D作用HepG2细胞导致细胞周期G2阻滞,其机制可能与NPM移位促使其相互作用靶蛋白P53和P21蛋白水平上调有关.

  18. Frequency of neonatal complications after premature delivery

    Directory of Open Access Journals (Sweden)

    Gordana Grgić

    2013-04-01

    Full Text Available Introduction: Preterm delivery is the delivery before 37 weeks of gestation are completed. The incidence of preterm birth ranges from 5 to 15%. Aims of the study were to determine the average body weight, Apgar score after one and five minutes, and the frequency of the most common complications in preterminfants.Methods: The study involved a total of 631 newborns, of whom 331 were born prematurely Aims of this study were to (24th-37th gestational weeks-experimental group, while 300 infants were born in time (37-42 weeks of gestation-control group.Results: Average body weight of prematurely born infants was 2382 grams, while the average Apgar score in this group after the fi rst minute was 7.32 and 7.79 after the fifth minute. The incidence of respiratory distress syndrome was 50%, intracranial hemorrhage, 28.1% and 4.8% of sepsis. Respiratory distresssyndrome was more common in infants born before 32 weeks of gestation. Mortality of premature infants is present in 9.1% and is higher than that of infants born at term.Conclusions: Birth body weight and Apgar scores was lower in preterm infants. Respiratory distress syndrome is the most common fetal complication of prematurity. Intracranial hemorrhage is the second most common complication of prematurity. Mortality of premature infants is higher than the mortality of infants born at term birth.

  19. Nonequilibrium Weak Processes in Kaon Condensation; 2, Kinetics of condensation

    CERN Document Server

    Muto, T; Iwamoto, N; Muto, Takumi; Tatsumi, Toshitaka; Iwamoto, Naoki

    2000-01-01

    The kinetics of negatively charged kaon condensation in the early stages of a newly born neutron star is considered. The thermal kaon process, in which kaons are thermally produced by nucleon-nucleon collisions, is found to be dominant throughout the equilibration process. Temporal changes of the order parameter of the condensate and the number densities of the chemical species are obtained from the rate equations, which include the thermal kaon reactions as well as the kaon-induced Urca and the modified Urca reactions. It is shown that the dynamical evolution of the condensate is characterized by three stages: the first, prior to establishment of a condensate, the second, during the growth and subsequent saturation of the condensate, and the third, near chemical equilibrium. The connection between the existence of a soft kaon mode and the instability of the noncondensed state is discussed. Implications of the nonequilibrium process on the possible delayed collapse of a protoneutron star are also mentioned.

  20. Abrogation of Chk1-mediated S/G2 checkpoint by UCN-01 enhances ara-C-induced cytotoxicity in human colon cancer cells

    Institute of Scientific and Technical Information of China (English)

    Rong-guang SHAO; Chun-Xia CAO; Yves POMMIER

    2004-01-01

    AIM: To investigate whether 7-hydroxystaurosporine (UCN-01) affects cell cycle progression in arabinosylcytosine (ara-C) treated human colon carcinoma HT-29 cells. METHODS: Cytotoxicity, DNA synthesis, cell cycle distribution,protein level, and kinase activity were determined by clonogenic assay, flow cytometry, DNA synthesis assay,immunoblotting, and kinase assays, respectively. RESULTS: UCN-01 abrogated an S/G2-phase checkpoint in HT29 cells treated with ara-C. When UCN-01 was added after treatment with ara-C, the rate of recovery of DNA synthesis was enhanced and colony-forming ability diminished. Thus, premature recovery of DNA synthesis was associated with increased cytotoxicity. Measurements of cyclin A and B protein levels, Cdk2 and Cdc2 kinase activities, Cdc25C phosphorylation, and Chkl kinase activity were consistent with UCN-01-induced abrogation of the S/G2-phase checkpoint in ara-C treated cells. CONCLUSION: The abrogation of the S/G2 checkpoint may be due to inhibition of Chkl kinase by UCN-01. The enhanced cytotoxicity produced when UCN-01 was combined with ara-C suggested a rationale for the use of this drug combination for tumors that might be susceptible to cell cycle checkpoint abrogation.

  1. Condensation Processes in Geothermal Systems

    Science.gov (United States)

    Norman, D. I.; Moore, J. N.

    2005-12-01

    We model condensation processes in geothermal systems to understand how this process changes fluid chemistry. We assume two processes operate in geothermal systems: 1) condensation of a vapor phase derived by boiling an aqueous geothermal fluid into a cool near surface water and 2) condensation of a magmatic vapor by a deep circulating meteoric thermal fluid. It is assumed that the condensation process has two stages. Initially the condensing fluid is under saturated in gaseous species. Condensation of the vapor phase continues until the pressure on the fluid equals the sum of the partial pressures of water and the dissolved gaseous species. At that time bubbles flux through the condensing fluid. In time the fluid and fluxing gas phase come to equilibrium. Calculation shows that during the second stage of the condensation process the liquid phase becomes enriched in more soluble gaseous species like CO2 and H2S, and depleted in less soluble species like CH4 and N2. Stage 2 condensation processes can therefore be monitored by ratios of more and less condensable species like CO2/N2. Condensation of vapor released by boiling geothermal fluids results in liquids with high concentrations of H2S and CO2 like is seen in geothermal system steam-heated waters. Condensation of a magmatic vapor into circulating meteoric water has been proposed, but not well demonstrated. We compare to our models the Cerro Prieto, Mexico gas analysis data set collected over twelve years time by USGS personnel. It was assumed for modeling that the Cerro Prieto geothermal fluids are circulating meteoritic fluids with N2/Ar ratios about 40 to which is added a magmatic vapor with N2/Ar ratio = 400. The Cerro Prieto analyses show a strong correlation between N2/Ar and CO2/N2 as predicted by calculation. Two dimensional image plots of well N2/Ar + CO2/N2 show a bull's-eye pattern on the geothermal field. Image plots of analyses collected over a year or less time show N2/Ar and CO2/N2 hot spots

  2. Both Chromosome Decondensation and Condensation Are Dependent on DNA Replication in C. elegans Embryos.

    Science.gov (United States)

    Sonneville, Remi; Craig, Gillian; Labib, Karim; Gartner, Anton; Blow, J Julian

    2015-07-21

    During cell division, chromatin alternates between a condensed state to facilitate chromosome segregation and a decondensed form when DNA replicates. In most tissues, S phase and mitosis are separated by defined G1 and G2 gap phases, but early embryogenesis involves rapid oscillations between replication and mitosis. Using Caenorhabditis elegans embryos as a model system, we show that chromosome condensation and condensin II concentration on chromosomal axes require replicated DNA. In addition, we found that, during late telophase, replication initiates on condensed chromosomes and promotes the rapid decondensation of the chromatin. Upon replication initiation, the CDC-45-MCM-GINS (CMG) DNA helicase drives the release of condensin I complexes from chromatin and the activation or displacement of inactive MCM-2-7 complexes, which together with the nucleoporin MEL-28/ELYS tethers condensed chromatin to the nuclear envelope, thereby promoting chromatin decondensation. Our results show how, in an early embryo, the chromosome-condensation cycle is functionally linked with DNA replication.

  3. 16 CFR Appendix G2 to Part 305 - Furnaces-Electric

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Furnaces-Electric G2 Appendix G2 to Part 305 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER SPECIFIC ACTS OF CONGRESS RULE CONCERNING... Part 305—Furnaces—Electric Manufacturer's rated heating capacities (Btu's/hr.) Range of annual fuel...

  4. XPD Functions as a Tumor Suppressor and Dysregulates Autophagy in Cultured HepG2 Cells.

    Science.gov (United States)

    Zheng, Jian-Feng; Li, Lin-Lin; Lu, Juan; Yan, Kun; Guo, Wu-Hua; Zhang, Ji-Xiang

    2015-05-29

    Recent clinical studies have linked polymorphisms in the xeroderma pigmentosum group D (XPD) gene, a key repair gene involved in nucleotide excision repair, to increased risk of hepatocellular carcinoma (HCC). However, the cellular effects of XPD expression in cultured HCC cells remain largely uncharacterized. Therefore, the aim of this study was to characterize the in vitro cellular effects of XPD expression on the HCC cell line HepG2. HepG2 cells were transfected as follows to create four experimental groups: pEGFP-N2/XPD plasmid (XPD) group, EGFP-N2 plasmid (N2) control group, lipofectamine™ 2000 (lipid) control group, and non-transfected (CON) control group. An MTT cell proliferation assay, Annexin V-APC apoptosis assay, colony formation assay, scratch wound migration assay, Transwell migration assay, and Western blotting of the autophagic proteins LC3 and p62 were conducted. XPD expression significantly inhibited HepG2 cell proliferation (pHepG2 cell apoptosis (pHepG2 colony formation (pHepG2 cells' migratory ability (pHepG2 cells' invasive capacity (pHepG2 cells in vitro. Further in vivo pre-clinical studies and clinical trials are needed to validate XPD's potential as a tumor-suppressive gene therapy.

  5. Microgravity condensing heat exchanger

    Science.gov (United States)

    Thomas, Christopher M. (Inventor); Ma, Yonghui (Inventor); North, Andrew (Inventor); Weislogel, Mark M. (Inventor)

    2011-01-01

    A heat exchanger having a plurality of heat exchanging aluminum fins with hydrophilic condensing surfaces which are stacked and clamped between two cold plates. The cold plates are aligned radially along a plane extending through the axis of a cylindrical duct and hold the stacked and clamped portions of the heat exchanging fins along the axis of the cylindrical duct. The fins extend outwardly from the clamped portions along approximately radial planes. The spacing between fins is symmetric about the cold plates, and are somewhat more closely spaced as the angle they make with the cold plates approaches 90.degree.. Passageways extend through the fins between vertex spaces which provide capillary storage and communicate with passageways formed in the stacked and clamped portions of the fins, which communicate with water drains connected to a pump externally to the duct. Water with no entrained air is drawn from the capillary spaces.

  6. Tenth-order lepton g-2: Contribution of some fourth-order radiative corrections to the sixth-order g-2 containing light-by-light-scattering subdiagrams

    CERN Document Server

    Aoyama, T; Kinoshita, T; Nio, M

    2010-01-01

    This paper reports the tenth-order QED contribution to lepton g-2 from diagrams of three gauge-invariant sets VI(d), VI(g), and VI(h), which are obtained by including various fourth-order radiative corrections to the sixth-order g-2 containing light-by-light-scattering subdiagrams. In the case of electron g-2, they consist of 492, 480, and 630 vertex Feynman diagrams, respectively. The results of numerical integration, including mass-dependent terms containing muon loops, are 1.8418(95) (alpha/pi)^5 for the Set VI(d), -1.5918(65) (alpha/pi)^5 for the Set VI(g), and 0.1797(40) (alpha/pi)^5 for the Set VI(h), respectively. We also report the contributions to the muon g-2, which derive from diagrams containing an electron, muon or tau lepton loop: Their sums are -5.876(802) (alpha/pi)^5 for the Set VI(d), 5.710(490) (alpha/pi)^5 for the Set VI(g), and -8.361(232) (alpha/pi)^5 for the Set VI(h), respectively.

  7. 龙葵碱诱导HepG2细胞凋亡的观察%Study of solanine on apoptosis in HepG2 cell

    Institute of Scientific and Technical Information of China (English)

    高世勇; 邹翔; 汲晨锋; 王宏亮

    2007-01-01

    观察龙葵碱对3种消化系统肿瘤细胞株人肝癌细胞HepG2、人胃癌细胞SGC-7901、人大肠癌细胞Ls-174的细胞毒作用.并从细胞凋亡角度揭示龙葵碱对敏感细胞株的作用机制.采用MTT法观察龙葵碱对3种肿瘤细胞株的细胞毒作用;采用AO/EB双染,激光共聚焦扫描显微术(eonfocal)观察龙葵碱对HepG,肿瘤细胞形态的影响;PI单染,流式细胞仪测定龙葵碱诱导HepG2细胞凋亡的凋亡率及对细胞周期的影响.龙葵碱作用于HepG2、SGC-7901、LS-174的IC50分别为14.47μg/mL、>50μg/mL、>50μg/mL;在形态学观察实验中,阴性对照组细胞形态正常,0.003 2μg/mL、0.016μg/mL龙葵碱使细胞外周呈微弱皱缩状改变,0.08、0.4、2μg/mL龙葵碱使HepG2细胞出现大量碎片及凋亡小体等典型的细胞凋亡形态.凋亡率测定结果表明5个剂量龙葵碱诱导HepG2细胞凋亡率分别为6.0%、14.4%、17.3%、18.9%、32.2%,0.08μg/mL喜树碱诱导HepG2细胞的凋亡率为21.9%.细胞周期观察发现龙葵碱各组G2/M期均消失,S期明显升高.龙葵碱对HepG2人肝癌细胞株比较敏感,能够诱导HepG2细胞凋亡,并将HepG2细胞阻止在S期,影响肿瘤细胞DNA合成.

  8. PPOOLEX experiments on wall condensation

    Energy Technology Data Exchange (ETDEWEB)

    Laine, J.; Puustinen, M. (Lappeenranta Univ. of Technology, Nuclear Safety Research Unit (Finland))

    2009-08-15

    This report summarizes the results of the wall condensation experiments carried out in December 2008 and January 2009 with the scaled down PPOOLEX test facility designed and constructed at Lappeenranta University of Technology. Steam was blown into the dry well compartment and from there through a DN200 blowdown pipe to the condensation pool. Altogether five experiments, each consisting of several blows, were carried out. The main purpose of the experiment series was to study wall condensation phenomenon inside the dry well compartment while steam is discharged through it into the condensation pool and to produce comparison data for CFD calculations at VTT. The PPOOLEX test facility is a closed stainless steel vessel divided into two compartments, dry well and wet well. For the wall condensation experiments the test facility was equipped with a system for collecting and measuring the amount of condensate from four different wall segments of the dry well compartment. A thermo graphic camera was used in a couple of experiments for filming the outside surface of the dry well wall. The effect of the initial temperature level of the dry well structures and of the steam flow rate for the accumulation of condensate was studied. The initial temperature level of the dry well structures varied from 23 to 99 deg. C. The steam flow rate varied from 90 to 690 g/s and the temperature of incoming steam from 115 to 160 deg. C. During the initial phase of steam discharge the accumulation of condensate was strongly controlled by the temperature level of the dry well structures; the lower the initial temperature level was the more condensate was accumulated. As the dry well structural temperatures increased the condensation process slowed down. Most of the condensate usually accumulated during the first 200 seconds of the discharge. However, the condensation process never completely stopped because a small temperature difference remained between the dry well atmosphere and inner wall

  9. Decay of Ultralight Axion Condensates

    Energy Technology Data Exchange (ETDEWEB)

    Eby, Joshua; Ma, Michael; Suranyi, Peter; Wijewardhana, L. C.R.

    2017-05-15

    Axion particles can form macroscopic condensates, whose size can be galactic in scale for models with very small axion masses $m\\sim10^{-22}$ eV, and which are sometimes referred to under the name of Fuzzy Dark Matter. Many analyses of these condensates are done in the non-interacting limit, due to the weakness of the self-interaction coupling of axions. We investigate here how certain results change upon inclusion of these interactions, finding a decreased maximum mass and a modified mass-radius relationship. Further, these condensates are, in general, unstable to decay through number-changing interactions. We analyze the stability of galaxy-sized condensates of axion-like particles, and sketch the parameter space of stable configurations as a function of a binding energy parameter. We find a strong lower bound on the size of Fuzzy Dark Matter condensates which are stable to decay, with lifetimes longer than the age of the universe.

  10. APPARATUS FOR CONDENSATION AND SUBLIMATION

    Science.gov (United States)

    Schmidt, R.J.; Fuis, F. Jr.

    1958-10-01

    An apparatus is presented for the sublimation and condensation of uranium compounds in order to obtain an improved crystalline structure of this material. The apparatus comprises a vaporizing chamber and condensing structure connected thereto. There condenser is fitted with a removable liner having a demountable baffle attached to the liner by means of brackets and a removable pin. The baffle is of spiral cross-section and is provided with cooling coils disposed between the surfaces of the baffle for circulation of a temperature controlling liquid within the baffle. The cooling coll provides for controlllng the temperature of the baffle to insure formatlon of a satisfactory condensate, and the removable liner facilitates the removal of condensate formed during tbe sublimation process.

  11. Prevalence of dental caries and caries-related risk factors in premature and term children.

    Science.gov (United States)

    Cruvinel, Vanessa Resende Nogueira; Gravina, Danuze Batista Lamas; Azevedo, Tatiana Degani Paes Leme; Bezerra, Ana Cristina Barreto; Toledo, Orlando Ayrton de

    2010-01-01

    This study evaluated the prevalence of enamel defects and dental caries and their risk factors on primary and permanent dentitions of prematurely-born children and term children. Eighty children were examined, 40 born prematurely (G1) and 40 born term (G2), in the age group between 5 and 10 years. The demographic variables, medical history and oral health behaviors were recorded on a questionnaire. The teeth were examined for presence of deficiencies of the enamel and caries that were registered. The caries were registered, focusing on the indices dmft (decayed, missing, and filled primary teeth) and DMFT (decayed, missing, and filled permanent teeth). The results showed that 75% of the total sample had enamel defects. The logistic regression model showed that other risk factors such as per capita family income, educational level, dietary and hygiene habits, fluoride exposure, trauma, and diseases had no correlation with enamel defects and caries. A smaller value of total DMFT (0.95) was found in the group of premature children in comparison to the term children (2.07) p = 0.0164. There was no difference concerning the permanent dentition between the two groups (p = 0.9926). One concludes that prematurity can't be a predisposing factor for the presence of dental caries.

  12. Prevalence of dental caries and caries-related risk factors in premature and term children

    Directory of Open Access Journals (Sweden)

    Vanessa Resende Nogueira Cruvinel

    2010-09-01

    Full Text Available This study evaluated the prevalence of enamel defects and dental caries and their risk factors on primary and permanent dentitions of prematurely-born children and term children. Eighty children were examined, 40 born prematurely (G1 and 40 born term (G2, in the age group between 5 and 10 years. The demographic variables, medical history and oral health behaviors were recorded on a questionnaire. The teeth were examined for presence of deficiencies of the enamel and caries that were registered. The caries were registered, focusing on the indices dmft (decayed, missing, and filled primary teeth and DMFT (decayed, missing, and filled permanent teeth. The results showed that 75% of the total sample had enamel defects. The logistic regression model showed that other risk factors such as per capita family income, educational level, dietary and hygiene habits, fluoride exposure, trauma, and diseases had no correlation with enamel defects and caries. A smaller value of total DMFT (0.95 was found in the group of premature children in comparison to the term children (2.07 p = 0.0164. There was no difference concerning the permanent dentition between the two groups (p = 0.9926. One concludes that prematurity can't be a predisposing factor for the presence of dental caries.

  13. Premature chromosome condensation (PCC) assay for dose assessment in mass casualty accidents.

    Science.gov (United States)

    Lindholm, Carita; Stricklin, Daniela; Jaworska, Alicja; Koivistoinen, Armi; Paile, Wendla; Arvidsson, Eva; Deperas-Standylo, Joanna; Wojcik, Andrzej

    2010-01-01

    The study was undertaken to establish a dose calibration curve for a practical PCC ring assay and to apply it in a simulated mass casualty accident. The PCC assay was validated against the conventional dicentric assay. A linear relationship was established for PCC rings after (60)Co gamma irradiation with doses up to 20 Gy. In the simulated accident experiment, 62 blood samples were analyzed with both the PCC ring assay and the conventional dicentric assay, applying a triage approach. Samples received various uniform and non-uniform (10-40% partial-body) irradiations up to doses of 13 Gy. The results indicated that both assays yielded good dose estimates for the whole-body exposure scenario, although in the lower-dose range (0-6 Gy) dicentric scoring resulted in more accurate whole-body estimates, whereas PCC rings were better in the high-dose range (>6 Gy). Neither assay was successful in identifying partial-body exposures, most likely due to the low numbers of cells scored in the triage mode. In conclusion, the study confirmed that the PCC ring assay is suitable for use as a biodosimeter after whole-body exposure to high doses of radiation. However, there are limitations for its use in the triage of people exposed to high, partial-body doses.

  14. Dose assessment intercomparisons within the RENEB network using G0-lymphocyte prematurely condensed chromosomes (PCC assay)

    OpenAIRE

    Terzoudi, Georgia I; Pantelias, Gabriel; Darroudi, Firouz; Barszczewska, Katarzyna; Buraczewska, Iwona; Depuydt, Julie; Georgieva, Dimka; Hadjidekova, Valeria; Hatzi, Vasiliki I.; Karachristou, Ioanna; Karakosta, Maria; Meschini, Roberta; M’kacher, Radhia; Montoro, Alegria; Palitti, Fabrizio

    2017-01-01

    Purpose: Dose assessment intercomparisons within the RENEB network were performed for triage biodosimetry analyzing G0-lymphocyte PCC for harmonization, standardization and optimization of the PCC assay. Materials and methods: Comparative analysis among different partners for dose assessment included shipment of PCC-slides and captured images to construct dose-response curves for up to 6 Gy c-rays. Accident simulation exercises were performed to assess the suitability of the PCC assay by d...

  15. Premature chomosome condensation technique: A very promising approach to radiotherapy for digestive system cancers

    Institute of Scientific and Technical Information of China (English)

    Jian-She Yang

    2006-01-01

    @@ Dear Editior-in-Chief, I am grateful to the renowned World Journal of Gastroenterology for publishing our manuscript about hepatoma radiosensitivity in volume 11 issue 26, page 4098-4101[1]. Since this paper appeared online first, it was widely considered. Up to date, it has been cited four times in various journals covered by Science Citation Index[2-4],and the click count and download count added up to 459and 163[5], respectively. Some scientists from Australia and Germany frequently sent me letters to ask for original data to be cited, but a fatal mistake made them arduous. The correspondence author's e-mail address should be yangjs@impcas.ac.cn, but not tuyangjs@impcas.ac.cnit. I sincerely expected your editors could rephrase and upload it to your online data base.

  16. Sensitivity of Hep G2 cells to Bacillus cereus emetic toxin.

    Science.gov (United States)

    Kamata, Yoichi; Kanno, Shinji; Mizutani, Noriko; Agata, Norio; Kawakami, Hiroshi; Sugiyama, Kei-ichi; Sugita-Konishi, Yoshiko

    2012-11-01

    We herein examined the sensitivity of Hep G2 human hepatoma cells to Bacillus cereus emetic toxin. Hep G2 cells were treated with the emetic toxin, and the cell shape was observed. The same experiments were performed for comparison purposes, using HEp-2 cells, which are currently used by most laboratories for a bioassay of the emetic toxin. Hep G2 cells showed clearer vacuolation in the cytosol within 2 hr and required a shorter incubation period than HEp-2 cells (10 hr). The number of vacuoles in the Hep G2 cells was greater, and the size of the vacuoles was larger than those observed in HEp-2 cells. The minimal concentration of the emetic toxin required to induce the vacuolation of Hep G2 cells was 0.04 ng/ml. The concentration for the HEp-2 cells was 1 ng/ml. These findings indicate that Hep G2 cells show higher sensitivity to the emetic toxin. Hep G2 cells may be superior to the currently used HEp-2 cells for the bioassay of the emetic toxin.

  17. Cells bearing chromosome aberrations lacking one telomere are selectively blocked at the G2/M checkpoint

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Pilar [Unitat de Biologia Cel.lular, Departament de Biologia Cel.lular, Fisiologia i Immunologia, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Barquinero, Joan Francesc [Unitat d' Antropologia Biologica, Departament de Biologia Animal, Biologia Vegetal i Ecologia, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Duran, Assumpta [Unitat de Biologia Cel.lular, Departament de Biologia Cel.lular, Fisiologia i Immunologia, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Caballin, Maria Rosa [Unitat d' Antropologia Biologica, Departament de Biologia Animal, Biologia Vegetal i Ecologia, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain); Ribas, Montserrat [Servei de Radiofisica i Radioproteccio de l' Hospital de la Santa Creu i Sant Pau, 08025 Barcelona (Spain); Barrios, Leonardo, E-mail: Lleonard.Barrios@uab.cat [Unitat de Biologia Cel.lular, Departament de Biologia Cel.lular, Fisiologia i Immunologia, Universitat Autonoma de Barcelona, 08193 Bellaterra (Spain)

    2009-11-02

    Cell cycle checkpoints are part of the cellular mechanisms to maintain genomic integrity. After ionizing radiation exposure, the cells can show delay or arrest in their progression through the cell cycle, as well as an activation of the DNA repair machinery in order to reduce the damage. The G2/M checkpoint prevents G2 cells entering mitosis until the DNA damage has been reduced. The present study evaluates which G0 radiation-induced chromosome aberrations are negatively selected in the G2/M checkpoint. For this purpose, peripheral blood samples were irradiated at 1 and 3 Gy of {gamma}-rays, and lymphocytes were cultured for 48 h. Calyculin-A and Colcemid were used to analyze, in the same slide, cells in G2 and M. Chromosome spreads were consecutively analyzed by solid stain, pancentromeric and pantelomeric FISH and mFISH. The results show that the frequency of incomplete chromosome elements, those lacking a telomeric signal at one end, decreases abruptly from G2 to M. This indicates that cells with incomplete chromosome elements can progress from G0 to G2, but at the G2/M checkpoint suffer a strong negative selection.

  18. Contribution of ethanol-tolerant xylanase G2 from Aspergillus oryzae on Japanese sake brewing.

    Science.gov (United States)

    Sato, Yuichiro; Fukuda, Hisashi; Zhou, Yan; Mikami, Shigeaki

    2010-12-01

    We purified three xylanase isozymes (XynF1, XynF3 and XynG2) from a solid-state Aspergillus oryzae RIB128 culture using chromatography. The results of our sake-brewing experiment, in which we used exogenously supplemented enzymes, revealed that only XynG2 improved the alcohol yield and the material utilization. The alcohol yield of the XynG2 batch displayed an increase of 4.4% in comparison to the control, and the amount of sake cake decreased by 4.6%. The contribution of XynG2 was further confirmed through our brewing experiment in which we used the yeast heterogeneously expressing fungal xylanase isozymes. Interestingly XynG1, an enzyme with a XynG2-like sequence that is more vulnerable to ethanol, did not improve the sake-mash fermentation. The stability of XynG2 in ethanol was prominent, and it retained most of its original activity after we exposed it to 80% ethanol for 30min, whereas the stability of the other isozymes in ethanol, including XynG1, was much lower (20-25% ethanol). We concluded, therefore, that the improvement of material utilization achieved with XynG2 is primarily attributable to its characteristically high stability in ethanol, thereby, effectively degrading rice endosperm cell walls under high-alcohol conditions such as a sake-mash environment.

  19. Zinc oxide nanoparticles-induced epigenetic change and G2/M arrest are associated with apoptosis in human epidermal keratinocytes

    Directory of Open Access Journals (Sweden)

    Gao F

    2016-08-01

    Full Text Available Fei Gao, Ningjie Ma, Hong Zhou, Qing Wang, Hao Zhang, Pu Wang, Haoli Hou, Huan Wen, Lijia Li State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, Wuhan, People’s Republic of China Abstract: As an engineered nanomaterial, zinc oxide nanoparticles (ZnO NPs are used frequently in biological applications and can make contact with human skin. Here, we systematically investigated the effects of ZnO NPs on non-tumorigenic human epidermal keratinocytes, which were used as a test model for this in vitro study, at the epigenetic and molecular levels. Our results showed that ZnO NPs induced cell cycle arrest at the G2/M checkpoint before the viability of human epidermal keratinocytes was reduced, which was associated with the chromatin changes at the epigenetic level, including increased methylation of histone H3K9 and decreased acetylation of histone H4K5 accompanied by chromatin condensation at 24 hours. The mRNA expression of the methyltransferase genes G9a and GLP was also increased upon treatment with ZnO NPs, and the acetyltransferase genes GCN5, P300, and CBP were downregulated. Reactive oxygen species were found to be more abundant after treatment with ZnO NPs for 6 hours, and DNA damage was observed at 24 hours. Transmission electron microscopy and flow cytometry confirmed that ZnO NPs were absorbed into the cell when they were added to the medium. Apoptotic human epidermal keratinocytes were detected, and the expression of the proapoptotic genes Bax, Noxa, and Puma increased significantly, while the expression of the antiapoptotic gene Bcl-xl decreased 24 hours after exposure to ZnO NPs. These findings suggest that the ZnO NPs induced cell cycle arrest at G2/M, which was associated with epigenetic changes and accompanied by p53-Bax mitochondrial pathway-mediated apoptosis. Keywords: ZnO nanoparticle, cell cycle G2/M arrest, histone modification, p53-Bax mitochondrial apoptosis pathway, reactive oxygen species

  20. Premature Ejaculation and Utilization of Cognitive Techniques

    Directory of Open Access Journals (Sweden)

    Serkan AKKOYUNLU

    2013-03-01

    Full Text Available Introduction: Premature ejaculation is the most common male sexual dysfunction leading to distress in many couples. Master and Johnson emphasized the concept of early learned experiences and Kaplan emphasized lack of sensory awareness. For treatment sex therapists mainly utilize start-stop and squeeze techniques as homework. Couples enter sex therapy with some cognitive distortions and beliefs about sex and sexuality. These beliefs are also named sexual myths. For some couples using techniques to challenge cognitive distortions and maladaptive beliefs about sex and sexuality can be used. In this paper by presenting a case we discussed how cognitive techniques can be used along with behaviour techniques with couples. Case: Presenting clients are five years married couple who are thirty and twenty nine years old respectively. They attended to the outpatient clinic with the request of the female client. Their main complaint was premature ejaculation. They were diagnosed premature ejaculation using clinical interview. In treatment besides start and stop technique, cognitive techniques were utilized to address dysfunctional beliefs about sexuality. Discussion: Premature ejaculation is a male sexual dysfunction that causes distress and intimacy problems between couples. Stop start and squeeze techniques were accepted as the choice of treatment but their effectiveness is questioned recently. Also cognitive distortions and maladaptive beliefs may hamper therapy progress. Besides that, behavioral techniques utilizing cognitive techniques to lessen the degree of dysfunctional beliefs about sex and sexuality may help the couple to overcome premature ejaculation and enhance sexual satisfaction and intimacy.

  1. Antitumor effect of matrine in human hepatoma G2 cells by inducing apoptosis and autophagy

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM: To study the antitumor effect of matrine in human hepatoma G2 (HepG2) cells and its molecular mechanism involved in antineoplastic activities. METHODS: 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay was used to detect viability of HepG2 cells. The effect of matrine on cell cycle was detected by flow cytometry. Annexin-V-FITC/PI double staining assay was used to detect cellular apoptosis. Cellular morphological changes were observed under an inverted phase contrast microscope. ...

  2. g-2 of the muon from compositeness in the model of Abbott and Farhi

    Science.gov (United States)

    Brodsky, Stanley J.; Davies, Andrew J.; Volkas, Raymond R.

    1989-05-01

    We use a simple model to estimate the contribution to g-2 for the muon in the composite model of Abbott and Farhi. Dimension-5 operators must be introduced to describe the effective coupling of the composite left-handed muon to its constituents. We find an interesting suppression, which operates in the region of low scalar preon mass, of the leading-order term for g-2. The contribution of compositeness to g-2 is thus smaller than might naively be expected and is within experimental limits.

  3. Initial study on apoptosis in HepG-2 Human heptocarcinoma cell line by CSS

    Institute of Scientific and Technical Information of China (English)

    YU Lei; CUI Rong-tian; MO Ke; WANG Wei; JI Yu-bin; ZOU Xiang

    2008-01-01

    Objective To discuss on mechanism of the killing and apoptosis inducing effect induced by total alkaloid in the CSS(Capparis spinosa L. saponin, CSS)on human hepatocarcinoma cell Line HepG-2. Methods The killing effect of the CSS on human hepatocarcinoma cell Line HepG-2 was observed by MTT method. Morphological observation of the HepG-2 cells was completed by fluorescence microscope. This test was signed to observe the changes of the cell cycle of HepG-2 cells affected by the CSS by PI single-staining, and to observe if there were typical apoptosis peaks. The apoptosis inducing effect and changing of mitochondria membrane potential of the CSS on the HepG-2 cells were studied by flow cytometry. The effect of intraceUular Ca2+ level of CSS on the HepG-2 cells was measured by laser confocal microscope. Results CSS has growth inhibiting on the HepG-2 and seems to be enhanced with the increasing concentration of CSS, and its IC50 value was 46.16 μg·mL-1. The HepG-2 cells are characteristic apoptosis morphologic changed, and the apoptosis percentage is increased to 66.652 % in the 50 μg·mL-1 dosage group. The cells cycle has been changed obviously that the progresses of cells cycle of G1 period and G2 period in high dosage group have been blocked, and the cellular proportion in G2 period is decreased by the function of CSS for 24 h. The mitochondria membrane potential of HepG-2 cells induced by CSS is decreased in various degrees. In addition, the intracellular Ca2+ level is increased by the function of CSS in the middle and high dose groups. Conclusions The CSS has obviously killing and apoptosis inducing effect on human hepatoearcinoma cell Line HepG-2 by the mechanism of decreasing the mitochondria membrane potential and increasing the intracellular Ca2+ level.

  4. HepG2 cells acquire stem cell-like characteristics after immune cell stimulation.

    Science.gov (United States)

    Wang, Hang; Yang, Miqing; Lin, Ling; Ren, Hongzhen; Lin, Chaotong; Lin, Suling; Shen, Guoying; Ji, Binfeng; Meng, Chun

    2016-02-01

    The presence of cancer stem cells (CSCs) is currently regarded as one of the main culprits of tumor formation and therapy failure. It is known that chronic inflammation is associated with CSCs, but it is not clear yet how inflammation affects the development of CSCs. In the present study we aimed to examine the relationship between cancer cell stimulation mediated by immune cells and the acquisition of a CSC-like phenotype. Cancer cells derived from single hepatocarcinoma HepG2 cells were treated with mouse splenic B cells (MSBCs) and mouse peritoneal macrophage cells (MPMCs), respectively. The stem cell-like characteristics of the resulting HepG2 cells (MSBC-HepG2 and MPMC-HepG2) were evaluated using different assays, including biomarker assays, in vitro tumoroid and colony forming assays, in vivo tumor forming assays and signal transduction pathway activation assays. Various stemness characteristics of HepG2 cells, including self-renewal, proliferation, chemoresistance and tumorigenicity were evaluated. The expression levels of stemness-related genes and its encoded proteins in the MSBC-HepG2 and MPMC-HepG2 cells were assessed using RT-PCR and FACS analyses. We found that MSBC-HepG2 and MPMC-HepG2 cells possess hepatic CSC properties, including persistent self-renewal, extensive proliferation, drug resistance, high tumorigenic capacity and over-expression of CSC-related genes and proteins (i.e., EpCAM, ALDH, CD133 and CD44), compared to the parental cells. We also found that 1x10(3) MSBC-HepG2 and MPMC-HepG2 cells were able to form tumors in NOD/SCID mice and that the Notch and SHH signaling pathways were highly activated in MSBC-HepG2 cells. We conclude that the immune system may have a double-edge effect on cancer development. On one hand, immune cells such as B lymphocytes and macrophages may recognize, attack and eliminate cancer cells, whereas on the other hand, they may promote a subset of cancer cells to acquire stem cell-like characteristics.

  5. Health physics during work on the G. 2 and G. 3 reactor exchanges; La radioprotection des travaux sur les echangeurs des piles G. 2 et G. 3

    Energy Technology Data Exchange (ETDEWEB)

    Rodier, J.; Chassany, J.; Guillermin, P. [Commissariat a l' Energie Atomique, Centre de Production de Plutonium, Marcoule (France). Centre d' Etudes Nucleaires

    1965-07-01

    During this work and its preparation, which took place first at G. 2 and then at G. 3 over a period of 11 months, 15000 measurement results were obtained. Their analysis, together with a consideration of the organisation on the site and of the conclusions drawn from the experiment, shows the various factors which determine the importance of the radio-active dangers. (authors) [French] Au cours de ces travaux et de leur preparation, qui ont eu lieu successivement a G. 3 puis a G. 2, pendant 11 mois, 15 000 resultats de mesures ont ete obtenus. Leur etude, mise en parallele avec l'organisation du chantier et les enseignements tires de l'experience, met en evidence les divers facteurs conditionnant les niveaux de risques radioactifs. (auteurs)

  6. 双五次B-样条曲面的G2连续条件%G2 CONTINUOS CONDITIONS OF BIQUINTIC B-SPLINE SURFACES

    Institute of Scientific and Technical Information of China (English)

    赵岩; 施锡泉

    2004-01-01

    Some practical problems in designing the outline of hidden airplane require to construct high-order surfaces with at least second order continuity. The high-order smooth surfaces'construction has been always a difficuit problem in CAGD. In this paper, G2 smoothness between two biquintic surface patches is discussed, and the intrinsic conditions of the control vectors of the common boundary curve are presented.

  7. Antikaon condensation in neutron stars

    CERN Document Server

    Pal, S; Greiner, W

    2000-01-01

    We investigate the condensation of charged K sup - meson and neutral anti-K sup 0 meson in dense neutron star matter. Calculations are performed in relativistic mean field models in which both the baryon-baryon and (anti)kaon-baryon interactions are mediated by meson exchange. It is found that anti-K sup 0 condensation is quite sensitive to the antikaon optical potential and depends more strongly on the nucleonic equation of state. For moderate values of antikaon potential and a rather stiff equation of state, a significant region of maximum mass star will contain anti-K sup 0 meson. The critical density of anti-K sup 0 condensation is always higher than that of K sup - condensation. With the appearance of K sup - and anti-K sup 0 condensates, pairs of p-K sup - and n-Kbar sup 0 are produced with equal proportion leading to a perfectly symmetric matter of nucleons and antikaons in neutron stars. Along with K sup - condensate, anti-K sup 0 condensate makes the equation of state much softer resulting in smaller...

  8. [Identification of rotavirus associated to serotype G2 in Yucatan, Mexico].

    Science.gov (United States)

    Gonzales-Loza, M del R; Polanco-Marín, G G; Puerto-Solis, M

    2000-01-01

    In the present study, rotavirus G2 serotype was identified from fecal samples of children with gastroenteritis from the city of Merida, Yucatan, Mexico. Virological diagnosis of disease was performed using polycrylamide gel electrophoresis and immunoenzymatic assay. Out of 149 analyzed samples 25 (16.7%) gave positive reaction to rotavirus groups A, of these 23 (92%) were identified as serotype g2, subgroup i and electrophoretic short pattern, whereas 2 (8%) were identified as subgroups II and electrophoretic long pattern, however, the G serotype was not possible to determine. Rotavirus G serotype has not been detected in more than 90% of samples since 1985. This indicates that the number of people susceptible to G2 serotype within the population has increased over recent years, which perhaps indicates that an important outbreak of acute infectious diarrhea caused by the rotavirus G2 serotype may be forthcoming.

  9. Correlation Between Muon $g-2$ and $\\mu\\rightarrow{e}{\\gamma}$

    CERN Document Server

    Chiu, Wei-Chi; Huang, Da

    2014-01-01

    While the muon $g-2$ anomaly can be successfully explained by some new physics models, most of them are severely constrained by the $\\mu \\to e \\gamma$ bound. This tension is more transparent from the effective field theory perspective, in which the two phenomena are encoded in two very similar operators. However, with the ${\\cal O}(1)$ Wilson coefficients, the current upper bound on $\\mu \\to e \\gamma$ indicates a new-physics cutoff scale five orders smaller than that needed to eliminate the $(g-2)_\\mu$ anomaly. By summarizing all the formulae from the one-loop contributions to the muon $g-2$ with the internal-particle spin not larger than 1, we point out two general methods to reconcile the conflict between the muon $g-2$ and $\\mu \\to e \\gamma$: the GIM mechanism and the non-universal couplings. For the latter method, we use a simple scalar leptoquark model as an illustration.

  10. Gauge-covariant decomposition and magnetic monopole for G(2) Yang-Mills field

    CERN Document Server

    Matsudo, Ryutaro

    2016-01-01

    We give a gauge-covariant decomposition of the Yang-Mills field with an exceptional gauge group $G(2)$, which extends the field decomposition invented by Cho, Duan-Ge, and Faddeev-Niemi for the $SU(N)$ Yang-Mills field. As an application of the decomposition, we derive a new expression of the non-Abelian Stokes theorem for the Wilson loop operator in an arbitrary representation of $G(2)$. The resulting new form is used to define gauge-invariant magnetic monopoles in the $G(2)$ Yang-Mills theory. Moreover, we obtain the quantization condition to be satisfied by the resulting magnetic charge. The method given in this paper is general enough to be applicable to any semi-simple Lie group other than $SU(N)$ and $G(2)$.

  11. Mutation analysis of the negative regulator cyclin G2 in gastric cancer

    African Journals Online (AJOL)

    Jane

    2011-10-24

    Oct 24, 2011 ... Key words: Cyclin G2, gastric cancer, negative regulator, mutation screen. ... has been reported in thyroid cancer, breast cancer, oral cancer and acute ..... transformation of papillary carcinoma of the thyroid. Anticancer. Res.

  12. Parallel tractor extension and ambient metrics of holonomy split G_2

    CERN Document Server

    Graham, C Robin

    2011-01-01

    The holonomy of the ambient metrics of Nurowski's conformal structures associated to generic real-analytic 2-plane fields on 5-manifolds is investigated. It is shown that the holonomy is always contained in the split real form G_2 of the exceptional Lie group, and is equal to G_2 for an open dense set of 2-plane fields given by explicit conditions. In particular, this gives an infinite-dimensional family of metrics of holonomy equal to split G_2. These results generalize work of Leistner-Nurowski. The inclusion of the holonomy in G_2 is established by proving an ambient extension theorem for parallel tractors for conformal structures in general signature and dimension, which is expected to be of independent interest. Parallel extension beyond the critical order in even dimensions is considered in certain cases.

  13. Data of evolutionary structure change: 1AW2G-2VENA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW2G-2VENA 1AW2 2VEN G A --RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDV...RQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEK-SEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAE... 2VEN A 2VENA1 2VEN A 2VENA A 2VENA YEPVW-----KVATP

  14. Mitofusin 1 is degraded at G2/M phase through ubiquitylation by MARCH5

    Directory of Open Access Journals (Sweden)

    Park Yong-Yea

    2012-12-01

    Full Text Available Abstract Background Mitochondria exhibit a dynamic morphology in cells and their biogenesis and function are integrated with the nuclear cell cycle. In mitotic cells, the filamentous network structure of mitochondria takes on a fragmented form. To date, however, whether mitochondrial fusion activity is regulated in mitosis has yet to be elucidated. Findings Here, we report that mitochondria were found to be fragmented in G2 phase prior to mitotic entry. Mitofusin 1 (Mfn1, a mitochondrial fusion protein, interacted with cyclin B1, and their interactions became stronger in G2/M phase. In addition, MARCH5, a mitochondrial E3 ubiquitin ligase, reduced Mfn1 levels and the MARCH5-mediated Mfn1 ubiquitylation were enhanced in G2/M phase. Conclusions Mfn1 is degraded through the MARCH5-mediated ubiquitylation in G2/M phase and the cell cycle-dependent degradation of Mfn1 could be facilitated by interaction with cyclin B1/Cdk1 complexes.

  15. Surface Grafted Glycopolymer Brushes to Enhance Selective Adhesion of HepG2 Cells

    DEFF Research Database (Denmark)

    Chernyy, Sergey; Jensen, Bettina Elisabeth Brøgger; Shimizu, Kyoko

    2013-01-01

    process on a previously formed poly(LAMA) brushes. The morphology of human hepatocellular carcinoma cancer cells (HepG2) on the comb-like poly(LAMA) brush layer has been studied. The fluorescent images of the HepG2 cells on the glycopolymer brush surface display distinct protrusions that extend outside...... of the cell periphery. On the other hand the cells on bare glass substrate display spheroid morphology. Further analysis using ToF-SIMS imaging shows that the HepG2 cells on glycopolymer surfaces is enriched with protein fragment along the cell periphery which is absent in the case of cells on bare glass...... substrate. It is suggested that the interaction of the galactose units of the polymer brush with the asialoglycoprotein receptor (ASGPR) of HepG2 cells has resulted in the protein enrichment along the cell periphery....

  16. Efficient, Long-Life Biocidal Condenser Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Environmental control systems for manned lunar and planetary bases will require condensing heat exchangers to control humidity. Condensing surfaces must be...

  17. Efficient, Long-Life Biocidal Condenser Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Environmental control systems for manned lunar and planetary bases will require condensing heat exchangers to control humidity in manned modules. Condensing surfaces...

  18. Bose condensation in (random traps

    Directory of Open Access Journals (Sweden)

    V.A. Zagrebnov

    2009-01-01

    Full Text Available We study a non-interacting (perfect Bose-gas in random external potentials (traps. It is shown that a generalized Bose-Einstein condensation in the random eigenstates manifests if and only if the same occurs in the one-particle kinetic-energy eigenstates, which corresponds to the generalized condensation of the free Bose-gas. Moreover, we prove that the amounts of both condensate densities are equal. This statement is relevant for justification of the Bogoliubov approximation} in the theory of disordered boson systems.

  19. Serum fructosamine and retinopathy of prematurity.

    Science.gov (United States)

    Bozdag, Senol; Oguz, Serife Suna; Gokmen, Tulin; Tunay, Zuhal; Tok, Levent; Uras, Nurdan; Erdeve, Omer; Dilmen, Ugur

    2011-12-01

    To determine whether serum fructosamine which is a good marker for detecting hyperglycemia during the previous 2 to 3 wk in infants could predict the development of retinopathy of prematurity in very low birth weight infants. One hundred sixty seven premature infants who had a birth weight of < 1500 g and a gestational age of less than 32 wk were investigated in the present study. Blood glucose was measured at the bedside and infants were recorded as hyperglycemic if their mean blood glucose levels were higher than 150 mg/dL. Serum corrected fructosamine level was obtained from the cord blood at birth and after the first month of life. The infants' eyes were examined by ophthalmologists to detect retinopathy of prematurity at the gestational age of 32 wk or at four wk after birth, whichever came first. Corrected fructosamine was 319.6 ± 59.6 and 272.8 ± 50.6 mmol/l for group 1 on 1(st) and 30(th) day respectively; 320 ± 61.7 and 268.2 ± 47.3 mmol/l for groups 2 + 3 on 1(st) and 30(th) day respectively which did not differ between groups (p = 0.766 and p = 0.665), whereas duration of hyperglycemia was 1.69 ± 1.1 day in group 1 compared with 3.05 ± 2.4 day in groups 2 + 3 which was significantly different (p = 0.019). The multivariate regression analysis indicated that the duration of hyperglycemia in days was significantly correlated with the development of retinopathy of prematurity (OR 3.26; 95% CI 1.09-9.80; p = 0.035). Although the duration of hyperglycemia may contribute to the development of retinopathy of prematurity, serum corrected fructosamine does not have a good predictive value in developing retinopathy of prematurity in very-low-birth-weight (VLBW) infants.

  20. Establishment of hepatocellular carcinoma multidrug resistant monoclone cell line HepG2/mdr1

    Institute of Scientific and Technical Information of China (English)

    CHEN Yong-bing; XIE Jian-guo; YANG Jia-yin; YAN Lü-nan; YAN Mao-lin; GONG Jian-ping; XIA Ren-pin; LIU Li-xin; LI Ning; LU Shi-chun; ZHANG Jing-guang; ZENG Dao-bing

    2007-01-01

    Background The multidrug resistance (MDR) associated with the expression of the mdr1 gene and its product P-glycoprotein is a major factor in the prognosis of hepatocellular carcinoma cell (HCC) patients treated with chemotherapy. Our study was to establish a stable HCC MDR cell line where a de novo acquisition of multidrug resistance specifically related to overexpression of a transgenic mdr1.Methods The 4.5-kb mdr1 cDNA obtained from the plasmid pHaMDR1-1 was cloned into the PCI-neo mammalian expression vector, later was transferred by liposome to human hepatocarcinoma cell line HepG2. Then the transfected HepG2 cells resisting G418 were clustered and cultured and the specific fragment of mdr1 cDNA, mRNA and the P-glycoprotein (Pgp) in these HepG2 cells were detected by PCR, RT-PCR and flow cytometry, respectively. The accumulation of the daunorubicin was determinated by flow cytometry simultaneously. The nude mice model of grafting tumour was established by injecting subcutaneously HepG2/mdr1 cells in the right axilla. When the tumour diameter reached 5 mm, adriamycin was injected into peritoneal cavity. The size and growth inhibition of tumour were evaluated.Results The mdr1 expression vector was constructed successfully and the MDR HCC line HepG2/mdr1 developed.The PCR analysis showed that the specific fragment of mdr1 cDNA in HepG2/mdr1 cells, but not in the control group HepG2 cells. Furthermore, the content of the specific fragment of mdr1 mRNA and Pgp expression in HepG2/mdr1 cells were (59.7±7.9)% and (12.28±2.09)%, respectively, compared with (16.9±3.2)% and (3.07±1.06)% in HepG2 cells.In the nude mice HCC model, the tumour genes of both groups were identified. After ADM therapy, the mean size of HepG2 cell tumours was significantly smaller than HepG2/mdr1 cell tumours.Conclusion The approach using the transfer of mdr1 cDNA may be applicable to the development of MDR hepatocarcinoma cell line, whose MDR mechanism is known. This would provide the

  1. Three-dimensional structure of the human myeloma IgG2.

    Directory of Open Access Journals (Sweden)

    Sergey Ryazantsev

    Full Text Available Human immunoglobulin G, subclass 2 (hIgG2, plays an important role in immunity to bacterial pathogens and in numerous pathological conditions. However, there is a lack of information regarding the three-dimensional (3D structure of the hIgG2 molecule. We used electron microscopy (EM, differential scanning microcalorimetry (DSC and fluorescence for structural analysis of the hIgG2. DSC and fluorescence indicated two types of interaction between CH1 domain of Fab (antigen-binding fragment/subunit and CH2 domain of Fc (complement fixation fragment/subunit simultaneously present in the sample: close interaction, which increases the thermostability of both, CH1 and CH2 domains, and weak (or no interaction, which is typical for most IgGs but not hIgG2. Thermodynamics could not determine if both types of interactions are present within a single molecule. To address this question, EM was used. We employed a single-particle reconstruction and negative staining approach to reveal the three-dimensional structure of the hIgG2. A three-dimensional model of hIgG2 was created at 1.78 nm resolution. The hIgG2 is asymmetrical: one Fab subunit is in close proximity to the upper portion of the Fc subunit (CH2 domain and the other Fab is distant from Fc. The plane of Fab subunits is nearly perpendicular to Fc. EM structure of the hIgG2 is in good agreement with thermodynamic data: a Fab distant from Fc should exhibit a lower melting temperature while a Fab interacting with Fc should exhibit a higher melting temperature. Both types of Fab subunits exist within one molecule resembling an A/B hIgG2 isoform introduced earlier on physicochemical level by Dillon et al. (2008. In such an arrangement, the access to the upper portion of Fc subunit is partially blocked by a Fab subunit. That might explain for instance why hIgG2 mildly activates complement and binds poorly to Fc receptors. Understanding of the three-dimensional structure of the hIgG2 should lead to better

  2. High Permissivity of Human HepG2 Hepatoma Cells for Influenza Viruses

    OpenAIRE

    Ollier, Laurence; Caramella, Anne; Giordanengo, Valérie; Lefebvre, Jean-Claude

    2004-01-01

    Human HepG2 hepatoma cells are highly permissive for influenza virus type A and type B, even without the addition of trypsin, and they exhibit a marked cytopathic effect. This property greatly facilitates the primary isolation of influenza viruses. Virus replication was significantly reduced by the plasmin(ogen)-specific inhibitor tranexamic acid, and this suggests a potential role played by the plasminogen/tissue plasminogen activator complex at the surface of HepG2 cells. This might represe...

  3. Precision measurement of the proton and deuteron spin structure functions g2 and asymmetries A2

    Science.gov (United States)

    E155 Collaboration; Anthony, P. L.; Arnold, R. G.; Averett, T.; Band, H. R.; Benmouna, N.; Boeglin, W.; Borel, H.; Bosted, P. E.; Bültmann, S. L.; Court, G. R.; Crabb, D.; Day, D.; Decowski, P.; Depietro, P.; Egiyan, H.; Erbacher, R.; Erickson, R.; Fatemi, R.; Frlez, E.; Griffioen, K. A.; Harris, C.; Hughes, E. W.; Hyde-Wright, C.; Igo, G.; Johnson, J.; King, P.; Kramer, K.; Kuhn, S. E.; Lawrence, D.; Liang, Y.; Lindgren, R.; Lombard-Nelsen, R. M.; McKee, P.; McNulty, D. E.; Meyer, W.; Mitchell, G. S.; Mitchell, J.; Olson, M.; Penttila, S.; Peterson, G. A.; Pitthan, R.; Pocanic, D.; Prepost, R.; Prescott, C.; Raue, B. A.; Reyna, D.; Ryan, P.; Rochester, L. S.; Rock, S.; Rondon-Aramayo, O.; Sabatie, F.; Smith, T.; Sorrell, L.; Lorant, S. St.; Szalata, Z.; Terrien, Y.; Tobias, A.; Toole, T.; Trentalange, S.; Wesselmann, F. R.; Wright, T. R.; Zeier, M.; Zhu, H.; Zihlmann, B.

    2003-01-01

    We have measured the spin structure functions g2p and g2d and the virtual photon asymmetries A2p and A2d over the kinematic range /0.020. The Efremov-Leader-Teryaev integral is consistent with zero within our measured kinematic range. The absolute value of A2 is significantly smaller than the A2<√R(1+A1)/2 limit.

  4. On twistor transformations and invariant differential operator of simple Lie group G2(2)

    Science.gov (United States)

    Wang, Wei

    2013-01-01

    The twistor transformations associated to the simple Lie group G2 are described explicitly. We consider the double fibration G_2/P_2 xleftarrow {η } {G_2/B} xrArr {tau }G_2/P_1, where P1 and P2 are two parabolic subgroups of G2 and B is a Borel subgroup, and its local version: H^*_2 xleftarrow {η } F xrArr {tau } H_1, where H_1 is the Heisenberg group of dimension 5 embedded in the coset space G2/P1, F = {CP}^1 × H_1 and H^*_2 contains the nilpotent Lie group H_2 of step three. The Baker-Campbell-Hausdorff formula is used to parametrize the coset spaces, coordinates charts, their transition functions and the fibers of the projection η as complex curves. We write down the relative De-Rham sequence on F along the fibers and push it down to H_1 to get a family of matrix-valued differential operators {D}_k. Then we establish a kind of Penrose correspondence for G2: the kernel of {D}_k is isomorphic to the first cohomology of the sheaf {O} (-k ) over H^*_2. We also give the Penrose-type integral transformation u = Pf for fin {O} (-k ), which gives solutions to equations {D}_ku=0. When restricted to the real Heisenberg group, the differential operators are invariant under the action of G2(2). Exchanging P1 and P2, we derive corresponding results on H_2.

  5. The circadian variation of premature atrial contractions

    DEFF Research Database (Denmark)

    Larsen, Bjørn Strøier; Kumarathurai, Preman; Nielsen, Olav W

    2016-01-01

    AIMS: The aim of the study was to assess a possible circadian variation of premature atrial contractions (PACs) in a community-based population and to determine if the daily variation could be used to assess a more vulnerable period of PACs in predicting later incidence of atrial fibrillation (AF...... variation in heart rate. After adjusting for relevant risk factors, the risk of AF was equal in all time intervals throughout the day. CONCLUSION: Premature atrial contractions showed a circadian variation in subjects with frequent PACs. No specific time interval of the day was more predictive of AF than...

  6. Xanthorrhizol induced DNA fragmentation in HepG2 cells involving Bcl-2 family proteins

    Energy Technology Data Exchange (ETDEWEB)

    Tee, Thiam-Tsui, E-mail: thiamtsu@yahoo.com [School of Biosciences and Biotechnology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Cheah, Yew-Hoong [School of Biosciences and Biotechnology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Bioassay Unit, Herbal Medicine Research Center, Institute for Medical Research, Jalan Pahang, Kuala Lumpur (Malaysia); Meenakshii, Nallappan [Biology Department, Faculty of Science, Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Mohd Sharom, Mohd Yusof; Azimahtol Hawariah, Lope Pihie [School of Biosciences and Biotechnology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)

    2012-04-20

    Highlights: Black-Right-Pointing-Pointer We isolated xanthorrhizol, a sesquiterpenoid compound from Curcuma xanthorrhiza. Black-Right-Pointing-Pointer Xanthorrhizol induced apoptosis in HepG2 cells as observed using SEM. Black-Right-Pointing-Pointer Apoptosis in xanthorrhizol-treated HepG2 cells involved Bcl-2 family proteins. Black-Right-Pointing-Pointer DNA fragmentation was observed in xanthorrhizol-treated HepG2 cells. Black-Right-Pointing-Pointer DNA fragmentation maybe due to cleavage of PARP and DFF45/ICAD proteins. -- Abstract: Xanthorrhizol is a plant-derived pharmacologically active sesquiterpenoid compound isolated from Curcuma xanthorrhiza. Previously, we have reported that xanthorrhizol inhibited the proliferation of HepG2 human hepatoma cells by inducing apoptotic cell death via caspase activation. Here, we attempt to further elucidate the mode of action of xanthorrhizol. Apoptosis in xanthorrhizol-treated HepG2 cells as observed by scanning electron microscopy was accompanied by truncation of BID; reduction of both anti-apoptotic Bcl-2 and Bcl-X{sub L} expression; cleavage of PARP and DFF45/ICAD proteins and DNA fragmentation. Taken together, these results suggest xanthorrhizol as a potent antiproliferative agent on HepG2 cells by inducing apoptosis via Bcl-2 family members. Hence we proposed that xanthorrhizol could be used as an anti-liver cancer drug for future studies.

  7. Cytostatic and genotoxic effect of temephos in human lymphocytes and HepG2 cells.

    Science.gov (United States)

    Benitez-Trinidad, A B; Herrera-Moreno, J F; Vázquez-Estrada, G; Verdín-Betancourt, F A; Sordo, M; Ostrosky-Wegman, P; Bernal-Hernández, Y Y; Medina-Díaz, I M; Barrón-Vivanco, B S; Robledo-Marenco, M L; Salazar, A M; Rojas-García, A E

    2015-06-01

    Temephos is an organophosphorus pesticide that is used in control campaigns against Aedes aegypti mosquitoes, which transmit dengue. In spite of the widespread use of temephos, few studies have examined its genotoxic potential. The aim of this study was to evaluate the cytotoxic, cytostatic and genotoxic effects of temephos in human lymphocytes and hepatoma cells (HepG2). The cytotoxicity was evaluated with simultaneous staining (FDA/EtBr). The cytostatic and genotoxic effects were evaluated using comet assays and the micronucleus technique. We found that temephos was not cytotoxic in either lymphocytes or HepG2 cells. Regarding the cytostatic effect in human lymphocytes, temephos (10 μM) caused a significant decrease in the percentage of binucleated cells and in the nuclear division index as well as an increase in the apoptotic cell frequency, which was not the case for HepG2 cells. The comet assay showed that temephos increased the DNA damage levels in human lymphocytes, but it did not increase the MN frequency. In contrast, in HepG2 cells, temephos increased the tail length, tail moment and MN frequency in HepG2 cells compared to control cells. In conclusion, temephos causes stable DNA damage in HepG2 cells but not in human lymphocytes. These findings suggest the importance of temephos biotransformation in its genotoxic effect.

  8. Anti-hepatocarcinoma effects of resveratrol nanoethosomes against human HepG2 cells

    Science.gov (United States)

    Meng, Xiang-Ping; Zhang, Zhen; Chen, Tong-sheng; Wang, Yi-fei; Wang, Zhi-ping

    2017-02-01

    Hepatocarcinoma, a malignant cancer, threaten human life badly. It is a current issue to seek the effective natural remedy from plant to treat cancer due to the resistance of the advanced hepatocarcinoma to chemotherapy. Resveratrol (Res) has been widely investigated with its strong anti-tumor activity. However, its low oral bioavailability restricts its wide application. In this study, we prepared resveratrol nanoethosomes (ResN) via ethanol injection method. The in vitro anti-hepatocarcinoma effects of ResN relative to efficacy of bulk Res were evaluated on proliferation and apoptosis of human HepG2 cells. ResN were spherical vesicles and its particle diameter, zeta potential were (115.8 +/- 1.3) nm and (-12.8 +/- 1.9) mV, respectively. ResN exhibited significant inhibitory effects against human HepG2 cells by MTT assay, and the IC50 value was 49.2 μg/ml (105.4 μg/ml of Res bulk solution). By flow cytometry assay, there was an increase in G2/M phase cells treated with ResN. The results demonstrated ResN could effectively block the G2/M phase of HepG2 cells, which can also enhance the inhibitory effect of Res against HepG2 cells.

  9. Dovitinib induces mitotic defects and activates the G2 DNA damage checkpoint.

    Science.gov (United States)

    Man, Wing Yu; Mak, Joyce P Y; Poon, Randy Y C

    2014-01-01

    Dovitinib (TKI258; formerly CHIR-258) is an orally bioavailable inhibitor of multiple receptor tyrosine kinases. Interestingly, Dovitinib triggered a G2 /M arrest in cancer cell lines from diverse origins including HeLa, nasopharyngeal carcinoma, and hepatocellular carcinoma. Single-cell analysis revealed that Dovitinib promoted a delay in mitotic exit in a subset of cells, causing the cells to undergo mitotic slippage. Higher concentrations of Dovitinib induced a G2 arrest similar to the G2 DNA damage checkpoint. In support of this, DNA damage was triggered by Dovitinib as revealed by γ-H2AX and comet assays. The mitotic kinase CDK1 was found to be inactivated by phosphorylation in the presence of Dovitinib. Furthermore, the G2 arrest could be overcome by abrogation of the G2 DNA damage checkpoint using small molecule inhibitors of CHK1 and WEE1. Finally, Dovitinib-mediated G2 cell cycle arrest and subsequent cell death could be promoted after DNA damage repair was disrupted by inhibitors of poly(ADP-ribose) polymerases. These results are consistent with the recent finding that Dovitinib can also target topoisomerases. Collectively, these results suggest additional directions for use of Dovitinib, in particular with agents that target the DNA damage checkpoint.

  10. Suppression of E-cadherin mediates gallotannin induced apoptosis in Hep G2 hepatocelluar carcinoma cells.

    Science.gov (United States)

    Han, Hee Jeong; Kwon, Hee Young; Sohn, Eun Jung; Ko, Hyunsuk; Kim, Bogeun; Jung, Kwon; Lew, Jae Hwan; Kim, Sung-Hoon

    2014-01-01

    Though gallotannin was known to have anti-oxidant and antitumor activity, the underlying antitumor mechanism of gallotannin still remains unclear. Thus, in the present study, antitumor mechanism of gallotannin was elucidated in hepatocellular carcinoma cells. Gallotannin significantly exerted cytotoxicity against Hep G2 and Chang hepatocellular carcinoma cells with the accumulation of the sub-G1 population and increase of terminal deoxynucleotidyltransferasedUTP nick end labeling (TUNEL) positive cells as an apoptotic feature. Also, gallotannin attenuated the expression of pro-caspase9, pro-caspase3, Bcl2 and integrin β1 and cleaved poly(ADP)-ribose polymerase (PARP) in Hep G2 and Chang cancer cells. Furthermore, gallotannin suppressed cell repair motility by wound healing assay and also inhibited cell adhesion in Hep G2 cells. Of note, gallotannin attenuated the expression of epithelial cadherin (E-cadherin) to form cell-cell adhesion from the early stage, and also beta-catenin at late phase in Hep G2 cells. Consistently, Immunofluorescence assay showed that E-cadherin or β-catenin expression was suppressed in a time dependent manner by gallotannin. Furthermore, silencing of E-cadherin by siRNA transfection method enhanced PAPR cleavage, caspase 3 activation and sub G1 population and attenuated the cell adhesion induced by gallotannin in Hep G2 cells. Overall, our findings demonstrate that the disruption of cell adhesion junction by suppression of E-cadherin mediates gallotannin enhanced apoptosis in Hep G2 liver cancer cells.

  11. Antitumor effects of polysaccharide from Sargassum fusiforme against human hepatocellular carcinoma HepG2 cells.

    Science.gov (United States)

    Fan, Sairong; Zhang, Junfeng; Nie, Wenjian; Zhou, Wenyuan; Jin, Liqin; Chen, Xiaoming; Lu, Jianxin

    2017-04-01

    Sargassum fusiforme (Harv.) Setchel, a kind of brown algae, has been applied as a therapeutic for thousands of years. This study was designed to investigate the antitumor effects of the polysaccharide (SFPS) from S. fusiform in liver cancer. The mice inoculated with HepG2 cells were orally administrated with SFPS at the doses of 100, 200 and 400 mg/kg body weight for 28 days. The products from peritoneal macrophages and serum in HepG2-bearing mice were measured. The effect of SFPS-induced cell apoptosis was measured by flow cytometry. Meanwhile, the expression levels of Bax and Bcl-2 were detected. Furthermore, the cytotoxicity of SFPS was evaluated by CCK-8 assay. Results showed that SFPS significantly inhibited growth of human HepG2 cell-transplanted tumor in nude mice, and remarkably increased serum TNF-α, IL-1, NO and IgM levels in HepG2-bearing mice. SFPS also promoted the cytokines (IL-1 and TNF-α) secreted by peritoneal macrophages in HepG2-bearing mice. SFPS exerted a stimulatory effect on apoptosis of HepG2 cells, increased the expression of Bax, and decreased the expression of Bcl-2. The results indicated that SFPS has anti-tumor and immunomodulatory activities at the high concentration, and it could be used as a potential chemopreventative and/or adjuvant chemotherapeutic agent in liver cancer. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Cyclin G2 Promotes Hypoxia- Driven Local Invasion of Glioblastoma by Orchestrating Cytoskeletal Dynamics

    Directory of Open Access Journals (Sweden)

    Atsushi Fujimura

    2013-11-01

    Full Text Available Microenvironmental conditions such as hypoxia potentiate the local invasion of malignant tumors including glioblastomas by modulating signal transduction and protein modification, yet the mechanism by which hypoxia controls cytoskeletal dynamics to promote the local invasion is not well defined. Here, we show that cyclin G2 plays pivotal roles in the cytoskeletal dynamics in hypoxia-driven invasion by glioblastoma cells. Cyclin G2 is a hypoxia-induced and cytoskeleton-associated protein and is required for glioblastoma expansion. Mechanistically, cyclin G2 recruits cortactin to the juxtamembrane through its SH3 domain-binding motif and consequently promotes the restricted tyrosine phosphorylation of cortactin in concert with src. Moreover, cyclin G2 interacts with filamentous actin to facilitate the formation of membrane ruffles. In primary glioblastoma, cyclin G2 is abundantly expressed in severely hypoxic regions such as pseudopalisades, which consist of actively migrating glioma cells. Furthermore, we show the effectiveness of dasatinib against hypoxia-driven, cyclin G2-involved invasion in vitro and in vivo. Our findings elucidate the mechanism of cytoskeletal regulation by which severe hypoxia promotes the local invasion and may provide a therapeutic target in glioblastoma.

  13. Nonequilibrium Thermodynamics of Wealth Condensation

    CERN Document Server

    Braun, D

    2006-01-01

    We analyze wealth condensation for a wide class of stochastic economy models on the basis of the economic analog of thermodynamic potentials, termed transfer potentials. The economy model is based on three common transfers modes of wealth: random transfer, profit proportional to wealth and motivation of poor agents to work harder. The economies never reach steady state. Wealth condensation is the result of stochastic tunneling through a metastable transfer potential. In accordance with reality, both wealth and income distribution transiently show Pareto tails for high income subjects. For metastable transfer potentials, exponential wealth condensation is a robust feature. For example with 10 % annual profit 1% of the population owns 50 % of the wealth after 50 years. The time to reach such a strong wealth condensation is a hyperbolic function of the annual profit rate.

  14. Solar engineering - a condensed course

    Energy Technology Data Exchange (ETDEWEB)

    Broman, Lars

    2011-11-15

    The document represents the material covered in a condensed two-week course focusing on the most important thermal and PV solar energy engineering topics, while also providing some theoretical background.

  15. Nuclear fusion inside condense matters

    Institute of Scientific and Technical Information of China (English)

    HE Jing-tang

    2007-01-01

    This article describes in detail the nuclear fusion inside condense matters--the Fleischmann-Pons effect, the reproducibility of cold fusions, self-consistentcy of cold fusions and the possible applications.

  16. Cyclin G2 suppresses estrogen-mediated osteogenesis through inhibition of Wnt/β-catenin signaling.

    Directory of Open Access Journals (Sweden)

    Jinlan Gao

    Full Text Available Estrogen plays an important role in the maintenance of bone formation, and deficiency in the production of estrogen is directly linked to postmenopausal osteoporosis. To date, the underlying mechanisms of estrogen-mediated osteogenic differentiation are not well understood. In this study, a pluripotent mesenchymal precursor cell line C2C12 was used to induce osteogenic differentiation and subjected to detection of gene expressions or to manipulation of cyclin G2 expressions. C57BL/6 mice were used to generate bilateral ovariectomized and sham-operated mice for analysis of bone mineral density and protein expression. We identified cyclin G2, an unconventional member of cyclin, is involved in osteoblast differentiation regulated by estrogen in vivo and in vitro. In addition, the data showed that ectopic expression of cyclin G2 suppressed expression of osteoblast transcription factor Runx2 and osteogenic differentiation marker genes, as well as ALP activity and in vitro extracellular matrix mineralization. Mechanistically, Wnt/β-catenin signaling pathway is essential for cyclin G2 to inhibit osteogenic differentiation. To the best of our knowledge, the current study presents the first evidence that cyclin G2 serves as a negative regulator of both osteogenesis and Wnt/β-catenin signaling. Most importantly, the basal and 17β-estradiol-induced osteogenic differentiation was restored by overexpression of cyclin G2. These results taken together suggest that cyclin G2 may function as an endogenous suppressor of estrogen-induced osteogenic differentiation through inhibition of Wnt/β-catenin signaling.

  17. Overexpression of Bmi‑1 promotes epithelial‑mesenchymal transition in CD133+Hep G2 cells.

    Science.gov (United States)

    Zhang, Zefeng; Wang, Qiyi; Bu, Xiaoling; Zhang, Chuangqiang; Chen, Hao; Sha, Weihong; Liu, Wanwei

    2017-08-24

    Cancer stem cells (CSCs) and epithelial‑mesenchymal transition (EMT) are critical factors contributing to tumor metastasis and recurrence. The BMI1 proto‑oncogene (Bmi‑1) promotes the development and progression of hematologic malignancies and of several types of solid tumors. The aim of the present study was to explore the mechanism by which Bmi‑1 may promote invasion and migration of hepatocellular carcinoma Hep G2 cells. CD133 antigen is a transmembrane glycoprotein and regarded as a cancer stem cells marker in hepatocellular carcinoma. CD133+Hep G2 cells were enriched by magnetic‑activated cell sorting and exhibited greater viability compared with CD133‑Hep G2 cells, as measured by Cell Counting kit‑8 assay. Then, Bmi‑1 was overexpressed in CD133+Hep G2 cells by transfection with the Bmi‑1/pcDNA3.1(+) expression plasmid, and overexpression was confirmed by reverse‑transcription‑polymerase chain reaction and western blotting. Overexpression of Bmi‑1in CD133+Hep G2 cells resulted in the downregulation of E‑cadherin and upregulation of Vimentin at the protein level. The invasion and migration abilities of CD133+Hep G2 cells were increased in the Bmi‑1/pcDNA3.1(+)‑transfected group, as measured by Transwell invasion and wound healing assays, respectively. In conclusion, Bmi‑1 promoted invasion and migration of CD133+Hep G2 cells most likely through inducing EMT. The present findings may offer a potential novel target for the development of hepatocellular carcinoma therapies.

  18. Inhibition of aldose reductase ameliorates ethanol‑induced steatosis in HepG2 cells.

    Science.gov (United States)

    Qiu, Longxin; Cai, Chengchao; Zhao, Xiangqian; Fang, Yan; Tang, Weibiao; Guo, Chang

    2017-05-01

    Aldose reductase (AR) expression is increased in liver tissue of patients with ethanol‑induced liver disease. However, the exact role of AR in the development of ethanol‑induced liver disease has yet to be elucidated. The present study aimed to determine the effect of an AR inhibitor on ethanol‑induced steatosis in HepG2 cells and to identify possible underlying molecular mechanisms. Steatosis was induced in HepG2 cells by stimulating cells with 100 mM absolute ethanol for 48 h. Oil Red O staining was used to detect the lipid droplet accumulation in cells. Western blot analyses were used to determine protein expression levels and reverse transcription‑quantitative polymerase chain reaction was used to analyze mRNA expression levels. The results showed that AR protein expression was elevated in HepG2 cells stimulated with ethanol. HepG2 cells exhibited marked improvement of ethanol‑induced lipid accumulation following treatment with the AR inhibitor zopolrestat. Phosphorylation levels of 5' adenosine monophosphate‑activated protein kinase (AMPK) were markedly higher, whereas the mRNA expression levels of sterol‑regulatory element‑binding protein (SREBP)‑1c and fatty acid synthase (FAS) were significantly lower in zopolrestat‑treated and ethanol‑stimulated HepG2 cells compared with in untreated ethanol‑stimulated HepG2 cells. In addition, zopolrestat inhibited the ethanol‑induced expression of tumor necrosis factor (TNF)‑α. These results suggested that zopolrestat attenuated ethanol‑induced steatosis by activating AMPK and subsequently inhibiting the expression of SREBP‑1c and FAS, and by suppressing the expression of TNF‑α in HepG2 cells.

  19. Developmental Stage-Specific Embryonic Induction of HepG2 Cell Differentiation.

    Science.gov (United States)

    Li, Yanning; Zong, Yanhong; Xiao, Zhigang; Zhu, Mengxuan; Xiao, Hui; Qi, Jinsheng; Liu, Kun; Wang, Hui

    2016-04-01

    Although hepatocellular carcinoma cells can sometimes undergo differentiation in an embryonic microenvironment, the mechanism is poorly understood. The developmental stage-specific embryonic induction of tumor cell differentiation was investigated. Both chick and mouse liver extracts and hepatoblast-enriched cells at different developmental stages were used to treat human hepatoma HepG2 cells, and the effects on the induction of differentiation were evaluated. The nuclear factors controlling differentiation, hepatocyte nuclear factor (HNF)-4α, HNF-1α, HNF-6 and upstream stimulatory factor-1 (USF-1), and the oncogene Myc and alpha-fetoprotein (AFP) were measured. HNF-4α RNA interference was used to verify the role of HNF-4α. Embryonic induction effects were further tested in vivo by injecting HepG2 tumor cells into immunodeficient nude mice. The 9-11-days chick liver extracts and 13.5-14.5-days mouse hepatoblast-enriched cells could inhibit proliferation and induce differentiation of HepG2 cells, leading to either death or maturation to hepatocytes. The maturation of surviving HepG2 cells was confirmed by increases in the expressions of HNF-4α, HNF-1α, HNF-6, and USF-1, and decreases in Myc and AFP. The embryonic induction of HepG2 cell maturation could be attenuated by HNF-4α RNA interference. Furthermore, the 13.5-days mouse hepatoblast culture completely eliminated HepG2 tumors with inhibited Myc and induced HNF-4α, confirming this embryonic induction effect in vivo. This study demonstrated that developmental stage-specific embryonic induction of HepG2 cell differentiation might help in understanding embryonic differentiation and oncogenesis.

  20. Altered cellular metabolism of HepG2 cells caused by microcystin-LR.

    Science.gov (United States)

    Ma, Junguo; Feng, Yiyi; Jiang, Siyu; Li, Xiaoyu

    2017-06-01

    This study aimed to evaluate the possible effects of microcystin-LR (MC-LR) exposure on the metabolism and drug resistance of human hepatocellular carcinoma (HepG2) cells. For this purpose, we first conducted an experiment to make sure that MC-LR could penetrate the HepG2 cell membrane effectively. The transcriptional levels of phase I (such as CYP2E1, CYP3A4, and CYP26B1) and phase II (such as EPHX1, SULTs, and GSTM) enzymes and export pump genes (such as MRP1 and MDR1) were altered by MC-LR-exposure for 24 h, indicating that MC-LR treatment may destabilize the metabolism of HepG2 cells. Further research showed that the CYP inducers omeprazole, ethanol, and rifampicin inhibited cell viability, in particular, ethanol, a CYP2E1 inducer, induced ROS generation, lipid peroxidation, and apoptosis in HepG2 cells treated with MC-LR. The CYP2E1 inhibitor chlormethiazole inhibited ROS generation, mitochondrial membrane potential loss, caspase-3 activity, and cytotoxicity caused by MC-LR. Meanwhile, the results also showed that co-incubation with the ROS scavenger l-ascorbic acid and MC-LR decreased ROS levels and effectively prevented apoptosis. These findings provide an interesting mechanistic explanation of cellular metabolism associated with MC-LR, i.e., MC-LR-exposure exerted toxicity on HepG2 cells and induced apoptosis of HepG2 cells via promoting CYP2E1 expression and inducing excessive ROS in HepG2 cells. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Ammonia metabolism capacity of HepG2 cells with high expression of human glutamine synthetase

    Institute of Scientific and Technical Information of China (English)

    Nan-Hong Tang; Xiao-Qian Wang; Xiu-Jin Li; Yan-Ling Chen

    2008-01-01

    BACKGROUND:Currently, one of the tough problems for the application of bioartiifcial liver (BAL) is the shortage of suitable hepatocytes. There are reports on different types of BAL assistance developed with porcine hepatocytes and HepG2 C3A cells, but their defects are obvious. In recent years, some studies focus more on liver cells with features of human origin and improved detoxiifcation. In this study, a hepatocyte line with high expression of human glutamine synthetase (hGS) was raised and its capacity for ammonia metabolism was investigated. METHODS:hGS cDNA and alpha-fetoprotein transcription regulatory element (AFP-TRE) were cloned with the designed primers. The eukaryotic expression vectors, pLNChGS and pLNAFhGS, were constructed and transfected into PA317 cells. Recombinant retroviruses (Retro-hGS and Retro-AFhGS) were produced and then infected into HepG2 cells. G418-resistant cell clones, HepG2/pLNChGS and HepG2/pLNAFhGS, were selected and ampliifed. Then hGS mRNA was measured by semi-quantitative RT-PCR;hGS enzymatic activity and ammonia metabolism analysis in different concentration of NH4+were detected with a quantitative biochemistry kit. The cell proliferation was also detected by MTT chromatometry. RESULTS:The expression of hGS mRNA in HepG2/pLNChGS cells (8.306±0.336) and HepG2/pLNAFhGS cells (21.358±1.716) was much stronger than in control cells (P CONCLUSION:The constructed hepatocytes (HepG2 cells) with speciifc high-expression of hGS have a powerful ability to degrade ammonia in vitro, and provide necessary experimental data for the selection of biomaterials in BAL.

  2. Selective Cytotoxicity of Goniothalamin against Hepatoblastoma HepG2 Cells

    Directory of Open Access Journals (Sweden)

    Noorjahan B. Alitheen

    2011-04-01

    Full Text Available Liver cancer has become one of the major types of cancer with high mortality and liver cancer is not responsive to the current cytotoxic agents used in chemotherapy. The purpose of this study was to examine the in vitro cytotoxicity of goniothalamin on human hepatoblastoma HepG2 cells and normal liver Chang cells. The cytotoxicity of goniothalamin against HepG2 and liver Chang cell was tested using MTT cell viability assay, LDH leakage assay, cell cycle flow cytometry PI analysis, BrdU proliferation ELISA assay and trypan blue dye exclusion assay. Goniothalamin selectively inhibited HepG2 cells [IC50 = 4.6 (±0.23 µM in the MTT assay; IC50 = 5.20 (±0.01 µM for LDH assay at 72 hours], with less sensitivity in Chang cells [IC50 = 35.0 (±0.09 µM for MTT assay; IC50 = 32.5 (±0.04 µM for LDH assay at 72 hours]. In the trypan blue dye exclusion assay, the Viability Indexes were 52 ± 1.73% for HepG2 cells and 62 ± 4.36% for Chang cells at IC50 after 72 hours. Cytotoxicity of goniothalamin was related to inhibition of DNA synthesis, as revealed by the reduction of BrdU incorporation. At 72 hours, the lowest concentration of goniothalamin (2.3 µL retained 97.6% of normal liver Chang cells proliferation while it reduced HepG2 cell proliferation to 19.8% as compared to control. Besides, goniothalamin caused accumulation of hypodiploid apoptosis and different degree of G2/M arrested as shown in cell cycle analysis by flow cytometry. Goniothalamin selectively killed liver cancer cell through suppression of proliferation and induction of apoptosis. These results suggest that goniothalamin shows potential cytotoxicity against hepatoblastoma HepG2 cells.

  3. AMH as Predictor of Premature Ovarian Insufficiency

    DEFF Research Database (Denmark)

    Lunding, Stine Aa; Aksglæde, Lise; Anderson, Richard A

    2015-01-01

    CONTEXT: The majority of Turner syndrome (TS) patients suffer from accelerated loss of primordial follicles. Low circulating levels of anti-Müllerian hormone (AMH) may predict the lack of spontaneous puberty in prepubertal girls and imminent premature ovarian insufficiency (POI) in TS women...

  4. Premature ovarian failure and ovarian autoimmunity

    NARCIS (Netherlands)

    J.A. Schoemaker (Joop); H.A. Drexhage (Hemmo); A. Hoek (Annemieke)

    1997-01-01

    textabstractPremature ovarian failure (POF) is defined as a syndrome characterized by menopause before the age of 40 yr. The patients suffer from anovulation and hypoestrogenism. Approximately 1% of women will experience menopause before the age of 40 yr. POF is a

  5. [Nontraumatic chylopericardium and chylothorax in premature neonates].

    Science.gov (United States)

    Avrel'kina, E A; Ignat'eva, E N; Fediarova, M A; Pliukhin, S V

    2014-01-01

    Deaths of extremely premature babies undiagnosed as having spontaneous chylopericardium (CP) and chylothorax (CT) are analyzed. The specific features of these death cases are the polyetiology of CP/CT and the similarity of their pathogenesis in the absence of specific clinical symptomatology.

  6. Catheter ablation of parahisian premature ventricular complex.

    Science.gov (United States)

    Kim, Jun; Kim, Jeong Su; Park, Yong Hyun; Kim, June Hong; Chun, Kook Jin

    2011-12-01

    Catheter ablation is performed in selected patients with a symptomatic premature ventricular complex (PVC) or PVC-induced cardiomyopathy. Ablation of PVC from the His region has a high risk of inducing a complete atrioventricular block. Here we report successful catheter ablation of a parahisian PVC in a 63-year-old man.

  7. Liver Abscess: Increasing Occurrence in Premature Newborns

    Directory of Open Access Journals (Sweden)

    OKTAV BOSNALI

    2013-03-01

    Full Text Available Neonatal liver abscess is a very rare condition associated with high morbidity and mortality rates. There seems to be an increasing trend of this rare condition amongst the newborns admitted to neonatal intensive care units. We report a case of liver abscess in a premature newborn and briefly review the literature and discuss its management.

  8. Liver Abscess: Increasing Occurrence in Premature Newborns

    Science.gov (United States)

    Bosnalı, Oktav; Moralıoğlu, Serdar; Pektaş, Osman

    2013-01-01

    Neonatal liver abscess is a very rare condition associated with high morbidity and mortality rates. There seems to be an increasing trend of this rare condition amongst the newborns admitted to neonatal intensive care units. We report a case of liver abscess in a premature newborn and briefly review the literature and discuss its management. PMID:26023443

  9. Liver Abscess: Increasing Occurrence in Premature Newborns

    Directory of Open Access Journals (Sweden)

    Oktav Bosnalı

    2013-04-01

    Full Text Available Neonatal liver abscess is a very rare condition associated with high morbidity and mortality rates. There seems to be an increasing trend of this rare condition amongst the newborns admitted to neonatal intensive care units. We report a case of liver abscess in a premature newborn and briefly review the literature and discuss its management.

  10. Premature mortality in Japan due to ozone

    Science.gov (United States)

    Nawahda, Amin; Yamashita, Ken; Ohara, Toshimasa; Kurokawa, Junichi; Ohizumi, Tsuyoshi; Chen, Fang; Akimoto, Hajime

    2013-12-01

    In Japan, all 47 prefectures conduct routine air quality monitoring at 1145 stations throughout the country to assess environmental effects. This study aims to provide a better understanding of possible estimations of premature mortality in Japan caused by exposure to monitored and modeled concentrations of tropospheric ozone during the period from January to December, 2005. The spatial distribution and temporal variation of ozone concentrations were modeled using the Models-3 Community Multiscale Air Quality modeling system coupled with the Regional Emission Inventory in Asia (CMAQ/REAS). Premature mortality caused by exposure to ozone was calculated assuming a relative risk (RR) value of 1.003 [95% Confidence Interval (CI): 1.001-1.004] for concentrations above 35 ppb according to the SOMO35 index (annual Sum of daily maximum 8-h Ozone Means Over 35 ppb) recommended by WHO (2008). Based on CMAQ/REAS simulations, the estimated all-cause premature mortality in 2005 is about 13,000 (95% CI: 4320-17,300) cases. This value is 2.5 times greater than the estimated premature mortality based on monitored ozone concentrations, which is 5220 (95% CI: 1740-6960) cases.

  11. Optimal oxygen saturation in premature infants

    Directory of Open Access Journals (Sweden)

    Meayoung Chang

    2011-09-01

    Full Text Available There is a delicate balance between too little and too much supplemental oxygen exposure in premature infants. Since underuse and overuse of supplemental oxygen can harm premature infants, oxygen saturation levels must be monitored and kept at less than 95% to prevent reactive oxygen species-related diseases, such as retinopathy of prematurity and bronchopulmonary dysplasia. At the same time, desaturation below 80 to 85% must be avoided to prevent adverse consequences, such as cerebral palsy. It is still unclear what range of oxygen saturation is appropriate for premature infants; however, until the results of further studies are available, a reasonable target for pulse oxygen saturation (SpO2 is 90 to 93% with an intermittent review of the correlation between SpO2 and the partial pressure of arterial oxygen tension (PaO2. Because optimal oxygenation depends on individuals at the bedside making ongoing adjustments, each unit must define an optimal target range and set alarm limits according to their own equipment or conditions. All staff must be aware of these values and adjust the concentration of supplemental oxygen frequently.

  12. New Information About Premature Births (For Consumers)

    Centers for Disease Control (CDC) Podcasts

    2006-10-06

    A new study finds that prematurity is the most frequent cause of infant death in the United States. Learn more.  Created: 10/6/2006 by CDC Division of Reproductive Health.   Date Released: 10/6/2006.

  13. Human cytomegalovirus infections in premature infants by ...

    African Journals Online (AJOL)

    Owner

    clinical importance of CMV infection in premature infants by breast-feeding is still unclear. This mini- ... Transmission of CMV by natural routes relates ... infection from the fresh breast milk containing the virus. ... As a result of transmission during the course of delivery ... hepatitis was speculated to be caused by primary.

  14. Premature ovarian failure and ovarian autoimmunity

    NARCIS (Netherlands)

    J.A. Schoemaker (Joop); H.A. Drexhage (Hemmo); A. Hoek (Annemieke)

    1997-01-01

    textabstractPremature ovarian failure (POF) is defined as a syndrome characterized by menopause before the age of 40 yr. The patients suffer from anovulation and hypoestrogenism. Approximately 1% of women will experience menopause before the age of 40 yr. POF is a heter

  15. Premature ovarian failure and ovarian autoimmunity

    NARCIS (Netherlands)

    J.A. Schoemaker (Joop); H.A. Drexhage (Hemmo); A. Hoek (Annemieke)

    1997-01-01

    textabstractPremature ovarian failure (POF) is defined as a syndrome characterized by menopause before the age of 40 yr. The patients suffer from anovulation and hypoestrogenism. Approximately 1% of women will experience menopause before the age of 40 yr. POF is a heter

  16. Laterality in Prematurely-Born Children.

    Science.gov (United States)

    Segalwitz, Sidney J.; Chapman, Jacqueline S.

    The study examined the relationship between perinatal stress and decreased right handedness and decreased left cerebral dominance for speech with 215 children born prematurely, followed from birth, and tested at age 5. Results indicated that neither hand preference nor hand performance correlated with degree of perinatal stress and that eye…

  17. RESEARCH ON REDUCING PREMATURITY RUPTURE OF MEMBRANE

    Directory of Open Access Journals (Sweden)

    Maria URSACHI (BOLOTA

    2016-12-01

    Full Text Available The membranes surrounding the amniotic cavity are composed from amnion and chorion, tightly adherent layers which are composed of several cell types, including epithelial cells, trophoblasts cells and mesenchyme cells, embedded in a collagenous matrix. They retain amniotic fluid, secret substances into the amniotic fluid, as well as to the uterus and protect the fetus against upward infections from urogenital tract. Normally, the membranes it breaks during labor. Premature rupture of the amniotic sac (PRAS is defined as rupture of membranes before the onset of labor. Premature rupture of the fetal membrane, which occurs before 37 weeks of gestation, usually, refers to preterm premature rupture of membranes. Despite advances in the care period, premature rupture of membranes and premature rupture of membranes preterm continue to be regarded as serious obstetric complications. On the term 8% - 10% of pregnant women have premature rupture of membranes; these women are at increased risk of intrauterine infections, where the interval between membrane rupture and expulsion is rolled-over. Premature rupture of membranes preterm occurs in approximately 1% of all pregnancies and is associated with 30% -40% of preterm births. Thus, it is important to identify the cause of pre-term birth (after less than 37 completed weeks of "gestation" and its complications, including respiratory distress syndrome, neonatal infection and intraventricular hemorrhage. Objectives: the development of the protocol of the clinical trial on patients with impending preterm birth, study clinical and statistical on the socio-demographic characteristics of patients with imminent preterm birth; clinical condition of patients and selection of cases that could benefit from the application of interventional therapy; preclinical investigation (biological and imaging of patients with imminent preterm birth; the modality therapy; clinical investigation of the effectiveness of short

  18. Acute renal failure in premature neonates

    Directory of Open Access Journals (Sweden)

    Doronjski Aleksandra

    2009-01-01

    Full Text Available Background/Aim. Hemodynamic stress is the leading cause of acute renal failure (ARF in premature neonates. Incidence of ARF in this population is between 8 and 24%. The aim of this study was to determine the frequency of presence of ARF in premature neonates, as well as its impact on their survival. Methods. A retrospective study of 114 premature neonates [(gestational age, GA less than 37 gestation weeks (gw] admitted to the Intensive Care Unit (ICU at the Pediatric Clinic, Institute of Child and Youth Healthcare of Vojvodina in 2007 was conducted. Serum creatinine, urea and bilirubine were determined on the 3rd day of life in 65 newborns who met inclusion criteria. ARF was diagnosed in 16 newborns (n=16/65; 25%. Results. The premature neonates with ARF had significantly lower GA [<28 gw - 8/16 (50% vs. 5/49 (10%; p < 0.05], birth weight (BW (1 265 g vs. 1615 g; p < 0.05 and systolic blood pressure (43.37 mm Hg vs. 52.7 mmHg; p < 0.05 than ones without ARF. Non-olyguric ARF was diagnosed in 62% of newborns with ARF (n=10/16, while the rest had the olyguric type (n = 6/16; 38%. Twenty-five percent of premature neonates with ARF (n = 4/16 died in contrast to 10% of premature neonates without ARF (n = 5/49. ARF was treated conservatively in all but 3 cases when peritoneal dialysis was performed. Renal function has recovered completely in all of the survivors. In order to determine their predictivity in relation to ARF, following parameters were analyzed: GA, BW < 1 500 g, presence of concomitant sepsis and intracranial hemorrhage grade III/IV. BW < 1 500 g demonstrated the highest sensitivity (se 0.75, while GA < 28 gw, sepsis and intracranial hemorrhage grade III/IV showed high specificity (sp = 0.90, 0.89 0.88, respectively. Conclusion. Acute renal failure frequently occurs in population of premature neonates and requires meticulous fluid and electrolyte balance, especially in the case of low birth weight and extreme immaturity.

  19. Impact of rotavirus vaccine on premature infants.

    Science.gov (United States)

    Roué, Jean-Michel; Nowak, Emmanuel; Le Gal, Grégoire; Lemaitre, Thomas; Oger, Emmanuel; Poulhazan, Elise; Giroux, Jean-Dominique; Garenne, Armelle; Gagneur, Arnaud

    2014-10-01

    Infants born preterm are at a higher risk of complications and hospitalization in cases of rotavirus diarrhea than children born at term. We evaluated the impact of a rotavirus vaccination campaign (May 2007 to May 2010) on hospitalizations for rotavirus gastroenteritis in a population of children under 3 years old born prematurely (before 37 weeks of gestation) in the Brest University Hospital birth zone. Active surveillance from 2002 to 2006 and a prospective collection of hospitalizations for rotavirus diarrhea were initiated in the pediatric units of Brest University Hospital until May 2010. Numbers of hospitalizations for rotavirus diarrhea among the population of children born prematurely, before and after the start of the vaccination program, were compared using a Poisson regression model controlling for epidemic-to-epidemic variation. A total of 217 premature infants were vaccinated from 2007 to 2010. Vaccine coverage for a complete course of three doses was 41.9%. The vaccine safety in premature infants was similar to that in term infants. The vaccination program led to a division by a factor of 2.6 (95% confidence interval [CI], 1.3 to 5.2) in the number of hospitalizations for rotavirus diarrhea during the first two epidemic seasons following vaccine introduction and by a factor of 11 (95% CI, 3.5 to 34.8) during the third season. We observed significant effectiveness of the pentavalent rotavirus vaccine on the number of hospitalizations in a population of prematurely born infants younger than 3 years of age. A multicenter national study would provide better assessment of this impact. (This study [Impact of Systematic Infants Vaccination Against Rotavirus on Gastroenteritis Hospitalization: a Prospective Study in Brest District, France (IVANHOE)] has been registered at ClinicalTrials.gov under registration no. NCT00740935.).

  20. Centrosome-associated regulators of the G2/M checkpoint as targets for cancer therapy

    Directory of Open Access Journals (Sweden)

    Broaddus Russell R

    2009-02-01

    Full Text Available Abstract In eukaryotic cells, control mechanisms have developed that restrain cell-cycle transitions in response to stress. These regulatory pathways are termed cell-cycle checkpoints. The G2/M checkpoint prevents cells from entering mitosis when DNA is damaged in order to afford these cells an opportunity to repair the damaged DNA before propagating genetic defects to the daughter cells. If the damage is irreparable, checkpoint signaling might activate pathways that lead to apoptosis. Since alteration of cell-cycle control is a hallmark of tumorigenesis, cell-cycle regulators represent potential targets for therapy. The centrosome has recently come into focus as a critical cellular organelle that integrates G2/M checkpoint control and repairs signals in response to DNA damage. A growing number of G2/M checkpoint regulators have been found in the centrosome, suggesting that centrosome has an important role in G2/M checkpoint function. In this review, we discuss centrosome-associated regulators of the G2/M checkpoint, the dysregulation of this checkpoint in cancer, and potential candidate targets for cancer therapy.

  1. Muon Beam Tracking and Spin-Orbit Correlations for Precision g-2 Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Tarazona, David [Michigan State U., East Lansing (main); Berz, Martin [Michigan State U., East Lansing (main); Hipple, Robert [Michigan State U., East Lansing (main); Makino, Kyoko [Michigan State U., East Lansing (main); Syphers, Michael [Fermilab

    2016-06-01

    The main goal of the Muon g-2 Experiment (g-2) at Fermilab is to measure the muon anomalous magnetic moment to unprecedented precision. This new measurement will allow to test the completeness of the Standard Model (SM) and to validate other theoretical models beyond the SM. The close interplay of the understanding of particle beam dynamics and the preparation of the beam properties with the experimental measurement is tantamount to the reduction of systematic errors in the determination of the muon anomalous magnetic moment. We describe progress in developing detailed calculations and modeling of the muon beam delivery system in order to obtain a better understanding of spin-orbit correlations, nonlinearities, and more realistic aspects that contribute to the systematic errors of the g-2 measurement. Our simulation is meant to provide statistical studies of error effects and quick analyses of running conditions for when g-2 is taking beam, among others. We are using COSY, a differential algebra solver developed at Michigan State University that will also serve as an alternative to compare results obtained by other simulation teams of the g-2 Collaboration.

  2. G2's closest approach to the Galactic Center black hole

    Science.gov (United States)

    Witzel, Gunther; Ghez, Andrea M.; Morris, Mark; Sitarski, Breann; Boehle, Anna; Campbell, Randall

    2015-01-01

    We report new observations of Galactic Center sources G2 and Sgr A* from the W. M. Keck Observatory. Both sources are of great interest and vary temporally; G2 is the putative gas cloud now passing through periapse in its orbit around the black hole at the center of the Milky Way Galaxy and Sgr A* is the emission associated with the central black hole. Our observations were obtained on 2014 March 19 & 20 (UT) with the Keck II laser guide star adaptive optics system (LGSAO) and the facility near-infrared camera (NIRC2) through the K' and L' broadband filters. At this time, G2 was expected to have been at closest approach with a separation from Sgr A* of only ~20 mas and, therefore, to be spatially unresolved from Sgr A*. Nevertheless, the two can be disentangled spectrally. In the L'-band, both Sgr A* and G2 contribute to the total flux; however, Sgr A*'s L' flux is estimated and removed based on (1) the analysis of K'-band maps showing bright and low states of Sgr A* (2) the well measured and constant K'-L' color of Sgr A*. We conclude that G2, which is currently experiencing its closest approach, is still intact and compact, in contrast to predictions for a simple gas cloud hypothesis and therefore most likely hosts a central star.

  3. Midkine accumulated in nucleolus of HepG2 cells involved in rRNA transcription

    Institute of Scientific and Technical Information of China (English)

    Li-Cheng Dai; Jian-Zhong Shao; Li-Shan Min; Yong-Tao Xiao; Li-Xin Xiang; Zhi-Hong Ma

    2008-01-01

    AIM: To invesgate the ultrastructural location of midkine (MK) in nucleolus and function corresponding to its location. METHODS: To investigate the ultrastructural location of MK in nucleolus with immunoelectronic microscopy. To study the role that MK plays in ribosomal biogenesis by real-time PCR. The effect of MK on anti-apoptotic activity of HepG2 cells was studied with FITC-conjugated annexin V and propidium iodide PI double staining through FACS assay. RESULTS: MK mainly localized in the granular component (GC), dense fibrillar component (DFC) and the border between the DF-C and fibrillar center (FC). The production of 45S precursor rRNA level was decreased significantly in the presence of IK antisense oligonucleotide in the HepG2 cells. Furthermore, it was found that exogenous MK could protect HepG2 from apoptosis significantly. CONCLUSION: NK was constitutively translocated to the nucleolus of HepG2 cells, where it accumulated and mostly distributed at DFC, GC components and at the region between FC and DFC, MK played an important role in rRNA transcription, ribosome biogenesis, and cell proliferation in HepG2 cells. MK might serve as a molecular target for therapeutic intervention of human carcinomas.

  4. Effects of sargentgloryvine stem extracts on HepG-2 cells in vitro and in vivo

    Institute of Scientific and Technical Information of China (English)

    Ming-Hua Wang; Min Long; Bao-Yi Zhu; Shu-Hui Yang; Ji-Hong Ren; Hui-Zhong Zhang

    2011-01-01

    AIM: To observe the effects of sargentgloryvine stem extracts (SSE) on the hepatoma cell line HepG-2 in vitro and in vivo and determine its mechanisms of action.METHODS: Cultured HepG-2 cells treated with SSE were analysed by 3-(4,5-Dimethyl-thiazol-2-yl)-2,5-Diphenyltetrazolium bromide and clone formation assay.The cell cycle and apoptosis analysis were conducted by flow cytometric, TdT-Mediated dUTP Nick End Labeling and acridine orange/ethidium bromide staining methods,and protein expression was examined by both reverse transcriptase-polymerase chain reaction and Western blotting.The pathological changes of the tumor cells were observed by haematoxylin and eosin staining. Tumor growth inhibition and side effects were determined in a xenograft mouse model.RESULTS: SSE treatment could not only inhibit HepG-2 cell proliferation in a dose- and time-dependent manner but also induce apoptosis and cell cycle arrest at the S phase. The number of colonies formed by SSEtreated tumor cells was fewer than that of the controls (P 0.05). Systemic administration of SSE could inhibit the HepG-2 xenograft tumor growth with no obvious toxic side effects on normal tissues.CONCLUSION: SSE can induce apoptosis of HepG-2 cells in vitro and in vivo through decreasing expression of Bcl-xl and Mcl-1 and increasing expression of Bax.

  5. Buckwheat trypsin inhibitor enters Hep G2 cells by clathrin-dependent endocytosis.

    Science.gov (United States)

    Cui, Xiaodong; Wang, Zhuanhua; Li, Yuying; Li, Chen

    2013-12-01

    Recombinant buckwheat trypsin inhibitor (rBTI) was studied to evaluate if it could enter cancer cells and to determine the mechanism. Fluorescein isothiocyanate-labelled buckwheat trypsin inhibitor (FITC-BTI) entered Hep G2 cells in a concentration-dependent manner. FITC-BTI colocalised with labelled transferrin (Tf) in the punctate structure, implying that rBTI enters Hep G2 cells by clathrin-dependent endocytosis. Incubation of Hep G2 cells with different chemical inhibitors abolished diffuse, but not punctate fluorescence, thus indicating that membrane potential plays a critical role in this process. Impairment of clathrin-mediated endocytosis by RNAi with clathrin heavy chain greatly reduced or completely abolished both diffuse and punctate fluorescence, further supporting a theory of a single route of endocytosis. Consistent with our working hypothesis, Hep G2 cells which were arrested in the M phase did not show any vesicular or diffuse FITC-BTI. We conclude from these results that both endocytosis and membrane potential are required for rBTI entry into Hep G2 cells. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Condenser Optimization in Steam Power Plant

    Institute of Scientific and Technical Information of China (English)

    Sukru Bekdemir; Recep Ozturk; Zehra Yumurtac

    2003-01-01

    In this paper the effects of the condenser design parameters (such as turbine inlet condition, turbine power and condenser pressure) on heat transfer area, cooling water flow-rate, condenser cost and specific energy generation cost are studied for surface type condenser.The results are given in the text and also shown as diagrams.

  7. G2 - G3 inventive properties, the first french nuclear plants; Caracteristiques generales et aspects originaux des reacteurs G2 et G3

    Energy Technology Data Exchange (ETDEWEB)

    Pascal; Horowitz; Bussac; Joatton; De Lagge de Meux; Martin [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    This paper points out the inventive properties of the frenchctors G2 and G3. These are dual purpose reactors, i.e. designed for the production of both plutonium and energy (30 electrical MW); in this respect, they can be considered as the start point of the french electrical energy produced from nuclear fuel. The following points are specially discussed in this paper: the choice of the prestressed concrete pressure vessel, the horizontal arrangement of the channels, the interest of neutron flux flattening, the advantages of the charging and discharging device working during pile operation. (author)Fren. [French] Les caracteres originaux des reacteurs fran is G2 et G3 sont decrits dans ce rapport. Ce sont des reacteurs a double fin, plutonigenes et aussi producteurs d'energie (30 MW electriques); ils constituent a ce titre le point de depart de la production fran ise d'electricite d'origine nucleaire. Sont discutes, en particulier, dans ce rapport: le choix du caisson en beton precontraint pour tenir la pression, la disposition horizontale des canaux, l'interet de l'aplatissement du flux neutronique, les avantages de l'appareil permettant le chargement et le dechargement du combustible sans arreter la pile. (auteur)

  8. Birthing and Parenting a Premature Infant in a Cultural Context

    Science.gov (United States)

    Brooks, Jada L.; Holdtich-Davis, Diane; Docherty, Sharron L.; Theodorou, Christina S.

    2015-01-01

    The purpose of this longitudinal qualitative descriptive study was to explore American Indian (AI) mothers’ perceptions of parenting their premature infants over their first year of life in the context of their culture, including the birth and hospitalization experience. A convenience sample of 17 AI mothers and their premature infants were recruited from either a neonatal intensive care unit (NICU) or pediatric clinic in the southeast. Semistructured interviews were conducted at two time points. Through content analytic methods, three broad categories were revealed: descriptions of having a premature infant in the NICU, descriptions of parenting a premature infant, and the influence of Lumbee culture on parenting a premature infant. Certain aspects of AI culture appear to be important in having a premature infant in the NICU and in parenting a premature infant. We recommend that healthcare providers deliver culturally appropriate care that fully supports AI mothers and their premature infants. PMID:25721716

  9. Birthing and Parenting a Premature Infant in a Cultural Context.

    Science.gov (United States)

    Brooks, Jada L; Holdtich-Davis, Diane; Docherty, Sharron L; Theodorou, Christina S

    2016-02-01

    The purpose of this longitudinal qualitative descriptive study was to explore American Indian mothers' perceptions of parenting their premature infants over their first year of life in the context of their culture, including the birth and hospitalization experience. A convenience sample of 17 American Indian mothers and their premature infants were recruited from either a neonatal intensive care unit (NICU) or pediatric clinic in the southeast. Semistructured interviews were conducted at two time points. Through content analytic methods, three broad categories were revealed: descriptions of having a premature infant in the NICU, descriptions of parenting a premature infant, and the influence of Lumbee culture on parenting a premature infant. Certain aspects of American Indian culture appear to be important in having a premature infant in the NICU and in parenting a premature infant. We recommend that health care providers deliver culturally appropriate care that fully supports American Indian mothers and their premature infants. © The Author(s) 2015.

  10. Effects of p53 on fisetin-induced apoptosis in hepatocellular carcinoma cell line HepG2%p53在漆树黄酮诱导人肝癌细胞系HepG2细胞凋亡的作用

    Institute of Scientific and Technical Information of China (English)

    李蓉; 黎小兵; 蔡康荣; 陈锦; 黄培春

    2011-01-01

    目的 观察漆树黄酮诱导人肝癌细胞系HepG2细胞凋亡的现象,研究p53在漆树黄酮诱导人肝癌细胞系HepG2细胞凋亡的作用.方法 用不同浓度的漆树黄酮(50、100、200 μmol/L)处理HepG2细胞24 h和100 μmol/L漆树黄酮处理HepG2细胞不同时间(12、24、48 h),流式细胞技术和Hoechst/PI免疫荧光法观察漆树黄酮作用HepG2细胞的凋亡情况; Westem Blot法检测漆树黄酮对HepG2细胞P53、Caspase-3 和Caspase-8蛋白的表达情况.结果 漆树黄酮能诱导HepG2细胞凋亡,呈剂量-时间依赖性; 漆树黄酮可增加P53蛋白的表达,降解Caspase-3、Caspase-8酶原,提高Caspase-3、Caspase-8活性.P53蛋白的上调与凋亡的发生呈正相关(r=0.586,r=0.592,均P<0.01),Caspase-3、Caspase-8酶原的降解与与凋亡的发生呈负相关(r=-0.585~-0.583,均P<0.01).结论 漆树黄酮可诱导HepG2细胞凋亡,其机制可能与上调p53表达,活化Caspase-3、 Caspase-8有关.%Objective To study the effects of p53 on fisetin - induced apoptosis in hepatocellular carcinoma cell line HepG2 cells. Methods HepG2 cells were treated with fisetin at different concentrations (50. 100, 200 μmol/L)for 24h and with fisetin of 100 μmol/L with different duration ( 12 , 24 , 48 h) . Cell apoptosis was assessed with Hoechst/PI double staining assay and flow cytometry ( FCM) . The expression levels of P53 , Caspase - 3 and Caspase - 8 proteins in HepG2 cells were measured by Western Blot. Results Fisetin - induced apoptosis in HepG2 cells followed dose - and time - dependent manners. Chromatin condensation was observed with Hoechst/PI staining in fisetin - treated cells. The level of P53 was significantly elevated in HepG2 cells after fisetin treatment, while the levels of Caspase - 3 and Caspase - 8 were significantly reduced. Significant positive correlation was observed between up - regulation of P53 and cellular apoptosis , while negative correlation was observed between down - regulation of

  11. Rapid Drop Dynamics During Superhydrophobic Condensation

    Science.gov (United States)

    Zhang, Xiaodong; Boreyko, Jonathan; Chen, Chuan-Hua

    2008-11-01

    Rapid drop motion is observed on superhydrophobic surfaces during condensation; condensate drops with diameter of order 10 μm can move at above 100G and 0.1 m/s. When water vapor condenses on a horizontal superhydrophobic surface, condensate drops move in a seemingly random direction. The observed motion is attributed to the energy released through coalescence of neighboring condensate drops. A scaling analysis captured the initial acceleration and terminal velocity. Our work is a step forward in understanding the dynamics of superhydrophobic condensation occurring in both natural water-repellant plants and engineered dropwise condensers.

  12. Targeting and molecular imaging of HepG2 cells using surface-functionalized gold nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Rathinaraj, Pierson [Auckland University of Technology, Institute of Biomedical Technologies (New Zealand); Lee, Kyubae; Choi, Yuri; Park, Soo-Young [Kyungpook National University, School of Applied Chemical Engineering, Graduate School (Korea, Republic of); Kwon, Oh Hyeong [Kumoh National Institute of Technology, Department of Polymer Science and Engineering (Korea, Republic of); Kang, Inn-Kyu, E-mail: ikkang@knu.ac.kr [Kyungpook National University, School of Applied Chemical Engineering, Graduate School (Korea, Republic of)

    2015-07-15

    Mercaptosuccinic acid (M)-conjugated gold nanoparticles (GM) were prepared and characterized by transmission electron microscope and dynamic light scattering. M was used to improve the monodispersity and non-specific intracellular uptake of nanoparticles. Lactobionic acid (L) was subsequently conjugated to the GM to target preferentially HepG2 cells (liver cancer cells) that express asialoglycoprotein receptors (ASGPR) on their membrane surfaces and facilitate the transit of nanoparticles across the cell membrane. The mean size of lactobionic acid-conjugated gold nanoparticle (GL) was approximately 10 ± 0.2 nm. Finally, the Atto 680 dye (A6) was coupled to the nanoparticles to visualize their internalization into HepG2 cells. The interaction of surface-modified gold nanoparticles with HepG2 cells was studied after culturing cells in media containing the GM or L-conjugated GM (GL)

  13. SEM-668-G2(日东科技)

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    SEM-668-G2比SEM-668在视觉技术上更加精湛,采用美国AGILENT(安提伦)LASER 5519A及HP的双重频率技术,加强运动;隹确性。在智能化印刷头上,SEM-668-G2印刷质量更加均匀、稳定,操作界面更加简易、更加人性化。在综合性能上更加卓越,保证实现现代化的生产效率。产品体具性能如下:SEM-668-G2视觉全自动印刷机

  14. Applying inversion to construct planar, rational spirals that satisfy two-point G(2) Hermite data

    CERN Document Server

    Kurnosenko, A

    2010-01-01

    A method of two-point G(2) Hermite interpolation with spirals is proposed. To construct a sought for curve, the inversion is applied to an arc of some other spiral. To illustrate the method, inversions of parabola are considered in detail. The resulting curve is 4th degree rational. The method allows the matching of a wide range of boundary conditions, including those which require an inflection. Although not all G(2) Hermite data can be matched with a spiral generated from a parabolic arc, introducing one intermediate G(2) data solves the problem. Expanding the method by involving other spirals arcs is also discussed. (C) 2009 Elsevier B.V. All rights reserved.

  15. Anticancer and apoptosis-inducing effects of Moringa concanensis using hepG2 cell lines

    Directory of Open Access Journals (Sweden)

    V. Balamurugan

    2014-12-01

    Full Text Available The objective of the present investigation is focused on the anticancer activity of the ethanolic crude extract of Moringa concanensis leaf and bark against HepG2 cell line. The study was facilitated by collecting the plant sample and subjected to ethanol crude extraction. The anticancer activity of the crude extracted sample against HepG2 cell line was examined by MTT assay. The study confirms that the leaf crude extract of M. concanensis has pronounced anticancer potential against HepG2 cell lines while compared to that of the bark extract. The plant investigated possesses remarkable anticancer activity and hence isolation of the compound contributing to the activity may lead to develop at a novel and natural phytomedicine for the disease.

  16. Observations of the gas cloud G2 in the Galactic Center

    CERN Document Server

    Gillessen, Stefan; Fritz, Tobias K; Eisenhauer, Frank; Pfuhl, Oliver; Ott, Thomas; Burkert, Andreas; Schartmann, Marc; Ballone, Alessandro

    2013-01-01

    In 2011, we discovered a compact gas cloud ("G2") with roughly three Earth masses that is falling on a near-radial orbit toward the massive black hole in the Galactic Center. The orbit is well constrained and pericenter passage is predicted for early 2014. Our data beautifully show that G2 gets tidally sheared apart due to the massive black hole's force. During the next months, we expect that in addition to the tidal effects, hydrodynamics get important, when G2 collides with the hot ambient gas around Sgr A*. Simulations show that ultimately, the cloud's material might fall into the massive black hole. Predictions for the accretion rate and luminosity evolution, however, are very difficult due to the many unknowns. Nevertheless, this might be a unique opportunity in the next years to observe how gas feeds a massive black hole in a galactic nucleus.

  17. Observations of the gas cloud G2 in the Galactic center

    Science.gov (United States)

    Gillessen, S.; Genzel, R.; Fritz, T. K.; Eisenhauer, F.; Pfuhl, O.; Ott, T.; Burkert, A.; Schartmann, M.; Ballone, A.

    2014-05-01

    In 2011, we discovered a compact gas cloud ("G2") with roughly three Earth masses that is falling on a near-radial orbit toward the massive black hole in the Galactic center. The orbit is well constrained and pericenter passage is predicted for early 2014. Our data beautifully show that G2 gets tidally sheared apart due to the massive black hole's force. During the next months, we expect that in addition to the tidal effects, hydrodynamics get important, when G2 collides with the hot ambient gas around Sgr A*. Simulations show that ultimately, the cloud's material might fall into the massive black hole. Predictions for the accretion rate and luminosity evolution, however, are very difficult due to the many unknowns. Nevertheless, this might be a unique opportunity in the next years to observe how gas feeds a massive black hole in a galactic nucleus.

  18. Replicatively senescent cells are arrested in G1 and G2 phases

    Science.gov (United States)

    Mao, Zhiyong; Ke, Zhonghe; Gorbunova, Vera; Seluanov, Andrei

    2012-01-01

    Most human somatic cells do not divide indefinitely but enter a terminal growth arrest termed replicative senescence. Replicatively senescent cells are generally believed to arrest in G1 or G0 stage of the cell cycle. While doing cell cycle analysis on three different lines of normal human fibroblasts we observed that 36-60% of the replicatively senescent cells had 4N DNA content. Only up to 5% of senescent cells had more than one nucleus ruling out the possibility that the 4N cell population were G1-arrested bi-nucleated cells. Furthermore, it is unlikely that the 4N cells are tetraploids, because actively dividing pre-senescent cultures lacked the 8N tetraploid G2 population. Collectively these results suggest that the 4N population consists of G2 arrested cells. The notion that a large fraction of senescent cell population is arrested in G2 is important for understanding the biology of replicative senescence. PMID:22745179

  19. Infrared-excess Source DSO/G2 Near the Galactic Center: Theory vs. Observations

    CERN Document Server

    Zajacek, Michal; Peissker, Florian; Karssen, Grischa D; Karas, Vladimir

    2015-01-01

    We monitored the Dusty S-cluster object (DSO/G2) during its closest approach to the Galactic Center supermassive black hole in 2014 with ESO VLT/SINFONI. We report on our findings, i.e. ionized-hydrogen emission from the DSO that remains spatially compact before and after the peribothron passage. The detection of DSO/G2 object as a compact single-peak emission line source is in contradiction with the original hypothesis of a core-less cloud that is necessarily tidally stretched, hence producing double-peak emission line profile around the pericentre passage. This strengthens the evidence that the DSO/G2 source is a dust-enshrouded young star. The accretion of material from the circumstellar disc onto the stellar surface can contribute significantly to the emission of Br$\\gamma$ line as well as to the observed large line width of the order of 10 angstroms.

  20. Gas cloud G2 can illuminate the black hole population near the galactic center.

    Science.gov (United States)

    Bartos, Imre; Haiman, Zoltán; Kocsis, Bence; Márka, Szabolcs

    2013-05-31

    Galactic nuclei are expected to be densely populated with stellar- and intermediate-mass black holes. Exploring this population will have important consequences for the observation prospects of gravitational waves as well as understanding galactic evolution. The gas cloud G2 currently approaching Sgr A* provides an unprecedented opportunity to probe the black hole and neutron star population of the Galactic nucleus. We examine the possibility of a G2-cloud-black-hole encounter and its detectability with current x-ray satellites, such as Chandra and NuSTAR. We find that multiple encounters are likely to occur close to the pericenter, which may be detectable upon favorable circumstances. This opportunity provides an additional important science case for leading x-ray observatories to closely follow G2 on its way to the nucleus.

  1. [Biological function and molecular mechanism of URI in HepG2 cells].

    Science.gov (United States)

    Zhou, Wei; Zhong, Yanyu; Wang, Hongmin; Yang, Sijun; Wei, Wenxiang

    2014-11-01

    To explore the effect and molecular mechanism of the unconventional prefoldin RPB5 interactor (URI) in hepatocellular carcinoma HepG2 cells. The cDNA sequence and shRNA of URI were obtained and sub-cloned into eukaryotic expression vectors. Then those vectors were transfected into HepG2 cells to obtain stable transfection cell line. The cell proliferation and anchor-independent growth in URI-overexpressing and knockdown HepG2 cells were determined by CCK-8 and soft agar colony assay. Flow cytometry was applied to detect the cell cycle and apoptosis of γ-ray irradiated cells. Apoptosis related genes were detected by Western blot. The pCDNA3.1-URI and pGPU6-URIi eukaryotic expression vectors were constructed successfully and corresponding stable transfection cell lines were obtained. Cell proliferation rates of the HepG2, pCDNA3.1-URI-HepG2 and pGPU6-URIi-HepG2 cells were (588.78 ± 32.12)%, (959.33 ± 58.8)% and (393.93 ± 39.7)%, respectively (P HepG2, pCDNA3.1-URI-HepG2 and pGPU6-URIi-HepG2 cells were 43 ± 7, 85 ± 5 and 20 ± 4 (P HepG2 cells, the relative protein expression levels of URI, Bax and Bcl-2 were 0.92 ± 0.03, 1.11 ± 0.13 and 0.82 ± 0.01 (P HepG2 cells, the relative protein expression levels of URI, Bax and Bcl-2 were 1.79 ± 0.12, 0.48 ± 0.01 and 2.20 ± 0.30 (P HepG2 cells, the relative protein expression levels of URI, Bax and Bcl-2 were 0.50 ± 0.04, 1.52 ± 0.20 and 0.38 ± 0.01 (P < 0.05), respectively. The expression of Bax was down-regulated and Bcl-2 was up-regulated in the URI-overexpressing cell line. However, on the contrary, expression of Bax was up-regulated and Bcl-2 was down-regulated in the URI-depleted cell line. URI may promote the growth of hepatocellular carcinoma cells via inhibition of cell proliferation and reducing the apoptosis in hepatocellular carcinoma cells in vitro. After the impairment of URI expression, the proliferation ability of hepatocellular carcinoma cells is suppressed and the ability to resist

  2. G2LC: Resources Autoscaling for Real Time Bioinformatics Applications in IaaS

    Directory of Open Access Journals (Sweden)

    Rongdong Hu

    2015-01-01

    Full Text Available Cloud computing has started to change the way how bioinformatics research is being carried out. Researchers who have taken advantage of this technology can process larger amounts of data and speed up scientific discovery. The variability in data volume results in variable computing requirements. Therefore, bioinformatics researchers are pursuing more reliable and efficient methods for conducting sequencing analyses. This paper proposes an automated resource provisioning method, G2LC, for bioinformatics applications in IaaS. It enables application to output the results in a real time manner. Its main purpose is to guarantee applications performance, while improving resource utilization. Real sequence searching data of BLAST is used to evaluate the effectiveness of G2LC. Experimental results show that G2LC guarantees the application performance, while resource is saved up to 20.14%.

  3. G2LC: Resources Autoscaling for Real Time Bioinformatics Applications in IaaS.

    Science.gov (United States)

    Hu, Rongdong; Liu, Guangming; Jiang, Jingfei; Wang, Lixin

    2015-01-01

    Cloud computing has started to change the way how bioinformatics research is being carried out. Researchers who have taken advantage of this technology can process larger amounts of data and speed up scientific discovery. The variability in data volume results in variable computing requirements. Therefore, bioinformatics researchers are pursuing more reliable and efficient methods for conducting sequencing analyses. This paper proposes an automated resource provisioning method, G2LC, for bioinformatics applications in IaaS. It enables application to output the results in a real time manner. Its main purpose is to guarantee applications performance, while improving resource utilization. Real sequence searching data of BLAST is used to evaluate the effectiveness of G2LC. Experimental results show that G2LC guarantees the application performance, while resource is saved up to 20.14%.

  4. Crystal Structure of a Dimerized Cockroach Allergen Bla g 2 Complexed with a Monoclonal Antibody

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mi; Gustchina, Alla; Alexandratos, Jerry; Wlodawer, Alexander; Wünschmann, Sabina; Kepley, Christopher L.; Chapman, Martin D.; Pomes, Anna (INDOOR Bio.); (VCU); (NIH)

    2008-09-03

    The crystal structure of a 1:1 complex between the German cockroach allergen Bla g 2 and the Fab' fragment of a monoclonal antibody 7C11 was solved at 2.8-{angstrom} resolution. Bla g 2 binds to the antibody through four loops that include residues 60-70, 83-86, 98-100, and 129-132. Cation-{pi} interactions exist between Lys-65, Arg-83, and Lys-132 in Bla g 2 and several tyrosines in 7C11. In the complex with Fab', Bla g 2 forms a dimer, which is stabilized by a quasi-four-helix bundle comprised of an {alpha}-helix and a helical turn from each allergen monomer, exhibiting a novel dimerization mode for an aspartic protease. A disulfide bridge between C51a and C113, unique to the aspartic protease family, connects the two helical elements within each Bla g 2 monomer, thus facilitating formation of the bundle. Mutation of these cysteines, as well as the residues Asn-52, Gln-110, and Ile-114, involved in hydrophobic interactions within the bundle, resulted in a protein that did not dimerize. The mutant proteins induced less {beta}-hexosaminidase release from mast cells than the wild-type Bla g 2, suggesting a functional role of dimerization in allergenicity. Because 7C11 shares a binding epitope with IgE, the information gained by analysis of the crystal structure of its complex provided guidance for site-directed mutagenesis of the allergen epitope. We have now identified key residues involved in IgE antibody binding; this information will be useful for the design of vaccines for immunotherapy.

  5. HepG2 cells recovered from apoptosis show altered drug responses and invasiveness

    Institute of Scientific and Technical Information of China (English)

    Shan-Shan Wang; Xin Xie; Chung Sing Timothy Wong

    2014-01-01

    BACKGROUND: Cancer  relapse,  associated  with  increased drug resistance and rate of metastasis, often follows completion of chemotherapy but the cancer escape mechanisms are still incompletely understood. Percutaneous ethanol injection (PEI) has been used for treating hepatocellular carcinoma (HCC) for decades, while the recurrence after PEI treatment remains a major limitation. Recent evidence mounted that cancer cells could survive from chemical induced apoptosis, suggesting a potential route through which cancer relapse may occur. This study focuses on the consequence of HepG2 recovery from ethanol-induced apoptotic event. METHODS: The  model  of  HepG2  recovery  from  ethanol-induced apoptotic event was established by live cell imaging, BrdU assay and Western blotting. MTT assay, wound healing assay and invasion assay were used to investigate the behavior of HepG2 after recovery. RESULTS: HepG2 cells could recover from ethanol-induced apoptosis. These cells changed their behaviors such as drug resistance, mobility and invasiveness. On average, the recovered HepG2 cell clones were found to be 46% more resistant to ethanol and 84% higher in mobility. The recovered clones became 58.2% more sensitive to 5-lfuorouracil. CONCLUSIONS: HepG2  cells  can  recover  from  ethanol-induced apoptotic event. These cells became more resistant to ethanol and more invasive. Although the recovered cell clones were more resistant to ethanol, they became more sensitive to 5-lfuorouracil treatment.

  6. CLA对HepG2细胞脂肪堆积的影响

    Institute of Scientific and Technical Information of China (English)

    张艳; 张丽; 张威

    2011-01-01

    目的 研究共轭亚油酸对H e p G2细胞中脂质沉积的影响.方法 以H e p G2细胞为研究对象,以不同浓度C L A(10μmol·L-1、50μmol·L-1、100μmol·L-1)作用细胞24小时,采用油红染色、RT-PCR等方法检测肝脏脂肪沉积、ACC mRNA表达,观察CLA对肝细胞内脂质沉积的影响.结果 CLA增加HepG2细胞中脂质沉积,50μmol·L-1CLA组细胞中红染脂滴与对照组相比明显增多;CL A使H e pG2细胞培养液中游离脂肪酸降低,50μm o l·L-1组的培养液中游离脂肪酸与对照组相比含量降低了50%(P<0.05);CLA增加HepG2细胞ACC mRNA的表达,ACC mRNA表达水平随CLA浓度增加而增高.结论 CLA可增加HepG2细胞的脂肪沉积;其机制可能与CLA能够改变肝细胞中ACC的表达有关.

  7. Comparative analysis of 3D culture methods on human HepG2 cells.

    Science.gov (United States)

    Luckert, Claudia; Schulz, Christina; Lehmann, Nadja; Thomas, Maria; Hofmann, Ute; Hammad, Seddik; Hengstler, Jan G; Braeuning, Albert; Lampen, Alfonso; Hessel, Stefanie

    2017-01-01

    Human primary hepatocytes represent a gold standard in in vitro liver research. Due to their low availability and high costs alternative liver cell models with comparable morphological and biochemical characteristics have come into focus. The human hepatocarcinoma cell line HepG2 is often used as a liver model for toxicity studies. However, under two-dimensional (2D) cultivation conditions the expression of xenobiotic-metabolizing enzymes and typical liver markers such as albumin is very low. Cultivation for 21 days in a three-dimensional (3D) Matrigel culture system has been reported to strongly increase the metabolic competence of HepG2 cells. In our present study we further compared HepG2 cell cultivation in three different 3D systems: collagen, Matrigel and Alvetex culture. Cell morphology, albumin secretion, cytochrome P450 monooxygenase enzyme activities, as well as gene expression of xenobiotic-metabolizing and liver-specific enzymes were analyzed after 3, 7, 14, and 21 days of cultivation. Our results show that the previously reported increase of metabolic competence of HepG2 cells is not primarily the result of 3D culture but a consequence of the duration of cultivation. HepG2 cells grown for 21 days in 2D monolayer exhibit comparable biochemical characteristics, CYP activities and gene expression patterns as all 3D culture systems used in our study. However, CYP activities did not reach the level of HepaRG cells. In conclusion, the increase of metabolic competence of the hepatocarcinoma cell line HepG2 is not due to 3D cultivation but rather a result of prolonged cultivation time.

  8. Butyrylcholinesterase expression is regulated by fatty acids in HepG2 cells.

    Science.gov (United States)

    Gok, Muslum; Zeybek, N Dilara; Bodur, Ebru

    2016-11-25

    Butyrylcholinesterase (BChE) is mostly associated with the detoxification of xenobiotics. In this study to analyze the involvement of BChE in lipid metabolism, linoleic acid (LA) and α-linolenic acid (ALA) were applied to HepG2 cells along with expression of wild type human BChE. After 48 h of these treatments WST-1 cell proliferation assay, FACS analysis, RT-PCR, Oil Red O staining and activity assays were performed. Application of high concentrations of LA to HepG2 cells without BChE transfection lead to detachment of the cells. The IC50 value LA was found as 149.3 μM whereas the IC50 value for ALA could not be calculated. Hence, in order to display minimal effects on cell viability, 5 μM was chosen as appropriate concentration for LA and ALA application to HepG2 cells. Transfection of wild-type BChE plasmid to HepG2 cells yielded increased BChE expression. Application of 5 μM ALA after BChE transfection to HepG2 cells resulted in increased expression of BChE. Although with this low concentration the number of apoptotic cells was decreased with ALA treatments, LA application did not cause a similar result with the same dose. Moreover ghost cell like property was observed in LA-treated cells. Application of ALA, on the other hand, led to an overall increase in cell numbers, BChE expression and activity. Our results indicate that BChE expression might be regulated by ALA in HepG2 cells. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  9. Juglanthraquinone C, a novel natural compound derived from Juglans mandshurica Maxim, induces S phase arrest and apoptosis in HepG2 cells.

    Science.gov (United States)

    Yao, Yao; Zhang, Yu-Wei; Sun, Lu-Guo; Liu, Biao; Bao, Yong-Li; Lin, Hua; Zhang, Yu; Zheng, Li-Hua; Sun, Ying; Yu, Chun-Lei; Wu, Yin; Wang, Guan-Nan; Li, Yu-Xin

    2012-08-01

    Juglanthraquinone C (1,5-dihydroxy-9,10-anthraquinone-3-carboxylic acid, JC), a naturally occurring anthraquinone isolated from the stem bark of Juglans mandshurica, shows strong cytotoxicity in various human cancer cells in vitro. Here, we first performed a structure-activity relationship study of six anthraquinone compounds (JC, rhein, emodin, aloe-emodin, physcion and chrysophanol) to exploit the relationship between their structural features and activity. The results showed that JC exhibited the strongest cytotoxicity of all compounds evaluated. Next, we used JC to treat several human cancer cell lines and found that JC showed an inhibitory effect on cell viability in dose-dependent (2.5-10 μg/ml JC) and time-dependent (24-48 h) manners. Importantly, the inhibitory effect of JC on HepG2 (human hepatocellular carcinoma) cells was more significant as shown by an IC(50) value of 9 ± 1.4 μg/ml, and 36 ± 1.2 μg/ml in L02 (human normal liver) cells. Further study suggested that JC-induced inhibition HepG2 cell proliferation was associated with S phase arrest, decreased protein expression of proliferation marker Ki67, cyclin A and cyclin-dependent kinase (CDK) 2, and increased expression of cyclin E and CDK inhibitory protein Cip1/p21. In addition, JC significantly triggered apoptosis in HepG2 cells, which was characterized by increased chromatin condensation and DNA fragmentation, activation of caspase-9 and -3, and induction of a higher Bax/Bcl2 ratio. Collectively, our study demonstrated that JC can efficiently inhibit proliferation and induce apoptosis in HepG2 cells.

  10. Research progress of control of condensate depression for condenser

    Science.gov (United States)

    Liu, Ying; Liang, Run; Li, Fengyu

    2017-08-01

    It is introduced that significance and structure of the condensate depression control system. In accordance with controller devised procedure, we analyze and elaborate how to construct the lumped parameter and dynamic mathematical model which possesses distinct physics significance. Neural network model being called black-box model is also introduced. We analyze and contrast the control technique of condensate depression as conventional PI control, fuzzy PI control and fuzzy control. It is indicated that if the controller of condensate depression were devised inappropriate, while the steam discharged of turbine varying by a large margin, would result in the rotation rate of cooling water circulating pump accelerating at a great lick even to trigger the galloping danger which is less impressive for the units operating safely.

  11. Higgs boson mass and muon g -2 with strongly coupled vectorlike generations

    Science.gov (United States)

    Nishida, Michinobu; Yoshioka, Koichi

    2016-11-01

    We study the Higgs boson mass and the muon anomalous magnetic moment (the muon g -2 ) in a supersymmetric standard model with vectorlike generations. The infrared physics of the model is governed by strong renormalization-group effects of the gauge couplings. That leads to sizable extra Yukawa couplings of Higgs doublets between the second and vectorlike generations in both quark and lepton sectors. It is found with this property that there exist wide parameter regions where the Higgs boson mass and the muon g -2 are simultaneously explained.

  12. Updated pseudoscalar contributions to the hadronic light-by-light of the muon (g-2)

    CERN Document Server

    Sanchez-Puertas, Pablo

    2016-01-01

    In this work, we present our recent results on a new and alternative data-driven determination for the hadronic light-by-light pseudoscalar-pole contribution to the muon $(g-2)$. Our approach is based on Canterbury approximants, a rational approach to describe the required transition form factors, which provides a systematic and model-independent framework beyond traditional large-$N_c$ approaches. As a result, we obtain a competitive determination with errors according to future $(g-2)$ experiments including, for the first time, a well-defined systematic uncertainty.

  13. Gluon contribution to the structure function $g_{2}(x,Q^{2})$

    CERN Document Server

    Braun, V M; Manashov, A N

    2001-01-01

    We calculate the one-loop twist-3 gluon contribution to the flavor-singlet structure function g_2(x,Q^2) in polarized deep-inelastic scattering and find that it is dominated by the contribution of the three-gluon operator with the lowest anomalous dimension (for each moment N). The similar property was observed earlier for the nonsinglet distributions, although the reason is in our case different. The result is encouraging and suggests a simple evolution pattern of g_2(x,Q^2) in analogy with the conventional description of twist-2 parton distributions.

  14. High permissivity of human HepG2 hepatoma cells for influenza viruses.

    Science.gov (United States)

    Ollier, Laurence; Caramella, Anne; Giordanengo, Valérie; Lefebvre, Jean-Claude

    2004-12-01

    Human HepG2 hepatoma cells are highly permissive for influenza virus type A and type B, even without the addition of trypsin, and they exhibit a marked cytopathic effect. This property greatly facilitates the primary isolation of influenza viruses. Virus replication was significantly reduced by the plasmin(ogen)-specific inhibitor tranexamic acid, and this suggests a potential role played by the plasminogen/tissue plasminogen activator complex at the surface of HepG2 cells. This might represent a new approach for study of the interrelations of this complex with influenza viruses.

  15. Moduli of $G_2$ structures and the Strominger system in dimension 7

    CERN Document Server

    Clarke, Andrew; Tipler, Carl

    2016-01-01

    We consider $G_2$ structures with torsion coupled with $G_2$-instantons, on a compact $7$-dimensional manifold. The coupling is via an equation for $4$-forms which appears in supergravity and generalized geometry, known as the Bianchi identity. The resulting system of partial differential equations can be regarded as an analogue of the Strominger system in $7$-dimensions. We initiate the study of the moduli space of solutions and show that it is finite dimensional using elliptic operator theory. We also relate the associated geometric structures to generalized geometry.

  16. Constraints on Hidden Photon Models from Electron g-2 and Hydrogen Spectroscopy

    CERN Document Server

    Endo, Motoi; Mishima, Go

    2012-01-01

    The hidden photon model is one of the simplest models which can explain the anomaly of the muon anomalous magnetic moment (g-2). The experimental constraints are studied in detail, which come from the electron g-2 and the hydrogen transition frequencies. The input parameters are set carefully in order to take dark photon contributions into account and to prevent the analysis from being self-inconsistent. It is shown that the new analysis provides a constraint severer by more than one order of magnitude than the previous result.

  17. Selection of Secure Hyperelliptic Curves of g = 2 Based on a Subfield

    Institute of Scientific and Technical Information of China (English)

    张方国; 张福泰; 王育民

    2002-01-01

    In the implementation of hyperelliptic curve cryptosystems, a siginificant stepis the selection of secure hyperelliptic curves on which the Jacobian is constructed. In thispaper, we discuss the hyperelliptic curves of g = 2 such as v2 + uv = f and v2 + v = f(u)defined on GF(2τ). The curves defined on GF(4) and GF(8) are expanded to the curves definedon GF(4)κ and GF(8)t respectively, where 38 < k < 70, 25 < t < 50. We also find out all thesecure curves of g = 2 that are suitable for establishing cryptosystems.

  18. The calibration system of the new g-2 experiment at Fermilab

    Science.gov (United States)

    Anastasi, A.; Babusci, D.; Cantatore, G.; Cauz, D.; Corradi, G.; Dabagov, S.; Di Meo, P.; Di Sciascio, G.; Di Stefano, R.; Ferrari, C.; Fienberg, A. T.; Fioretti, A.; Gabbanini, C.; Hampai, D.; Hertzog, D. W.; Iacovacci, M.; Karuza, M.; Kaspar, J.; Marignetti, F.; Mastroianni, S.; Moricciani, D.; Pauletta, G.; Santi, L.; Venanzoni, G.

    2016-07-01

    The muon anomaly (g - 2) μ / 2 has been measured to 0.54 parts per million by E821 experiment at Brookhaven National Laboratory, and at present there is a 3-4 standard-deviation difference between the Standard Model prediction and the experimental value. A new muon g-2 experiment, E989, is being prepared at Fermilab that will improve the experimental error by a factor of four to clarify this difference. A central component to reach this fourfold improvement in accuracy is the high-precision laser calibration system which should monitor the gain fluctuations of the calorimeter photodetectors at 0.04% accuracy.

  19. SIMULATED PERFORMANCE OF THE PRODUCTION TARGET FOR THE MUON G-2 EXPERIMENT

    Energy Technology Data Exchange (ETDEWEB)

    Stratakis, D. [Fermilab; Convery, M. [Fermilab; Morgan, J. P. [Fermilab; Still, D. [Fermilab; Syphers, M. J. [Northern Illinois U.; Tishchenko, V. [Brookhaven Natl. Lab.

    2017-05-23

    The Muon g-2 Experiment plans to use the Fermilab Re-cycler Ring for forming the proton bunches that hit its pro-duction target. The proposed scheme uses one RF system, 80 kV of 2.5 MHz RF. In order to avoid bunch rotations in a mismatched bucket, the 2.5 MHz is ramped adiabatically from 3 to 80 kV in 90 ms. In this study, the interaction of the primary proton beam with the production target for the Muon g-2 Experiment is numerically examined.

  20. The conformal-Killing equation on G2 and Spin7 structures

    CERN Document Server

    David, Liana

    2010-01-01

    Let M be a 7-manifold with a G2-structure defined by \\phi \\in\\Omega^{3}_{+}(M). We prove that {\\phi} is conformal-Killing with respect to the associated metric g(\\phi) if and only if the G2-structure is nearly parallel. Let M be an 8-manifold with a Spin7-structure defined by \\psi \\in\\Omega^{4}_{+}(M). We prove that {\\psi} is conformal-Killing with respect to the associated metric g(\\psi) if and only if the Spin7-structure is parallel.

  1. Probing $(g-2)_{\\mu}$ at the LHC in the paradigm of R-parity violating MSSM

    CERN Document Server

    Chakraborty, Amit

    2015-01-01

    The measurement of the anomalous magnetic moment of the muon exhibits a long standing discrepancy compared to the Standard model prediction. In this paper we consider the framework of effective supersymmetric theory with relevant $R$-parity violating operators, which can provide substantially large anomalous magnetic moment of the muon. In addition, we point out that the implication of such operators satisfying muon $g-2$ are immense from the perspective of the LHC experiment, leading to a spectacular four muon final state. We propose an analysis in this particular channel which might help to settle the debate of $R$-parity violation as an probable explanation for $(g-2)_{\\mu}$.

  2. Demonstration of the presence of the "deleted" MIR122 gene in HepG2 cells.

    Science.gov (United States)

    Hamad, Ibrahim A Y; Fei, Yue; Kalea, Anastasia Z; Yin, Dan; Smith, Andrew J P; Palmen, Jutta; Humphries, Steve E; Talmud, Philippa J; Walker, Ann P

    2015-01-01

    MicroRNA 122 (miR-122) is highly expressed in the liver where it influences diverse biological processes and pathways, including hepatitis C virus replication and metabolism of iron and cholesterol. It is processed from a long non-coding primary transcript (~7.5 kb) and the gene has two evolutionarily-conserved regions containing the pri-mir-122 promoter and pre-mir-122 hairpin region. Several groups reported that the widely-used hepatocytic cell line HepG2 had deficient expression of miR-122, previously ascribed to deletion of the pre-mir-122 stem-loop region. We aimed to characterise this deletion by direct sequencing of 6078 bp containing the pri-mir-122 promoter and pre-mir-122 stem-loop region in HepG2 and Huh-7, a control hepatocytic cell line reported to express miR-122, supported by sequence analysis of cloned genomic DNA. In contrast to previous findings, the entire sequence was present in both cell lines. Ten SNPs were heterozygous in HepG2 indicating that DNA was present in two copies. Three validation isolates of HepG2 were sequenced, showing identical genotype to the original in two, whereas the third was different. Investigation of promoter chromatin status by FAIRE showed that Huh-7 cells had 6.2 ± 0.19- and 2.7 ± 0.01- fold more accessible chromatin at the proximal (HNF4α-binding) and distal DR1 transcription factor sites, compared to HepG2 cells (p=0.03 and 0.001, respectively). This was substantiated by ENCODE genome annotations, which showed a DNAse I hypersensitive site in the pri-mir-122 promoter in Huh-7 that was absent in HepG2 cells. While the origin of the reported deletion is unclear, cell lines should be obtained from a reputable source and used at low passage number to avoid discrepant results. Deficiency of miR-122 expression in HepG2 cells may be related to a relative deficiency of accessible promoter chromatin in HepG2 versus Huh-7 cells.

  3. Synthesis of apoptotic chalcone analogues in HepG2 human hepatocellular carcinoma cells.

    Science.gov (United States)

    Park, Cheon-Soo; Ahn, Yongchel; Lee, Dahae; Moon, Sung Won; Kim, Ki Hyun; Yamabe, Noriko; Hwang, Gwi Seo; Jang, Hyuk Jai; Lee, Heesu; Kang, Ki Sung; Lee, Jae Wook

    2015-12-15

    Eight chalcone analogues were prepared and evaluated for their cytotoxic effects in human hepatoma HepG2 cells. Compound 5 had a potent cytotoxic effect. The percentage of apoptotic cells was significantly higher in compound 5-treated cells than in control cells. Exposure to compound 5 for 24h induced cleavage of caspase-8 and -3, and poly (ADP-ribose) polymerase (PARP). Our findings suggest that compound 5 is the active chalcone analogue that contributes to cell death in HepG2 cells via the extrinsic apoptotic pathway.

  4. Frequency Shifts Induced by Field Gradients in Muon $g-2$ Experiments

    CERN Document Server

    Nouri, N; Golub, R; Plaster, B

    2016-01-01

    Two prominent efforts aimed at probing beyond Standard Model physics, searches for a neutron electric dipole moment (EDM) and measurements of the muon $g-2$ anomalous magnetic moment, employ spin precession techniques. In the most recent neutron EDM experiment, frequency shifts induced by magnetic field gradients and $\\mathbf{E} \\times \\mathbf{v}$ motional fields were a significant source of systematic error. We consider the possibility of a similar effect in the most recent muon $g-2$ experiment, and find that such an effect could potentially be as large as $\\sim 1$ ppm fractional error, to be compared with the reported $\\sim 0.5$ ppm error.

  5. Alterations in Functional Connectivity for Language in Prematurely Born Adolescents

    Science.gov (United States)

    Schafer, Robin J.; Lacadie, Cheryl; Vohr, Betty; Kesler, Shelli R.; Katz, Karol H.; Schneider, Karen C.; Pugh, Kenneth R.; Makuch, Robert W.; Reiss, Allan L.; Constable, R. Todd; Ment, Laura R.

    2009-01-01

    Recent data suggest recovery of language systems but persistent structural abnormalities in the prematurely born. We tested the hypothesis that subjects who were born prematurely develop alternative networks for processing language. Subjects who were born prematurely (n = 22; 600-1250 g birth weight), without neonatal brain injury on neonatal…

  6. 14 CFR 1214.806 - Premature termination of Spacelab flights.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Premature termination of Spacelab flights... FLIGHT Reimbursement for Spacelab Services § 1214.806 Premature termination of Spacelab flights. If a... are, in NASA's judgment, adversely affected by such premature termination. The basis for proration...

  7. Scrutinizing the pion condensed phase

    CERN Document Server

    Carignano, Stefano; Mammarella, Andrea; Mannarelli, Massimo; Pagliaroli, Giulia

    2016-01-01

    When the isospin chemical potential exceeds the pion mass, charged pions condense in the zero-momentum state forming a superfluid. Chiral perturbation theory provides a very powerful tool for studying this phase. However, the formalism that is usually employed in this context does not clarify various aspects of the condensation mechanism and makes the identification of the soft modes problematic. We re-examine the pion condensed phase using different approaches within the chiral perturbation theory framework. As a first step, we perform a low-density expansion of the chiral Lagrangian valid in the normal phase and close to the onset of the Bose-Einstein condensation. We obtain an effective theory that can be mapped to a Gross-Pitaevskii Lagrangian in which, remarkably, all the coefficients depend on the isospin chemical potential. The low-density expansion becomes unreliable deep in the pion condensed phase. For this reason, we develop an alternative field expansion deriving a low-energy Lagrangian analog to ...

  8. Polariton condensates at room temperature

    Science.gov (United States)

    Guillet, Thierry; Brimont, Christelle

    2016-10-01

    We review the recent developments of the polariton physics in microcavities featuring the exciton-photon strong coupling at room temperature, and leading to the achievement of room-temperature polariton condensates. Such cavities embed active layers with robust excitons that present a large binding energy and a large oscillator strength, i.e. wide bandgap inorganic or organic semiconductors, or organic molecules. These various systems are compared, in terms of figures of merit and of common features related to their strong oscillator strength. The various demonstrations of polariton laser are compared, as well as their condensation phase diagrams. The room-temperature operation indeed allows a detailed investigation of the thermodynamic and out-of-equilibrium regimes of the condensation process. The crucial role of the spatial dynamics of the condensate formation is discussed, as well as the debated issue of the mechanism of stimulated relaxation from the reservoir to the condensate under non-resonant excitation. Finally the prospects of polariton devices are presented.

  9. TMEM2 inhibits hepatitis B virus infection in HepG2 and HepG2.2.15 cells by activating the JAK-STAT signaling pathway.

    Science.gov (United States)

    Zhu, X; Xie, C; Li, Y-M; Huang, Z-L; Zhao, Q-Y; Hu, Z-X; Wang, P-P; Gu, Y-R; Gao, Z-L; Peng, L

    2016-06-02

    We have previously observed the downregulation of TMEM2 in the liver tissue of patients with chronic hepatitis B virus (HBV) infection and in HepG2.2.15 cells with HBV genomic DNA. In the present study, we investigated the role and mechanism of TMEM2 in HepG2 and HepG2.2.15 during HBV infection HepG2 and HepG2.2.15. HepG2 shTMEM2 cells with stable TMEM2 knockdown and HepG2 TMEM2 and HepG2.2.15 TMEM2 cells with stable TMEM2 overexpression were established using lentivirus vectors. We observed reduced expression of TMEM2 in HBV-infected liver tissues and HepG2.2.15 cells. HBsAg, HBcAg, HBV DNA, and HBV cccDNA levels were significantly increased in HepG2 shTMEM2 cells but decreased in HepG2 TMEM2 and HepG2.2.15 TMEM2 cells compared with naive HepG2 cells. On the basis of the western blotting results, the JAK-STAT signaling pathway was inhibited in HepG2 shTMEM2 cells but activated in HepG2 TMEM2 and HepG2.2.15 TMEM2 cells. In addition, reduced and increased expression of the antiviral proteins MxA and OAS1 was observed in TMEM2-silenced cells (HepG2 shTMEM2 cells) and TMEM2-overexpressing cells (HepG2 TMEM2 and HepG2.2.15 TMEM2 cells), respectively. The expression of Interferon regulatory factor 9 (IRF9) was not affected by TMEM2. However, we found that overexpression and knockdown of TMEM2, respectively, promoted and inhibited importation of IRF9 into nuclei. The luciferase reporter assay showed that IRF9 nuclear translocation affected interferon-stimulated response element activities. In addition, the inhibitory effects of TMEM2 on HBV infection in HepG2 shTMEM2 cells was significantly enhanced by pre-treatment with interferon but significantly inhibited in HepG2.2.15 TMEM2 cells by pre-treatment with JAK1 inhibitor. TMEM2 inhibits HBV infection in HepG2 and HepG2.2.15 by activating the JAK-STAT signaling pathway.

  10. TMEM2 inhibits hepatitis B virus infection in HepG2 and HepG2.2.15 cells by activating the JAK–STAT signaling pathway

    Science.gov (United States)

    Zhu, X; Xie, C; Li, Y-m; Huang, Z-l; Zhao, Q-y; Hu, Z-x; Wang, P-p; Gu, Y-r; Gao, Z-l; Peng, L

    2016-01-01

    We have previously observed the downregulation of TMEM2 in the liver tissue of patients with chronic hepatitis B virus (HBV) infection and in HepG2.2.15 cells with HBV genomic DNA. In the present study, we investigated the role and mechanism of TMEM2 in HepG2 and HepG2.2.15 during HBV infection HepG2 and HepG2.2.15. HepG2 shTMEM2 cells with stable TMEM2 knockdown and HepG2 TMEM2 and HepG2.2.15 TMEM2 cells with stable TMEM2 overexpression were established using lentivirus vectors. We observed reduced expression of TMEM2 in HBV-infected liver tissues and HepG2.2.15 cells. HBsAg, HBcAg, HBV DNA, and HBV cccDNA levels were significantly increased in HepG2 shTMEM2 cells but decreased in HepG2 TMEM2 and HepG2.2.15 TMEM2 cells compared with naive HepG2 cells. On the basis of the western blotting results, the JAK–STAT signaling pathway was inhibited in HepG2 shTMEM2 cells but activated in HepG2 TMEM2 and HepG2.2.15 TMEM2 cells. In addition, reduced and increased expression of the antiviral proteins MxA and OAS1 was observed in TMEM2-silenced cells (HepG2 shTMEM2 cells) and TMEM2-overexpressing cells (HepG2 TMEM2 and HepG2.2.15 TMEM2 cells), respectively. The expression of Interferon regulatory factor 9 (IRF9) was not affected by TMEM2. However, we found that overexpression and knockdown of TMEM2, respectively, promoted and inhibited importation of IRF9 into nuclei. The luciferase reporter assay showed that IRF9 nuclear translocation affected interferon-stimulated response element activities. In addition, the inhibitory effects of TMEM2 on HBV infection in HepG2 shTMEM2 cells was significantly enhanced by pre-treatment with interferon but significantly inhibited in HepG2.2.15 TMEM2 cells by pre-treatment with JAK1 inhibitor. TMEM2 inhibits HBV infection in HepG2 and HepG2.2.15 by activating the JAK–STAT signaling pathway. PMID:27253403

  11. The Tenth-Order QED Contribution to the Lepton g-2: Evaluation of Dominant $\\alpha^5$ Terms of Muon g-2

    CERN Document Server

    Kinoshita, T

    2006-01-01

    The QED contribution to the anomalous magnetic moments of electron and muon are known very precisely up to the order $\\alpha^4$. However, the knowledge of $\\alpha^5$ term will also be required when the precision of measurement improves further. This paper reports the first systematic attempt to evaluate the $\\alpha^5$ term. Feynman diagrams contributing to this term can be classified into six gauge-invariant sets which can be subdivided further into 32 gauge-invariant subsets. Thus far we have numerically evaluated all integrals of 17 gauge-invariant subsets which contain light-by-light-scattering subdiagrams and/or vacuum-polarization subdiagrams. They cover most of leading terms of muon $g-2$ and lead to a preliminary result 652 (20) $(\\alpha/\\pi )^5$, which is 8.5 times more precise than the old estimate.

  12. Persistent currents in ferromagnetic condensates

    Science.gov (United States)

    Lamacraft, Austen

    2017-06-01

    Persistent currents in Bose condensates with a scalar order parameter are stabilized by the topology of the order parameter manifold. In condensates with multicomponent order parameters it is topologically possible for supercurrents to "unwind" without leaving the manifold. We study the energetics of this process in the case of ferromagnetic condensates using a long wavelength energy functional that includes both the superfluid and spin stiffnesses. Exploiting analogies to an elastic rod and rigid body motion, we show that the current carrying state in a 1D ring geometry transitions between a spin helix in the energy minima and a solitonlike configuration at the maxima. The relevance to recent experiments in ultracold atoms is briefly discussed.

  13. A new measurement of the leading hadronic corrections to the muon g-2*

    Directory of Open Access Journals (Sweden)

    Trentadue Luca

    2016-01-01

    Full Text Available A novel approach to determine the leading hadronic corrections to the muon g-2 is proposed. It consists in a measurement of the effective electromagnetic coupling in the space-like region. This method may become feasible at flavor factories resulting in a determination potentially competitive with the dispersive approach via time-like data.

  14. Three-dimensional spiral injection scheme for the g-2/EDM experiment at J-PARC

    Science.gov (United States)

    Iinuma, Hiromi; Nakayama, Hisayoshi; Oide, Katsunobu; Sasaki, Ken-ichi; Saito, Naohito; Mibe, Tsutomu; Abe, Mitsushi

    2016-10-01

    A newly developed three-dimensional spiral injection scheme for beam insertion into a solenoidal storage ring is reported. A new planned muon g-2/EDM experiment at J-PARC aims to measure g - 2 to a factor of 5 better statistical precision and a factor of 100 better sensitivity for the electric dipole moment (EDM) measurement compared to previous experiments. The J-PARC experiment will use a 3-T MRI solenoid magnet as the muon storage ring with a 0.66 m diameter to achieve a 1-ppm level of local uniformity. The previous g - 2 injection scheme is not applicable for beam injection into a small ring. The new scheme provides a smooth injection utilizing a radial solenoidal fringe field, without causing an error field in the storage volume. The expected storage efficiency is 80% and over, which is to be compared to 3.5% for the previous g - 2 experiment. In addition, the ability to control the storage plane is important for the EDM measurement. In this paper, we introduce the conceptual design and required beam parameters in terms of Twiss functions and the expected injection efficiency.

  15. Staphylococcus aureus Lpl Lipoproteins Delay G2/M Phase Transition in HeLa Cells.

    Science.gov (United States)

    Nguyen, Minh-Thu; Deplanche, Martine; Nega, Mulugeta; Le Loir, Yves; Peisl, Loulou; Götz, Friedrich; Berkova, Nadia

    2016-01-01

    The cell cycle is an ordered set of events, leading to cell growth and division into two daughter cells. The eukaryotic cell cycle consists of interphase (G1, S, and G2 phases), followed by the mitotic phase and G0 phase. Many bacterial pathogens secrete cyclomodulins that interfere with the host cell cycle. In Staphylococcus aureus four cyclomodulins have been described so far that all represent toxins and are secreted into the culture supernatant. Here we show that the membrane-anchored lipoprotein-like proteins (Lpl), encoded on a genomic island called νSaα, interact with the cell cycle of HeLa cells. By comparing wild type and lpl deletion mutant it turned out that the lpl cluster is causative for the G2/M phase transition delay and also contributes to increased invasion frequency. The lipoprotein Lpl1, a representative of the lpl cluster, also caused G2/M phase transition delay. Interestingly, the lipid modification, which is essential for TLR2 signaling and activation of the immune system, is not necessary for cyclomodulin activity. Unlike the other staphylococcal cyclomodulins Lpl1 shows no cytotoxicity even at high concentrations. As all Lpl proteins are highly conserved there might be a common function that is accentuated by their multiplicity in a tandem gene cluster. The cell surface localized Lpls' suggests a correlation between G2/M phase transition delay and host cell invasion.

  16. Pathways for Genome Integrity in G2 Phase of the Cell Cycle

    Directory of Open Access Journals (Sweden)

    Claus Storgaard Sørensen

    2012-11-01

    Full Text Available The maintenance of genome integrity is important for normal cellular functions, organism development and the prevention of diseases, such as cancer. Cellular pathways respond immediately to DNA breaks leading to the initiation of a multi-facetted DNA damage response, which leads to DNA repair and cell cycle arrest. Cell cycle checkpoints provide the cell time to complete replication and repair the DNA damage before it can continue to the next cell cycle phase. The G2/M checkpoint plays an especially important role in ensuring the propagation of error-free copies of the genome to each daughter cell. Here, we review recent progress in our understanding of DNA repair and checkpoint pathways in late S and G2 phases. This review will first describe the current understanding of normal cell cycle progression through G2 phase to mitosis. It will also discuss the DNA damage response including cell cycle checkpoint control and DNA double-strand break repair. Finally, we discuss the emerging concept that DNA repair pathways play a major role in the G2/M checkpoint pathway thereby blocking cell division as long as DNA lesions are present.

  17. CDK-1 Inhibition in G2 Stabilizes Kinetochore-Microtubules in the following Mitosis.

    Science.gov (United States)

    Gayek, A Sophia; Ohi, Ryoma

    2016-01-01

    Cell proliferation is driven by cyclical activation of cyclin-dependent kinases (CDKs), which produce distinct biochemical cell cycle phases. Mitosis (M phase) is orchestrated by CDK-1, complexed with mitotic cyclins. During M phase, chromosomes are segregated by a bipolar array of microtubules called the mitotic spindle. The essential bipolarity of the mitotic spindle is established by the kinesin-5 Eg5, but factors influencing the maintenance of spindle bipolarity are not fully understood. Here, we describe an unexpected link between inhibiting CDK-1 before mitosis and bipolar spindle maintenance. Spindles in human RPE-1 cells normally collapse to monopolar structures when Eg5 is inhibited at metaphase. However, we found that inhibition of CDK-1 in the G2 phase of the cell cycle improved the ability of RPE-1 cells to maintain spindle bipolarity without Eg5 activity in the mitosis immediately after release from CDK-1 inhibition. This improved bipolarity maintenance correlated with an increase in the stability of kinetochore-microtubules, the subset of microtubules that link chromosomes to the spindle. The improvement in bipolarity maintenance after CDK-1 inhibition in G2 required both the kinesin-12 Kif15 and increased stability of kinetochore-microtubules. Consistent with increased kinetochore-microtubule stability, we find that inhibition of CDK-1 in G2 impairs mitotic fidelity by increasing the incidence of lagging chromosomes in anaphase. These results suggest that inhibition of CDK-1 in G2 causes unpredicted effects in mitosis, even after CDK-1 inhibition is relieved.

  18. Recombination between G2 and G6 strains of rabbit hemorrhagic disease virus (RHDV) in China.

    Science.gov (United States)

    Hu, Bo; Wang, Fang; Fan, Zhiyu; Song, Yanhua; Abrantes, Joana; Zuo, Yuanyuan; Esteves, Pedro J

    2017-01-01

    Rabbit hemorrhagic disease (RHD) is an acute fatal disease caused by the lagovirus rabbit hemorrhagic disease virus (RHDV), which was first reported in 1984 in China. Genetic characterization of RHDV has demonstrated that two different genogroups (G2 and G6) are present in China. To gain a better understanding of the molecular evolution of RHDV, we searched for recombination events by analyzing all full-length RHDV capsid VP60 sequences of Chinese isolates belonging to the genogroups 2 and 6. Our results revealed a recombinant origin for the NanBu/China/2011 isolate. This recombination event occurred between G2 and G6 strains with two breakpoints located at nucleotide positions 393 and 1079 of the VP60 sequence. Phylogenetically, the NanBu/China/2011 strain clustered with genogroup G6 in the entire capsid gene sequence except in the fragment between nucleotides 394 and 1078, where it clustered with genogroup G2. As the consequences of the presence of a G2/G6 recombinant strain in China are unpredictable, the circulation of RHDV in the populations should be carefully monitored.

  19. Staphylococcus aureus Lpl Lipoproteins Delay G2/M Phase Transition in HeLa Cells

    Science.gov (United States)

    Nguyen, Minh-Thu; Deplanche, Martine; Nega, Mulugeta; Le Loir, Yves; Peisl, Loulou; Götz, Friedrich; Berkova, Nadia

    2016-01-01

    The cell cycle is an ordered set of events, leading to cell growth and division into two daughter cells. The eukaryotic cell cycle consists of interphase (G1, S, and G2 phases), followed by the mitotic phase and G0 phase. Many bacterial pathogens secrete cyclomodulins that interfere with the host cell cycle. In Staphylococcus aureus four cyclomodulins have been described so far that all represent toxins and are secreted into the culture supernatant. Here we show that the membrane-anchored lipoprotein-like proteins (Lpl), encoded on a genomic island called νSaα, interact with the cell cycle of HeLa cells. By comparing wild type and lpl deletion mutant it turned out that the lpl cluster is causative for the G2/M phase transition delay and also contributes to increased invasion frequency. The lipoprotein Lpl1, a representative of the lpl cluster, also caused G2/M phase transition delay. Interestingly, the lipid modification, which is essential for TLR2 signaling and activation of the immune system, is not necessary for cyclomodulin activity. Unlike the other staphylococcal cyclomodulins Lpl1 shows no cytotoxicity even at high concentrations. As all Lpl proteins are highly conserved there might be a common function that is accentuated by their multiplicity in a tandem gene cluster. The cell surface localized Lpls' suggests a correlation between G2/M phase transition delay and host cell invasion. PMID:28083519

  20. Colliding with G2 near the Galactic Centre: a geometrical approach

    CERN Document Server

    Marcos, R de la Fuente

    2013-01-01

    The object G2 will pass within nearly 100 au from Sgr A* in 2014. Due to its very short periapse, the study of the dynamical evolution of this object in the short-term future may offer some insight into the region surrounding the supermassive black hole at the centre of the Galaxy. With this scenario in mind, it has recently been proposed by Bartos et al. (arXiv:1302.3220) that, prior to its perinigricon, G2 will likely experience multiple encounters with members of the black hole and neutron star populations believed to orbit near the Galactic Centre. Here, we further explore this possibility and study the general case for collisions with the G2 object using the latest orbital solutions provided by Phifer et al. (arXiv:1304.5280) and Gillessen et al., (arXiv:1306.1374) and a Monte Carlo approach to estimate the minimum orbit intersection distance (MOID) with G2 as a function of the orbital parameters of the incoming body. Our results indicate that encounters at distances closer than 100 au started to become ...

  1. Asymptotical small-x behaviour of the spin structure functions $g_1$ and $g_2$

    CERN Document Server

    Ermolaev, B I

    1997-01-01

    We show that for small x and in the double logarithmic approximation (DLA) g_2 can be expressed through derivative of g_1 with respect to logarithm of the QCD coupling. Therefore the small-x behavior of the both structure functions is similar. The analytical expression for flavor nonsinglet structure function g_1 is presented and its asymptotical behaviour is calculated.

  2. PPARγ pathway activation results in apoptosis and COX-2 inhibition in HepG2 cells

    Institute of Scientific and Technical Information of China (English)

    Ming-Yi Li; Hua Deng; Jia-Ming Zhao; Dong Dai; Xiao-Yu Tan

    2003-01-01

    AIM: To investigate whether troglitazone (TGZ), theperoxisome proliferator-activated receptor (PPAR) gammaligand, can induce apoptosis and inhibit cell proliferation inhuman liver cancer cell line HepG2 and to explore themolecular mechanisms. METHODS: [3-(4,5)-dimethyithiazol-2-yl]-2,5-diphenyltetrazolium bromide (NTT), [3H] Thymidine incorporation,Hochest33258 staining, DNA ladder, enzyme-linkedimmunosorbent assay (ELISA), RT-PCR, Northern and Western blotting analyses were employed to investigate the effect of TGZ on HepG2 cells and related molecular mechanisms.RESULTS: TGZ was found to inhibit the growth of HepG2cells and to induce apoptosis. During the process, the expression of COX-2 mRNA and protein and Bcl-2 protein was down-regulated, while that of Bax and Bak proteins was up-regulated, and the activity of caspase-3 was elevated.Furthermore, the level of PGE2 was decreased transiently after 12 h of treatment with 30 gM troglitazone. CONCLUSION: TGZ inhibits cell proliferation and induces apoptosis in HepG2 cells, which may be associated with the activation of caspase-3-like proteases, down-regulation of the expression of COX-2 mRNA and protein, Bcl-2 protein,the elevation of PGE2 levels, and up-regulation of the expressions of Bax and Bak proteins.

  3. Octreotide induces caspase activation and apoptosis inhuman hepatoma HepG2 cells

    Institute of Scientific and Technical Information of China (English)

    Nikos J Tsagarakis; Ioannis Drygiannakis; Antonis G Batistakis; George Kolios; Elias A Kouroumalis

    2011-01-01

    AIM: To investigate the role of octreotide on cellular proliferation and apoptosis of human hepatoma (HepG2) cells.METHODS: We studied cellular proliferation, apoptosis and the possible internal caspase-mediated apoptosis pathway involved, after treatment of HepG2 carcinomacells with octreotide in comparison with the apoptosis caused by tumor necrosis factor-α (TNF-α). Activities of caspase-3, caspase-9, caspase-8 and caspase-2 were studied, while apoptosis was investigated through detection of DNA fragmentation and through identification of apoptotic cells with the annexin-V/propidium iodide flow cytometric method.RESULTS: After an initial increase in HepG2 cellular proliferation, a significant inhibition was observed with 10-8 mol/L octreotide, while TNF-α dose-dependentlydecreased proliferation. Early and late apoptosis was significantly increased with both substances. Octreotide significantly increased caspase-3, caspase-8 andcaspase-2 activity. TNF-α significantly increased only caspase-2. Cellular proliferation was decreased after treatment with octreotide or TNF-α alone but, in contrast to TNF-α, octreotide decreased proliferation onlyat concentrations of 10-8 mol/L, while lower concentrations increased proliferation.CONCLUSION: Our findings are suggestive of caspasemediated signaling pathways of octreotide antitumor activity in HepG2 cells, and indicate that measurementsof serum octreotide levels may be important, at least in clinical trials, to verify optimal therapeutic drug concentrations.

  4. RESEARCH OF SYNERGETIC RELIABILITY OF PEARLITE-REDUCED STRUCTURAL STEEL 09G2FB

    Directory of Open Access Journals (Sweden)

    Gustov Yuriy Ivanovich

    2012-10-01

    Full Text Available The primary objective of the research is the synergetic reliability of perlite-reduced structural steel 09G2FB exposed to various thermal and mechanical treatments. In the aftermath of the above exposure, the steel in question has proved to assume a set of strength-related and plastic mechanical properties (σσδ and ψ.

  5. Knockdown of nucleophosmin induces S-phase arrest in HepG2 cells

    Institute of Scientific and Technical Information of China (English)

    Qing-Qing Wang; Zhi-Yi Zhang; Jian-Yong Xiao; Chun Yi; Lin-Zi Li; Yan Huang; Jing-Ping Yun

    2011-01-01

    Nucleophosmin/B23 (NPM) is a universally expressed nucleolar phosphoprotein that participates in proliferation,apoptosis,ribosome assembly,and centrosome duplication; however,the role of NPM in cell cycle regulation is not well characterized.We investigated the mechanism by which NPM is involved in cell cycle regulation.NPM was knocked down using siRNA in HepG2 hepatoblastoma cells.NPM translocation following actinomycin D (ActD) treatment was investigated using immunofluorescent staining.Expression of NPM and other factors involved in cell cycle regulation was examined by Westem blotting.Cell cycle distribution was measured using flow cytometry to detect 5-ethynyl-2'-deoxyuddine (EdU) incorporation.Cell proliferation was quantified by the MTT assay.Knockdown of NPM increased the percentage of HepG2 calls in S phase and led to decreased expression of P53 and P21Cp1/WAF1.S-phase arrest in HepG2 cells was significantly enhanced by ActD treatment.Furthermore,knockdown of NPM abrogated ActD-induced G2/M phase call cycle arrest.Taken together,these data demonstrate that inhibition of NPM has a significant effect on the cell cycle.

  6. Effects of elaidic acid in a HepG2-SF liver cell model

    DEFF Research Database (Denmark)

    Hansen, Toke Peter Krogager

    lipidmetabolismen når HepG2-SF celler blev inkuberet med elaidinsyre sammenlignet med oleinsyre eller stearinsyre. Den mest fremtrædende ændring var en opregulering af enzymer som syntetiserer kolesterol og fedtsyrer, hvilken indikerede aktivering af sterol regulatory element-binding proteins (SREBPs). Dog blev...

  7. Curcumin and (-)-epigallocatechin-3-gallate attenuate acrylamide-induced proliferation in HepG2 cells.

    Science.gov (United States)

    Shan, Xiaoyun; Li, Yuan; Meng, Xulian; Wang, Pengqi; Jiang, Pan; Feng, Qing

    2014-04-01

    Acrylamide, a proven rodent carcinogen, is present in carbohydrate-rich food heated at high temperatures. It can be metabolized into glycidamide mainly by cytochrome P450 2E1 (CYP2E1). The fact that acrylamide is a potential carcinogen to human-beings draws public attention recently. This study aimed to elucidate the effect of acrylamide at low doses on proliferation of HepG2 cells, and to test whether the two well-studied chemopreventive agents, curcumin and (-)-epigallocatechin-3-gallate (EGCG), would have antagonistic effects against acrylamide. The results showed that lower concentration of acrylamide (⩽100μM) significantly increased the proliferation of HepG2 cells, but not of the other cancer cells (MDA-231, HeLa, A549, and PC-3). Only in HepG2 cells, low concentration of acrylamide was able to induce CYP2E1 expression significantly. Knockdown of CYP2E1 restrained acrylamide to increase viability of HepG2 cells. In addition, acrylamide raised expression of epidermal growth factor receptor (EGFR), cyclin D1 and nuclear factor-κB (NF-κB), which contributed to cell proliferation. Both curcumin and EGCG effectively reduced acrylamide-induced proliferation, as well as protein expression of CYP2E1, EGFR, cyclin D1 and NF-κB. All these results suggest that low concentration of acrylamide may contribute to progression of hepatocellular carcinoma (HCC). Curcumin or EGCG could prevent acrylamide triggering this effect.

  8. Hyperglycemia and anthocyanin inhibit quercetin metabolism in HepG2 cells

    Science.gov (United States)

    A high glucose (Glu) milieu promotes generation of reactive oxygen species, which may not only cause cellular damage, but also modulate phase II enzymes that are responsible for the metabolism of flavonoids. Thus, we examined the effect of a high Glu milieu on quercetin (Q) metabolism in HepG2 cells...

  9. Mangiferin: A xanthone attenuates mercury chloride induced cytotoxicity and genotoxicity in HepG2 cells.

    Science.gov (United States)

    Kaivalya, Mudholkar; Nageshwar Rao, B N; Satish Rao, B S

    2011-01-01

    Mangiferin (MGN), a dietary C-glucosylxanthone present in Mangifera indica, is known to possess a spectrum of beneficial pharmacological properties. This study demonstrates antigenotoxic potential of MGN against mercuric chloride (HgCl2)-induced genotoxicity in HepG2 cell line. Treatment of HepG2 cells with various concentrations of HgCl2 for 3 h caused a dose-dependent increase in micronuclei frequency and elevation in DNA strand breaks (olive tail moment and tail DNA). Pretreatment with MGN significantly (p inhibited HgCl2 -induced (20 µM for 30 h) DNA damage. An optimal antigenotoxic effect of MGN, both in micronuclei and comet assay, was observed at a concentration of 50 µM. Furthermore, HepG2 cells treated with various concentrations of HgCl2 resulted in a dose-dependent increase in the dichlorofluorescein fluorescence, indicating an increase in the generation of reactive oxygen species (ROS). However, MGN by itself failed to generate ROS at a concentration of 50 µM, whereas it could significantly decrease HgCl2 -induced ROS. Our study clearly demonstrates that MGN pretreatment reduced the HgCl2-induced DNA damage in HepG2 cells, thus demonstrating the genoprotective potential of MGN, which is mediated mainly by the inhibition of oxidative stress.

  10. Zero Action on Perfect Crystals for U_q(G_2^{(1)})

    CERN Document Server

    Misra, Kailash C; Okado, Masato

    2009-01-01

    The explicit zero action of Kashiwara operators on the U'_q(G_2^{(1)})-crystal B_l constructed by Yamane are presented by using a similarity technique from that of a U'_q(D_4^{(3)})-crystal. It is shown that these crystals form a coherent family of perfect crystals.

  11. On the Perplexingly Low Rate of Transport of IgG2 across the Human Placenta

    NARCIS (Netherlands)

    Einarsdottir, Helga K.; Stapleton, Nigel M.; Scherjon, Sicco; Andersen, Jan Terje; Rispens, Theo; van der Schoot, C. Ellen; Vidarsson, Gestur

    2014-01-01

    The neonatal receptor, FcRn, mediates both serum half-life extension as well as active transport of maternal IgG to the fetus during pregnancy. Therefore, transport efficiency and half-life go hand-in-hand. However, while the half-life of the human IgG2 subclass is comparable to IgG1, the placental

  12. Analysis of the hadronic light-by-light contributions to the muon g - 2

    NARCIS (Netherlands)

    Bijnens, Johan; Pallante, Elisabetta; Prades, Joaquim

    1996-01-01

    We calculate the hadronic light-by-light contributions to the muon g - 2. We use both 1/Nc and chiral counting to organize the calculation. Then we calculate the leading and next-to-leading order in the 1/Nc expansion low energy contributions using the Extended Nambu-Jona-Lasinio model as hadronic m

  13. Surface Grafted Glycopolymer Brushes to Enhance Selective Adhesion of HepG2 Cells

    DEFF Research Database (Denmark)

    Chernyy, Sergey; Jensen, Bettina Elisabeth Brøgger; Shimizu, Kyoko;

    2013-01-01

    of the cell periphery. On the other hand the cells on bare glass substrate display spheroid morphology. Further analysis using ToF-SIMS imaging shows that the HepG2 cells on glycopolymer surfaces is enriched with protein fragment along the cell periphery which is absent in the case of cells on bare glass...

  14. Polarization Restricts Hepatitis C Virus Entry into HepG2 Hepatoma Cells

    NARCIS (Netherlands)

    Mee, Christopher J.; Harris, Helen J.; Farquhar, Michelle J.; Wilson, Garrick; Reynolds, Gary; Davis, Christopher; van IJzendoorn, Sven C. D.; Balfe, Peter; McKeating, Jane A.

    2009-01-01

    The primary reservoir for hepatitis C virus (HCV) replication is believed to be hepatocytes, which are highly polarized with tight junctions (TJ) separating their basolateral and apical domains. HepG2 cells develop polarity over time, resulting in the formation and remodeling of bile canalicular

  15. BRCA1 and its phosphorylation involved in caffeine-inhibitable event upstream of G2 checkpoint

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Caffeine,which specifically inhibits ATM/ATR kinases,efficiently abrogates the ionizing radiation(IR)-induced G2 arrest and increases the sensitivity of various tumor cells to IR.Mechanisms for the effect of caffeine remain to be elucidated.As a target of ATM/ATR kinases,BRCA1 becomes activated and phosphorylated in response to IR.Thus,in this work,we investigated the possible role of BRCA1 in the effect of caffeine on G2 checkpoint and observed how BRCA1 phosphorylation was regulated in this process.For these purposes,the BRCA1 protein level and the phosphorylation states were analyzed by Western blotting by using an antibody against BRCA1 and phospho-specific antibodies against Ser-1423 and Ser-1524 residues in cells exposed to a combination of IR and caffeine.The results showed that caffeine down-regulated IR-induced BRCA1 expression and specifically abolished BRCA1 phosphorylation of Ser-1524,which was followed by an override of G2 arrest by caffeine.In addition,the ability of BRCA1 to transactivate p21 may be required for MCF-7 but not necessary for Hela response to caffeine.These data suggest that BRCA1 may be a potential target of caffeine.BRCA1 and its phosphorylation are most likely to be involved in the caffeine-inhibitable event upstream of G2 arrest.

  16. Scrutinizing the pion condensed phase

    Energy Technology Data Exchange (ETDEWEB)

    Carignano, Stefano; Mammarella, Andrea; Mannarelli, Massimo [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Lepori, Luca [Universita di Padova, Dipartimento di Fisica e Astronomia, Padova (Italy); Universita dell' Aquila, Dipartimento di Scienze Fisiche e Chimiche, Coppito-L' Aquila (Italy); Pagliaroli, Giulia [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Gran Sasso Science Institute, L' Aquila (Italy)

    2017-02-15

    When the isospin chemical potential exceeds the pion mass, charged pions condense in the zero-momentum state forming a superfluid. Chiral perturbation theory provides a very powerful tool for studying this phase. However, the formalism that is usually employed in this context does not clarify various aspects of the condensation mechanism and makes the identification of the soft modes problematic. We re-examine the pion condensed phase using different approaches within the chiral perturbation theory framework. As a first step, we perform a low-density expansion of the chiral Lagrangian valid close to the onset of the Bose-Einstein condensation. We obtain an effective theory that can be mapped to a Gross-Pitaevskii Lagrangian in which, remarkably, all the coefficients depend on the isospin chemical potential. The low-density expansion becomes unreliable deep in the pion condensed phase. For this reason, we develop an alternative field expansion deriving a low-energy Lagrangian analog to that of quantum magnets. By integrating out the ''radial'' fluctuations we obtain a soft Lagrangian in terms of the Nambu-Goldstone bosons arising from the breaking of the pion number symmetry. Finally, we test the robustness of the second-order transition between the normal and the pion condensed phase when next-to-leading-order chiral corrections are included. We determine the range of parameters for turning the second-order phase transition into a first-order one, finding that the currently accepted values of these corrections are unlikely to change the order of the phase transition. (orig.)

  17. Oceanic Climatology in the Coupled Model FGOALS-g2:Improvements and Biases

    Institute of Scientific and Technical Information of China (English)

    LIN Pengfei; YU Yongqiang; LIU Hailong

    2013-01-01

    The present study examines simulated oceanic climatology in the Flexible Global Ocean-Atmosphere-Land System model,Grid-point Version 2 (FGOALS-g2) forced by historical external forcing data.The oceanic temperatures and circulations in FGOALS-g2 were found to be comparable to those observed,and substantially improved compared to those simulated by the previous version,FGOALS-g1.0.Compared with simulations by FGOALS-g1.0,the shallow mixed layer depths were better captured in the eastern Atlantic and Pacific Ocean in FGOALS-g2.In the high latitudes of the Northern Hemisphere,the cold biases of SST were about 1℃ 5℃ smaller in FGOALS-g2.The associated sea ice distributions and their seasonal cycles were more realistic in FGOALS-g2.The pattern of Atlantic Meridional Overturning Circulation (AMOC) was better simulated in FGOALS-g2,although its magnitude was larger than that found in observed data.The simulated Antarctic Circumpolar Current (ACC) transport was about 140 Sv through the Drake Passage,which is close to that observed.Moreover,Antarctic Intermediate Water (AAIW) was better captured in FGOALS-g2.However,large SST cold biases (>3℃) were still found to exist around major western boundary currents and in the Barents Sea,which can be explained by excessively strong oceanic cold advection and unresolved processes owing to the coarse resolution.In the Indo-Pacific warm pool,the cold biases were partly related to the excessive loss of heat from the ocean.Along the eastern coast in the Atlantic and Pacific Oceans,the warm biases were due to overestimation of shortwave radiation.In the Indian Ocean and Southern Ocean,the surface fresh biases were mainly due to the biases of precipitation.In the tropical Pacific Ocean,the surface fresh biases (>2 psu) were mainly caused by excessive precipitation and oceanic advection.In theIndo-Pacific Ocean,fresh biases were also found to dominate in the upper 1000 m,except in the northeastern Indian Ocean.There were warm and

  18. Prematurity: an overview and public health implications.

    Science.gov (United States)

    McCormick, Marie C; Litt, Jonathan S; Smith, Vincent C; Zupancic, John A F

    2011-01-01

    The high rate of premature births in the United States remains a public health concern. These infants experience substantial morbidity and mortality in the newborn period, which translate into significant medical costs. In early childhood, survivors are characterized by a variety of health problems, including motor delay and/or cerebral palsy, lower IQs, behavior problems, and respiratory illness, especially asthma. Many experience difficulty with school work, lower health-related quality of life, and family stress. Emerging information in adolescence and young adulthood paints a more optimistic picture, with persistence of many problems but with better adaptation and more positive expectations by the young adults. Few opportunities for prevention have been identified; therefore, public health approaches to prematurity include assurance of delivery in a facility capable of managing neonatal complications, quality improvement to minimize interinstitutional variations, early developmental support for such infants, and attention to related family health issues.

  19. Chronic Exposure to Particulate Chromate Induces Premature Centrosome Separation and Centriole Disengagement in Human Lung Cells

    Science.gov (United States)

    Martino, Julieta; Holmes, Amie L.; Xie, Hong; Wise, Sandra S.; Wise, John Pierce

    2015-01-01

    Particulate hexavalent chromium (Cr(VI)) is a well-established human lung carcinogen. Lung tumors are characterized by structural and numerical chromosome instability. Centrosome amplification is a phenotype commonly found in solid tumors, including lung tumors, which strongly correlates with chromosome instability. Human lung cells exposed to Cr(VI) exhibit centrosome amplification but the underlying phenotypes and mechanisms remain unknown. In this study, we further characterize the phenotypes of Cr(VI)-induced centrosome abnormalities. We show that Cr(VI)-induced centrosome amplification correlates with numerical chromosome instability. We also show chronic exposure to particulate Cr(VI) induces centrosomes with supernumerary centrioles and acentriolar centrosomes in human lung cells. Moreover, chronic exposure to particulate Cr(VI) affects the timing of important centriolar events. Specifically, chronic exposure to particulate Cr(VI) causes premature centriole disengagement in S and G2 phase cells. It also induces premature centrosome separation in interphase. Altogether, our data suggest that chronic exposure to particulate Cr(VI) targets the protein linkers that hold centrioles together. These centriolar linkers are important for key events of the centrosome cycle and their premature disruption might underlie Cr(VI)-induced centrosome amplification. PMID:26293554

  20. On the onset of surface condensation: formation and transition mechanisms of condensation mode

    Science.gov (United States)

    Sheng, Qiang; Sun, Jie; Wang, Qian; Wang, Wen; Wang, Hua Sheng

    2016-08-01

    Molecular dynamics simulations have been carried out to investigate the onset of surface condensation. On surfaces with different wettability, we snapshot different condensation modes (no-condensation, dropwise condensation and filmwise condensation) and quantitatively analyze their characteristics by temporal profiles of surface clusters. Two different types of formation of nanoscale droplets are identified, i.e. the formations with and without film-like condensate. We exhibit the effect of surface tensions on the formations of nanoscale droplets and film. We reveal the formation mechanisms of different condensation modes at nanoscale based on our simulation results and classical nucleation theory, which supplements the ‘classical hypotheses’ of the onset of dropwise condensation. We also reveal the transition mechanism between different condensation modes based on the competition between surface tensions and reveal that dropwise condensation represents the transition states from no-condensation to filmwise condensation.

  1. Turbulent mixing condensation nucleus counter

    Science.gov (United States)

    Mavliev, Rashid

    The construction and operating principles of the Turbulent Mixing Condensation Nucleus Counter (TM CNC) are described. Estimations based on the semiempirical theory of turbulent jets and the classical theory of nucleation and growth show the possibility of detecting particles as small as 2.5 nm without the interference of homogeneous nucleation. This conclusion was confirmed experimentally during the International Workshop on Intercomparison of Condensation Nuclei and Aerosol Particle Counters (Vienna, Austria). Number concentration, measured by the Turbulent Mixing CNC and other participating instruments, is found to be essentially equal.

  2. Condensed Matter Physics - Biology Resonance

    Science.gov (United States)

    Baskaran, G.

    The field of condensed matter physics had its genesis this century and it has had a remarkable evolution. A closer look at its growth reveals a hidden aim in the collective consciousness of the field - a part of the development this century is a kind of warm up exercise to understand the nature of living condensed matter, namely the field of biology, by a growing new breed of scientists in the coming century. Through some examples the vitality of this interaction will be pointed out.

  3. The genetic basis of premature ovarian failure.

    Science.gov (United States)

    Woad, Kathryn J; Watkins, Wendy J; Prendergast, Deborah; Shelling, Andrew N

    2006-06-01

    Premature ovarian failure (POF) is a common condition, affecting approximately 1:100 women. It is characterised by amenorrhea, hypoestrogenism, and elevated gonadotrophin levels in women under the age of 40. It is often an unexpected and distressing diagnosis, which coincides with infertility and menopausal symptoms. There is a well recognised genetic basis to the development of POF. Our laboratory has identified several candidate genes associated with POF.

  4. Progeria: A rare genetic premature ageing disorder

    OpenAIRE

    Jitendra Kumar Sinha; Shampa Ghosh; Manchala Raghunath

    2014-01-01

    Progeria is characterized by clinical features that mimic premature ageing. Although the mutation responsible for this syndrome has been deciphered, the mechanism of its action remains elusive. Progeria research has gained momentum particularly in the last two decades because of the possibility of revealing evidences about the ageing process in normal and other pathophysiological conditions. Various experimental models, both in vivo and in vitro, have been developed in an effort to understand...

  5. The drug treatment of premature ejaculation

    OpenAIRE

    Hisasue, Shin-ichi

    2016-01-01

    The management recommendation for both acquired premature ejaculation (APE) and lifelong PE (LPE) are similar, such as a behavioral/psychotherapy, a pharmacotherapy and a combination of these treatments. For the drug treatment for PE, gold standard is selective serotonin reuptake inhibitors (SSRIs) including dapoxetine or paroxetine. The drug treatment for PE is still developing and some new promising therapeutic options have been proposed. Topical anesthetics, tramadol, and alpha-1 blockers ...

  6. Quarter variation and correlations of colostrum albumin, immunoglobulin G1 and G2 in dairy cows.

    Science.gov (United States)

    Samarütel, Jaak; Baumrucker, Craig R; Gross, Josef J; Dechow, Chad D; Bruckmaier, Rupert M

    2016-05-01

    A high variation in immunoglobulin G1 (IgG1) concentration in first milked quarter colostrum has been reported, but BSA quarter colostrum variation is not known. The occurrence of serum albumin in milk has been attributed to increased blood-milk barrier penetration. Reports of serum albumin binding to the Fc Receptor of the neonate, the receptor thought to be responsible for IgG1 transcytosis, suggested that a correlation with the appearance of IgG1 in colostrum of dairy cows was likely. The objective of the study was to establish the quarter colostrum concentration and mass of immunoglobulins and serum albumin. First colostrum was quarter collected within 4 h of parturition from healthy udders of 31 multiparous dairy cows. Individual quarter colostrum weight was determined and a sample of each was frozen for subsequent analysis. Concentrations of immunoglobulin G1, G2, and BSA were measured by ELISA and total mass of components was calculated. In addition, colostrum was also analysed for L-lactate dehydrogenase activity. Analysis of concentration and mass of BSA, immunoglobulin G1, G2 established that the quarter variations were different by cow, quarter and quarter within cow. Partial correlations corrected for colostrum weight indicated that BSA and IgG2 concentration and mass are closely correlated while that of BSA and IgG1 concentration and mass exhibited no correlation suggesting that BSA and IgG1 may have different transport mechanisms. Interestingly, immunoglobulin G1 and G2 concentration and mass exhibited strong correlations suggesting that also some unknown mechanism of immunoglobulin G2 appearance in colostrum is occurring. Finally, no measured protein exhibited any correlation with the activity of lactate dehydrogenase in colostrum.

  7. Inhibition of energy-producing pathways of HepG2 cells by 3-bromopyruvate.

    Science.gov (United States)

    Pereira da Silva, Ana Paula; El-Bacha, Tatiana; Kyaw, Nattascha; dos Santos, Reinaldo Sousa; da-Silva, Wagner Seixas; Almeida, Fabio C L; Da Poian, Andrea T; Galina, Antonio

    2009-02-01

    3-BrPA (3-bromopyruvate) is an alkylating agent with anti-tumoral activity on hepatocellular carcinoma. This compound inhibits cellular ATP production owing to its action on glycolysis and oxidative phosphorylation; however, the specific metabolic steps and mechanisms of 3-BrPA action in human hepatocellular carcinomas, particularly its effects on mitochondrial energetics, are poorly understood. In the present study it was found that incubation of HepG2 cells with a low concentration of 3-BrPA for a short period (150 microM for 30 min) significantly affected both glycolysis and mitochondrial respiratory functions. The activity of mitochondrial hexokinase was not inhibited by 150 microM 3-BrPA, but this concentration caused more than 70% inhibition of GAPDH (glyceraldehyde-3-phosphate dehydrogenase) and 3-phosphoglycerate kinase activities. Additionally, 3-BrPA treatment significantly impaired lactate production by HepG2 cells, even when glucose was withdrawn from the incubation medium. Oxygen consumption of HepG2 cells supported by either pyruvate/malate or succinate was inhibited when cells were pre-incubated with 3-BrPA in glucose-free medium. On the other hand, when cells were pre-incubated in glucose-supplemented medium, oxygen consumption was affected only when succinate was used as the oxidizable substrate. An increase in oligomycin-independent respiration was observed in HepG2 cells treated with 3-BrPA only when incubated in glucose-supplemented medium, indicating that 3-BrPA induces mitochondrial proton leakage as well as blocking the electron transport system. The activity of succinate dehydrogenase was inhibited by 70% by 3-BrPA treatment. These results suggest that the combined action of 3-BrPA on succinate dehydrogenase and on glycolysis, inhibiting steps downstream of the phosphorylation of glucose, play an important role in HepG2 cell death.

  8. Cytotoxic and antimigratory effects of Cratoxy formosum extract against HepG2 liver cancer cells.

    Science.gov (United States)

    Buranrat, Benjaporn; Mairuae, Nootchanat; Kanchanarach, Watchara

    2017-04-01

    The aim of the present study was to investigate the molecular mechanisms underlying Cratoxylum formosum (CF) Dyer-induced cancer cell death and antimigratory effects in HepG2 liver cancer cells. The cytotoxic, antiproliferative and antimigratory effects of CF leaf extract on human liver cancer HepG2 cell lines were evaluated using sulforhodamine B, colony formation, and wound healing assays. In addition, apoptosis induction mechanisms were investigated via reactive oxygen species (ROS) formation, caspase 3 activities, and mitochondrial membrane potential (ΔΨm) disruption. Gene expression and apoptosis-associated protein levels were measured by reverse transcription-quantitative polymerase chain reaction and western blotting. CF induced HepG2 cell death in a time- and dose-dependent manner with half maximal inhibitory concentration values of 219.03±9.96 and 124.90±6.86 µg/ml at 24 and 48 h, respectively. Treatment with CF caused a significant and dose-dependent decrease in colony forming ability and cell migration. Furthermore, the present study demonstrated that CF induced ROS formation, increased caspase 3 activities, decreased the ΔΨm, and caused HepG2 apoptosis. CF marginally decreased the expression level of the cell cycle regulatory protein, ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) and the downstream protein, cyclin dependent kinase 6. Additionally, CF significantly enhanced p21 levels, reduced cyclin D1 protein levels and triggered cancer cell death. CF leaf extracts induced cell death, stimulated apoptosis and inhibited migration in HepG2 cells. Thus, CF may be useful for developing an anticancer drug candidate for the treatment of liver cancer.

  9. Long G2 accumulates recombination intermediates and disturbs chromosome segregation at dysfunction telomere in Schizosaccharomyces pombe

    Energy Technology Data Exchange (ETDEWEB)

    Habib, Ahmed G.K.; Masuda, Kenta; Yukawa, Masashi; Tsuchiya, Eiko [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8530 (Japan); Ueno, Masaru, E-mail: scmueno@hiroshima-u.ac.jp [Department of Molecular Biotechnology, Graduate School of Advanced Sciences of Matter, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8530 (Japan); Research Center for the Mathematics on Chromatin Live Dynamics, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8530 (Japan)

    2015-08-14

    Protection of telomere (Pot1) is a single-stranded telomere binding protein which is essential for chromosome ends protection. Fission yeast Rqh1 is a member of RecQ helicases family which has essential roles in the maintenance of genomic stability and regulation of homologous recombination. Double mutant between fission yeast pot1Δ and rqh1 helicase dead (rqh1-hd) maintains telomere by homologous recombination. In pot1Δ rqh1-hd double mutant, recombination intermediates accumulate near telomere which disturb chromosome segregation and make cells sensitive to microtubule inhibitors thiabendazole (TBZ). Deletion of chk1{sup +} or mutation of its kinase domain shortens the G2 of pot1Δ rqh1-hd double mutant and suppresses both the accumulation of recombination intermediates and the TBZ sensitivity of that double mutant. In this study, we asked whether the long G2 is the reason for the TBZ sensitivity of pot1Δ rqh1-hd double mutant. We found that shortening the G2 of pot1Δ rqh1-hd double mutant by additional mutations of wee1 and mik1 or gain of function mutation of Cdc2 suppresses both the accumulation of recombination intermediates and the TBZ sensitivity of pot1Δ rqh1-hd double mutant. Our results suggest that long G2 of pot1Δ rqh1-hd double mutant may allow time for the accumulation of recombination intermediates which disturb chromosome segregation and make cells sensitive to TBZ. - Ηighlights: • We show link between long G2 and accumulation of toxic recombination intermediates. • Accumulation of recombination intermediates at telomere results in TBZ sensitivity. • Activation of DNA damage checkpoint worsens cells' viability in presence of TBZ.

  10. [Prematurity risk according to prematurity risk score and postpartal morbidity of the newborn infants (author's transl)].

    Science.gov (United States)

    Coradello, H; Lubec, G; Simbruner, G

    1981-02-01

    Risk of premature birth was evaluated retrospectively in 610 women in the first days after delivery using the prematurity risk score published by Thalhammer 1973. The calculated risk of premature birth was compared than prospectively to postpartal morbidity of the newborn infants as determined by duration of hospital stay, incidence of respiratory distress syndrome, need of artificial ventilation and mortality. A positive correlation could be found between risk of premature birth and postpartal morbidity of the newborn infants especially in small premature infants with birthweights of 2000 grams and less. The same correlation existed also in two groups of infants out of two different obstetric clinics which showed the same distribution of prenatal risks and the same prenatal care frequencies. It clearly becomes evident that infants with the same prenatal risks but good prenatal care during pregnancy had much lower hospital stays, lower respiratory distress frequencies and lower mortality rates than babies delivered from pregnancies badly cared for. These prenatal care related differences in postpartum morbidity again were much more evident in infants out of lower birth weight classes.

  11. Evaporative Condensers in Comfortable Air Conditioning System

    Institute of Scientific and Technical Information of China (English)

    YIN Ying-de; ZHU Dong-sheng; DU Gui-mei; LI Yuan-xi; SUN He-jing; LIU Qing-ming

    2009-01-01

    The operating theory of an evaporative condenser was expatiated.The difference between an e-vaporative condensing refrigeration system and a general refrigeration system was analyzed.Compared with the air-cooled and the water-cooled,the virtues of energy-conservation and water-conservation of evaporative con-densers were analyzed.Some questions existing in the application of evaporative condensers were pointed out,the corresponding solving methods were analyzed accordingly,and the development trend of evaporative con-densing technique in mechanical refrigeration system field and the applied foreground of evaporative condensers in comfortable air conditioning were prospected.

  12. Effect of shikonin on multidrug resistance in HepG2: The role of SIRT1.

    Science.gov (United States)

    Jin, Yong-Dong; Ren, Yi; Wu, Ming-Wei; Chen, Ping; Lu, Jin

    2015-07-01

    Overexpression of SIRT1 is considered to enhance the resistance of HepG2 cells to irradiation. Shikonin, a naturally occurring naphthoquinone compound, displays anticancer effects and circumvents cancer drug resistance. This study investigated the MDR reversal effect of shikonin induced by the overexpression of SIRT1. The overexpression of SIRT1 in HepG2 cells was established by lentivirus infection. Five days after transduction, real-time quantitative polymerase chain reaction and western blotting were used to detect the expression of SIRT1 and MDR1/P-gp. Drug resistance was also evaluated by flow cytometry after rhodamine-123 staining. On day 5, the multidrug resistance cells were treated by shikonin (10(-7), 10(-6), and 10(-5) µmol/L) one time. The cell viability was detected by the MTT assay, and apoptosis was evaluated by Hoechst 33342 staining and caspase-3 activity 24 h after shikonin treatment. Overexpression of SIRT1 decreased rhodamine-123 staining and successfully produced the R-HepG2 cell line. Compared with HepG2, the expression of MDR1/P-gp mRNA (3.45 ± 0.35) and protein (1.40 ± 0.05) were both upregulated in R-HepG2. Shikonin inhibited cell viability (from 93.9 ± 2.1 to 66.7 ± 1.5%), induced apoptosis of R-HepG2 (apoptotic ratio from 3.5 ± 0.8 to 47.5 ± 2.7%, caspase-3 activity from 103.5 ± 1.9 to 329.2 ± 14.9%, respectively), downregulated the mRNA and protein expression of SIRT1 and MDR1/P-gp, and decreased rhodamin 123 efflux. In the present study, we demonstrated that shikonin is able to overcome drug resistance in hepatocellular carcinoma cells, and the mechanism is related to the SIRT1-MDR1/P-gp signaling pathway.

  13. Condensational theory of stationary tornadoes

    CERN Document Server

    Makarieva, Anastassia M; Nefiodov, Andrei V; 10.1016/j.physleta.2011.04.023

    2012-01-01

    Using the Bernoulli integral for air streamline with condensing water vapor a stationary axisymmetric tornado circulation is described. The obtained profiles of vertical, radial and tangential velocities are in agreement with observations for the Mulhall tornado, world's largest on record and longest-lived among the three tornadoes for which 3D velocity data are available. Maximum possible vortex velocities are estimated.

  14. Approaching Bose-Einstein Condensation

    Science.gov (United States)

    Ferrari, Loris

    2011-01-01

    Bose-Einstein condensation (BEC) is discussed at the level of an advanced course of statistical thermodynamics, clarifying some formal and physical aspects that are usually not covered by the standard pedagogical literature. The non-conventional approach adopted starts by showing that the continuum limit, in certain cases, cancels out the crucial…

  15. Magnetofermionic condensate in two dimensions

    Science.gov (United States)

    Kulik, L. V.; Zhuravlev, A. S.; Dickmann, S.; Gorbunov, A. V.; Timofeev, V. B.; Kukushkin, I. V.; Schmult, S.

    2016-11-01

    Coherent condensate states of particles obeying either Bose or Fermi statistics are in the focus of interest in modern physics. Here we report on condensation of collective excitations with Bose statistics, cyclotron magnetoexcitons, in a high-mobility two-dimensional electron system in a magnetic field. At low temperatures, the dense non-equilibrium ensemble of long-lived triplet magnetoexcitons exhibits both a drastic reduction in the viscosity and a steep enhancement in the response to the external electromagnetic field. The observed effects are related to formation of a super-absorbing state interacting coherently with the electromagnetic field. Simultaneously, the electrons below the Fermi level form a super-emitting state. The effects are explicable from the viewpoint of a coherent condensate phase in a non-equilibrium system of two-dimensional fermions with a fully quantized energy spectrum. The condensation occurs in the space of vectors of magnetic translations, a property providing a completely new landscape for future physical investigations.

  16. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  17. 26 CFR 31.3406(g)-2 - Exception for reportable payment for which withholding is otherwise required.

    Science.gov (United States)

    2010-04-01

    ... withholding is otherwise required. 31.3406(g)-2 Section 31.3406(g)-2 Internal Revenue INTERNAL REVENUE SERVICE... TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3406(g)-2 Exception... wages (as defined in section 3401) because, e.g., the employee makes a certification under section...

  18. Evolution equation for the structure function g_2(x,Q^2)

    CERN Document Server

    Braun, V M; Manashov, A N

    2001-01-01

    We perform an extensive study of the scale dependence of flavor-singlet contributions to the structure function g_2(x,Q^2) in polarized deep-inelastic scattering. We find that the mixing between quark-antiquark-gluon and three-gluon twist-3 operators only involves the three-gluon operator with the lowest anomalous dimension and is weak in other cases. This means, effectively, that only those three-gluon operators with the lowest anomalous dimension for each moment are important, and allows to formulate a simple two-component parton-like description of g_2(x,Q^2) in analogy with the conventional description of twist-2 parton distributions. The similar simplification was observed earlier for the nonsinglet distributions, although the reason is in our case different.

  19. Kinetics of aflatoxin B1 and G2 adsorption on Ca-clinoptilolite

    Directory of Open Access Journals (Sweden)

    VERA DONDUR

    2000-10-01

    Full Text Available The kinetics of aflatoxins B1 and G2 adsorption on Ca-clinoptilolite at pH 2 and 7, in aqueous electrolyte at 37°C were studied. For both aflatoxins, the adsorption process begins with a fast reaction whereby most of the toxin is adsorbed in the first few minutes. This fast process is followed by the significantly slower process of aflatoxin bonding at active centers of mineral adsorbent. The initial rate method showed that the fast adsorption process of aflatoxin B1 and G2, at both pH values is a first order reaction, while the slow adsorption process of these aflatoxins is a zero order reaction. The adsorption indexes and adsorption rates for both examined toxins were pH dependent. In the investigated initial toxins concentration ranges (500–3000 µg/dm3, high adsorption indexes were achieved (> 80 %.

  20. Weyl Modules for Groups of Type B(2) and G(2)

    Science.gov (United States)

    Fitzgerald, John G. M.

    Available from UMI in association with The British Library. Requires signed TDF. In this thesis we determine the submodule structure of a number of Weyl modules for algebraic groups with root systems B_2 and G_2 . We use the Jantzen sum formula to find the composition factors of Weyl modules and go on to use homomorphisms between Weyl modules, given by H. H. Andersen, and the comparison of two filtrations of tensor products of Weyl modules to establish submodule structure. A computer program in the Prolog language is given which calculates the Jantzen sum formula. In addition we find one 2-dimensional Ext group for simple modules for type G_2 in characteristic greater than or equal to 7.

  1. Development and testing of fiber beam monitors for the Muon g-2 experiment

    Science.gov (United States)

    Bjorkquist, Robin; Diamond, Edward; Martinez, Benjamin; Sblendorio, Alec; Gray, Frederick; Muon g-2 Collaboration

    2017-01-01

    The Muon g-2 experiment at Fermilab will measure the anomalous magnetic moment of the muon to a precision of 140 parts per billion. Careful characterization of the stored muon beam will be crucial for the experiment, because several beam-related systematic effects must be taken into account. The fiber beam monitors will provide a direct measurement of the spatial, temporal and momentum distributions and betatron oscillations of the stored muon beam. These detectors were originally built by KEK for the previous Muon g-2 experiment at Brookhaven National Lab, but have been repaired and refurbished for the upcoming experiment, including new scintillating fibers and upgraded SiPM-based readout electronics. We present the final design of the fiber beam monitor system and the results of a recent beam test performed at SLAC.

  2. Enhanced diphoton signal of the Higgs boson and the muon g-2 in gauge mediation models

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Ryosuke; Tobioka, Kohsaku [Department of Physics, University of Tokyo, Tokyo 113-0033 (Japan); Kavli Institute for the Physics and Mathematics of the Universe (WPI), Todai Institutes for Advanced Study, University of Tokyo, Kashiwa 277-8583 (Japan); Yokozaki, Norimi, E-mail: yokozaki@hep-th.phys.s.u-tokyo.ac.jp [Kavli Institute for the Physics and Mathematics of the Universe (WPI), Todai Institutes for Advanced Study, University of Tokyo, Kashiwa 277-8583 (Japan)

    2012-10-02

    We study the diphoton signal of the Higgs boson in gauge mediated supersymmetry breaking models, which can explain both the Higgs boson mass of around 125 GeV and the result of the muon g-2 experiment. We consider two possible extensions of gauge mediation models: inclusion of vector-like matters, and a mixing between a messenger and the up-type Higgs. The large left-right mixing of staus is induced in both scenarios, resulting in the enhanced diphoton signal. We include a constraint from a charge breaking minimum, which is severe for the large left-right mixing of staus. The branching fraction of h{yields}{gamma}{gamma} can be about 20-30% larger than that of the Standard Model Higgs boson, in the region of parameter space where the Higgs boson mass of around 125 GeV and the muon g-2 are explained.

  3. Closing the Door for Dark Photons as the Explanation for the Muon g-2 Anomaly

    CERN Document Server

    Adare, A; Aidala, C; Ajitanand, N N; Akiba, Y; Akimoto, R; Al-Bataineh, H; Al-Ta'ani, H; Alexander, J; Alfred, M; Andrews, K R; Angerami, A; Aoki, K; Apadula, N; Aphecetche, L; Appelt, E; Aramaki, Y; Armendariz, R; Asai, J; Asano, H; Aschenauer, E C; Atomssa, E T; Averbeck, R; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Baksay, G; Baksay, L; Baldisseri, A; Bandara, N S; Bannier, B; Barish, K N; Barnes, P D; Bassalleck, B; Basye, A T; Bathe, S; Batsouli, S; Baublis, V; Baumann, C; Bazilevsky, A; Beaumier, M; Beckman, S; Belikov, S; Belmont, R; Ben-Benjamin, J; Bennett, R; Berdnikov, A; Berdnikov, Y; Bhom, J H; Bickley, A A; Black, D; Blau, D S; Boissevain, J G; Bok, J; Bok, J S; Borel, H; Boyle, K; Brooks, M L; Broxmeyer, D; Bryslawskyj, J; Buesching, H; Bumazhnov, V; Bunce, G; Butsyk, S; Camacho, C M; Campbell, S; Caringi, A; Castera, P; Chang, B S; Chang, W C; Charvet, J -L; Chen, C -H; Chernichenko, S; Chi, C Y; Chiu, M; Choi, I J; Choi, J B; Choudhury, R K; Christiansen, P; Chujo, T; Chung, P; Churyn, A; Chvala, O; Cianciolo, V; Citron, Z; Cole, B A; del Valle, Z Conesa; Connors, M; Constantin, P; Csanád, M; Csörgő, T; Dahms, T; Dairaku, S; Danchev, I; Das, K; Datta, A; Daugherity, M S; David, G; Dayananda, M K; DeBlasio, K; Dehmelt, K; Denisov, A; d'Enterria, D; Deshpande, A; Desmond, E J; Dharmawardane, K V; Dietzsch, O; Ding, L; Dion, A; Do, J H; Donadelli, M; Drapier, O; Drees, A; Drees, K A; Dubey, A K; Durham, J M; Durum, A; Dutta, D; Dzhordzhadze, V; D'Orazio, L; Edwards, S; Efremenko, Y V; Ellinghaus, F; Engelmore, T; Enokizono, A; En'yo, H; Esumi, S; Eyser, K O; Fadem, B; Feege, N; Fields, D E; Finger, M; Fleuret, F; Fokin, S L; Fraenkel, Z; Frantz, J E; Franz, A; Frawley, A D; Fujiwara, K; Fukao, Y; Fusayasu, T; Gal, C; Gallus, P; Garg, P; Garishvili, I; Ge, H; Giordano, F; Glenn, A; Gong, H; Gong, X; Gonin, M; Gosset, J; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Grim, G; Perdekamp, M Grosse; Gu, Y; Gunji, T; Guo, L; Guragain, H; Gustafsson, H -Å; Hachiya, T; Henni, A Hadj; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamblen, J; Han, R; Han, S Y; Hanks, J; Harper, C; Hartouni, E P; Haruna, K; Hasegawa, S; Hashimoto, K; Haslum, E; Hayano, R; He, X; Heffner, M; Hemmick, T K; Hester, T; Hill, J C; Hohlmann, M; Hollis, R S; Holzmann, W; Homma, K; Hong, B; Horaguchi, T; Hori, Y; Hornback, D; Hoshino, T; Huang, J; Huang, S; Ichihara, T; Ichimiya, R; Iinuma, H; Ikeda, Y; Imai, K; Imazu, Y; Imrek, J; Inaba, M; Iordanova, A; Isenhower, D; Ishihara, M; Isobe, T; Issah, M; Isupov, A; Ivanischev, D; Ivanishchev, D; Iwanaga, Y; Jacak, B V; Jeon, S J; Jezghani, M; Jia, J; Jiang, X; Jin, J; John, D; Johnson, B M; Jones, T; Joo, E; Joo, K S; Jouan, D; Jumper, D S; Kajihara, F; Kametani, S; Kamihara, N; Kamin, J; Kaneti, S; Kang, B H; Kang, J H; Kang, J S; Kapustinsky, J; Karatsu, K; Kasai, M; Kawall, D; Kawashima, M; Kazantsev, A V; Kempel, T; Key, J A; Khachatryan, V; Khanzadeev, A; Kihara, K; Kijima, K M; Kikuchi, J; Kim, A; Kim, B I; Kim, C; Kim, D H; Kim, D J; Kim, E; Kim, E -J; Kim, H -J; Kim, M; Kim, S H; Kim, Y -J; Kim, Y K; Kinney, E; Kiriluk, K; Kiss, Á; Kistenev, E; Klatsky, J; Klay, J; Klein-Boesing, C; Kleinjan, D; Kline, P; Koblesky, T; Kochenda, L; Kofarago, M; Komkov, B; Konno, M; Koster, J; Kotov, D; Kozlov, A; Král, A; Kravitz, A; Kunde, G J; Kurita, K; Kurosawa, M; Kweon, M J; Kwon, Y; Kyle, G S; Lacey, R; Lai, Y S; Lajoie, J G; Layton, D; Lebedev, A; Lee, D M; Lee, J; Lee, K B; Lee, K S; Lee, S H; Lee, S R; Lee, T; Leitch, M J; Leite, M A L; Leitgab, M; Lenzi, B; Li, X; Lichtenwalner, P; Liebing, P; Lim, S H; Levy, L A Linden; Liška, T; Litvinenko, A; Liu, H; Liu, M X; Love, B; Lynch, D; Maguire, C F; Makdisi, Y I; Makek, M; Malakhov, A; Malik, M D; Manion, A; Manko, V I; Mannel, E; Mao, Y; Mašek, L; Masui, H; Matathias, F; McCumber, M; McGaughey, P L; McGlinchey, D; McKinney, C; Means, N; Meles, A; Mendoza, M; Meredith, B; Miake, Y; Mibe, T; Mignerey, A C; Mikeš, P; Miki, K; Miller, A J; Milov, A; Mishra, D K; Mishra, M; Mitchell, J T; Miyachi, Y; Miyasaka, S; Mizuno, S; Mohanty, A K; Montuenga, P; Moon, H J; Moon, T; Morino, Y; Morreale, A; Morrison, D P; Motschwiller, S; Moukhanova, T V; Mukhopadhyay, D; Murakami, T; Murata, J; Mwai, A; Nagamiya, S; Nagle, J L; Naglis, M; Nagy, M I; Nakagawa, I; Nakagomi, H; Nakamiya, Y; Nakamura, K R; Nakamura, T; Nakano, K; Nam, S; Nattrass, C; Netrakanti, P K; Newby, J; Nguyen, M; Nihashi, M; Niida, T; Nouicer, R; Novitzky, N; Nyanin, A S; Oakley, C; O'Brien, E; Oda, S X; Ogilvie, C A; Oka, M; Okada, K; Onuki, Y; Koop, J D Orjuela; Oskarsson, A; Ouchida, M; Ozaki, H; Ozawa, K; Pak, R; Palounek, A P T; Pantuev, V; Papavassiliou, V; Park, B H; Park, I H; Park, J; Park, S; Park, S K; Park, W J; Pate, S F; Patel, L; Patel, M; Pei, H; Peng, J -C; Pereira, H; Perepelitsa, D V; Perera, G D N; Peresedov, V; Peressounko, D Yu; Perry, J; Petti, R; Pinkenburg, C

    2014-01-01

    The standard model (SM) of particle physics is spectacularly successful, yet the measured value of the muon anomalous magnetic moment (g-2)_\\mu deviates from SM calculations by 3.6 sigma. Several theoretical models attribute this to the existence of a "dark photon", an additional U(1) gauge boson, which is weakly coupled to ordinary photons. The PHENIX experiment at the Relativistic Heavy Ion Collider has searched for a dark photon, U, in \\pi^0,\\eta \\rightarrow \\gamma e^+e^- decays and obtained upper limits on U-\\gamma mixing at 90% CL for the mass range 30 < m_U < 90 MeV/c^2. Combined with other experimental limits, the remaining region in the U-\\gamma mixing parameter space that can explain the (g-2)_\\mu deviation from its SM value is nearly completely excluded at the 90% confidence level, with only a small region of 30 < m_U < 36 MeV/c^2 remaining.

  4. IgG2 immunodeficiency: association to pediatric patients with bacterial meningoencephalitis

    Directory of Open Access Journals (Sweden)

    ESCOBAR-PÉREZ XIOMARA

    2000-01-01

    Full Text Available An IgG subclass deficiency is often associated with bacterial infections. We studied four pediatric patients suffering from meningoencephalitis, two of them due to Streptococcus pneumoniae and two due to Haemophilus influenzae type b. Simultaneous diagnostic serum and cerebrospinal fluid samples were taken during income. The four subclasses of IgG and albumin were quantified in both biologic fluids by radial immunodiffusion. Very low levels of seric IgG2 with non detectable cerebrospinal fluid IgG2 were found in the patients. No intrathecal IgG subclass synthesis was found in two patients. One patient with S. pneumoniae had IgG3 intrathecal synthesis. Intrathecal IgG1, IgG3 and IgG4 synthesis was found in one patient suffering from H. influenzae according with reibergrams. Substitutive therapy with intravenous gammaglobulin was given to the patients as part of the treatment.

  5. Measuring the leading hadronic contribution to the muon g-2 via μ e scattering

    Science.gov (United States)

    Abbiendi, G.; Calame, C. M. Carloni; Marconi, U.; Matteuzzi, C.; Montagna, G.; Nicrosini, O.; Passera, M.; Piccinini, F.; Tenchini, R.; Trentadue, L.; Venanzoni, G.

    2017-03-01

    We propose a new experiment to measure the running of the electromagnetic coupling constant in the space-like region by scattering high-energy muons on atomic electrons of a low- Z target through the elastic process μ e → μ e. The differential cross section of this process, measured as a function of the squared momentum transfer t=q^2Area, a statistical uncertainty of ˜ 0.3% can be achieved on a^{HLO}_{μ } after two years of data taking. The direct measurement of a^{HLO}_{μ } via μ e scattering will provide an independent determination, competitive with the time-like dispersive approach, and consolidate the theoretical prediction for the muon g-2 in the Standard Model. It will allow therefore a firmer interpretation of the measurements of the future muon g-2 experiments at Fermilab and J-PARC.

  6. Biosynthesis of hematite nanoparticles and its cytotoxic effect on HepG2 cancer cells.

    Science.gov (United States)

    Rajendran, Kumar; Karunagaran, Vithiya; Mahanty, Biswanath; Sen, Shampa

    2015-03-01

    Iron oxide nanoparticles were gaining significant importance in a variety of applications due to its paramagnetic properties and biocompatibility. Various chemical methods were employed for hematite nanoparticle synthesis which require special equipment or a complex production process. In this study, protein capped crystalline hexagonal hematite (α-Fe2O3) nanoparticles were synthesized by green approach using culture supernatant of a newly isolated bacterium, Bacillus cereus SVK1 at ambient conditions. The synthesized nanoparticles were characterized by electron microscopy, X-ray diffraction, UV-visible spectroscopy and Fourier transform infrared spectroscopic analysis. Nanoparticles were evaluated for its possible anticancer activity against HepG2 liver cancer cells by MTT assay. Hematite nanoparticles with an average diameter of 30.2 nm, exhibited a significant cytotoxicity toward HepG2 cells in a concentration-dependent manner (CTC50=704 ng/ml). Copyright © 2014 Elsevier B.V. All rights reserved.

  7. The MAP, M/G1,G2/1 queue with preemptive priority

    Directory of Open Access Journals (Sweden)

    Bong Dae Choi

    1997-01-01

    Full Text Available We consider the MAP, M/G1,G2/1 queue with preemptive resume priority, where low priority customers arrive to the system according to a Markovian arrival process (MAP and high priority customers according to a Poisson process. The service time density function of low (respectively: high priority customers is g1(x (respectively: g2(x. We use the supplementary variable method with Extended Laplace Transforms to obtain the joint transform of the number of customers in each priority queue, as well as the remaining service time for the customer in service in the steady state. We also derive the probability generating function for the number of customers of low (respectively, high priority in the system just after the service completion epochs for customers of low (respectively, high priority.

  8. Optimization of the Target Subsystem for the New g-2 Experiment

    CERN Document Server

    Yoshikawa, C; Mokhov, N V; Morgan, J; Neuffer, D; Striganov, S

    2013-01-01

    A precision measurement of the muon anomalous magnetic moment, $a_{\\mu} = (g-2)/2$, was previously performed at BNL with a result of 2.2 - 2.7 standard deviations above the Standard Model (SM) theoretical calculations. The same experimental apparatus is being planned to run in the new Muon Campus at Fermilab, where the muon beam is expected to have less pion contamination and the extended dataset may provide a possible $7.5\\sigma$ deviation from the SM, creating a sensitive and complementary bench mark for proposed SM extensions. We report here on a preliminary study of the target subsystem where the apparatus is optimized for pions that have favorable phase space to create polarized daughter muons around the magic momentum of 3.094 GeV/c, which is needed by the downstream g 2 muon ring.

  9. Transition zone cells reach G2 phase before initiating elongation in maize root apex

    Directory of Open Access Journals (Sweden)

    M. Victoria Alarcón

    2017-06-01

    Full Text Available Root elongation requires cell divisions in the meristematic zone and cell elongation in the elongation zone. The boundary between dividing and elongating cells is called the transition zone. In the meristem zone, initial cells are continuously dividing, but on the basal side of the meristem cells exit the meristem through the transition zone and enter in the elongation zone, where they stop division and rapidly elongate. Throughout this journey cells are accompanied by changes in cell cycle progression. Flow cytometry analysis showed that meristematic cells are in cycle, but exit when they enter the elongation zone. In addition, the percentage of cells in G2 phase (4C strongly increased from the meristem to the elongation zone. However, we did not observe remarkable changes in the percentage of cells in cell cycle phases along the entire elongation zone. These results suggest that meristematic cells in maize root apex stop the cell cycle in G2 phase after leaving the meristem.

  10. Reconciling Muon g-2, 125 GeV Higgs and Dark Matter in Gauge Mediation Models

    CERN Document Server

    Gogoladze, Ilia; Un, Cem Salih

    2015-01-01

    We present a class of models in the framework of gauge mediation supersymmetry breaking where the standard model is supplemented by additional U(1) symmetry which acts only on the third generation fermions. The messenger fields carry non-trivial U(1) charge and are vector-like particles under this symmetry. This leads to additional contribution to the soft supersymmetry breaking mass terms for the third generation squarks and sleptons. In this framework we show that the muon g-2 anomaly, the observed 125 GeV Higgs boson mass and the detected relic dark matter abundance (gravitino in our case) can be simultaneously accommodated. The resolution of the muon g-2 anomaly, in particular, yields the result that the first two generation squark masses, as well the gluino mass, should be <~ 2.5 TeV, which will be tested at LHC14.

  11. Unique features of monoclonal IgG2b in the cleavage reaction with pepsin.

    Directory of Open Access Journals (Sweden)

    Sumii,Hiroshi

    1989-06-01

    Full Text Available Preparations of IgG2b purified from several mouse hybridoma clones were highly susceptible, compared to other subclasses, to peptic digestion under conditions usually used to prepare F (ab'2 fragments. Analyses of the digestion products revealed that no F (ab'2 was produced and that the main product was a Fab-like fragment. Demonstration of the hinge disulfides in the Fc portion clearly indicated that in IgG2b the primary peptic cleavage occurs on the NH2-terminal side of the inter-heavy chain disulfide bridge. The resulting Fab failed to bind with antigen, suggesting the importance of the CH1-hinge region in maintaining the native conformation of the antigen-binding site.

  12. Recognition of the group G2(5 by the prime graph

    Directory of Open Access Journals (Sweden)

    Parivash Nosratpour

    2014-05-01

    Full Text Available Let $G$ be a finite group‎. ‎The prime graph of $G$‎ ‎is a graph $\\Gamma(G$ with vertex set $\\pi(G$‎, ‎the set of all‎ ‎prime divisors of $|G|$‎, ‎and two distinct vertices $p$ and $q$ are‎ ‎adjacent by an edge if $G$ has an element of order $pq$‎. ‎In this‎ ‎paper we prove that if $\\Gamma(G=\\Gamma(G_2(5$‎, ‎then $G$ has a‎ ‎normal subgroup $N$ such that $\\pi(N\\subseteq\\{2,3,5\\}$ and‎ ‎$G/N\\cong G_2(5$‎.

  13. [Study on transient absorption spectrum of tungsten nanoparticle with HepG2 tumor cell].

    Science.gov (United States)

    Cao, Lin; Shu, Xiao-Ning; Liang, Dong; Wang, Cong

    2014-07-01

    Significance of this study lies in tungsten nano materials can be used as a preliminary innovative medicines applied basic research. This paper investigated the inhibition of tungsten nanoparticles which effected on human hepatoma HepG2 cells by MTT. The authors use transient absorption spectroscopy (TAS) technology absorption and emission spectra characterization of charge transfer between nanoparticles and tumor cell. The authors discussed the role of the tungsten nanoparticles in the tumor early detection of the disease and its anti-tumor properties. In the HepG2 experiments system, 100-150 microg x mL(-1) is the best drug concentration of anti-tumor activity which recact violently within 6 hours and basically completed in 24 hours. The results showed that transient absorption spectroscopy can be used as tumor detection methods and characterization of charge transfer between nano-biosensors and tumor cells. Tungsten nanoparticles have potential applications as anticancer drugs.

  14. Estradiol and Estrogen Receptor Agonists Oppose Oncogenic Actions of Leptin in HepG2 Cells.

    Directory of Open Access Journals (Sweden)

    Minqian Shen

    Full Text Available Obesity is a significant risk factor for certain cancers, including hepatocellular carcinoma (HCC. Leptin, a hormone secreted by white adipose tissue, precipitates HCC development. Epidemiology data show that men have a much higher incidence of HCC than women, suggesting that estrogens and its receptors may inhibit HCC development and progression. Whether estrogens antagonize oncogenic action of leptin is uncertain. To investigate potential inhibitory effects of estrogens on leptin-induced HCC development, HCC cell line HepG2 cells were treated with leptin in combination with 17 β-estradiol (E2, estrogen receptor-α (ER-α selective agonist PPT, ER-β selective agonist DPN, or G protein-coupled ER (GPER selective agonist G-1. Cell number, proliferation, and apoptosis were determined, and leptin- and estrogen-related intracellular signaling pathways were analyzed. HepG2 cells expressed a low level of ER-β mRNA, and leptin treatment increased ER-β expression. E2 suppressed leptin-induced HepG2 cell proliferation and promoted cell apoptosis in a dose-dependent manner. Additionally E2 reversed leptin-induced STAT3 and leptin-suppressed SOCS3, which was mainly achieved by activation of ER-β. E2 also enhanced ERK via activating ER-α and GPER and activated p38/MAPK via activating ER-β. To conclude, E2 and its receptors antagonize the oncogenic actions of leptin in HepG2 cells by inhibiting cell proliferation and stimulating cell apoptosis, which was associated with reversing leptin-induced changes in SOCS3/STAT3 and increasing p38/MAPK by activating ER-β, and increasing ERK by activating ER-α and GPER. Identifying roles of different estrogen receptors would provide comprehensive understanding of estrogenic mechanisms in HCC development and shed light on potential treatment for HCC patients.

  15. A new measurement of the leading hadronic corrections to the muon g-2

    Science.gov (United States)

    Trentadue, Luca

    2016-11-01

    A novel approach to determine the leading hadronic corrections to the muon g-2 is proposed. It consists in a measurement of the effective electromagnetic coupling in the space-like region. This method may become feasible at flavor factories resulting in a determination potentially competitive with the dispersive approach via time-like data. This talk is based on a work done in collaboration with C. Carloni Calame, M. Passera, and G. Venanzoni.

  16. Test of candidate light distributors for the muon (g$-$2) laser calibration system

    CERN Document Server

    Anastasi, A; Baffigi, F; Cantatore, G; Cauz, D; Corradi, G; Dabagov, S; Di Sciascio, G; Di Stefano, R; Ferrari, C; Fienberg, A T; Fioretti, A; Fulgentini, L; Gabbanini, C; Gizzi, L A; Hampai, D; Hertzog, D W; Iacovacci, M; Karuza, M; Kaspar, J; Koester, P; Labate, L; Mastroianni, S; Moricciani, D; Pauletta, G; Santi, L; Venanzoni, G

    2015-01-01

    The new muon (g-2) experiment E989 at Fermilab will be equipped with a laser calibration system for all the 1296 channels of the calorimeters. An integrating sphere and an alternative system based on an engineered diffuser have been considered as possible light distributors for the experiment. We present here a detailed comparison of the two based on temporal response, spatial uniformity, transmittance and time stability.

  17. Normal Subgroup Growth of Linear Groups: the (G2; F4;E8)-Theorem

    CERN Document Server

    Larsen, Michael

    2011-01-01

    Let G be a finitely generated group and M_n(G) the number of its normal subgroup subgroups of index at most n. For linear groups G we show that M_n(G) can grow polynomially in n only if the semisimple part of the Zariski closure of G has simple components only of type G2, F4 or E8 (and in this case indeed this can happened!)

  18. Induction of apoptosis in HepG2 cells by solanine and Bcl-2 protein.

    Science.gov (United States)

    Ji, Y B; Gao, S Y; Ji, C F; Zou, X

    2008-01-17

    The nightshade (Solanum nigrum Linn.) has been widely used in Chinese traditional medicine as a remedy for the treatment of digestive system cancer. The anti-tumor activity of solanine, a steroid alkaloid isolated from the nightshade has been demonstrated. To observe the effect of anti-tumor and mechanism of solanine. The MTT assay was used to evaluate the IC(50) on the three digestive system tumor cell lines. The effect on the morphology was observed with a laser confocal microscopy; the rate of apoptosis and the cell cycle were measured using flow cytometry (FCM); the expression of Bcl-2 protein was measured by Western blot. The results show that the IC(50) for HepG(2), SGC-7901, and LS-174 were 14.47, >50, and >50 microg/ml, respectively; the morphology of cells in the negative control was normal; for the treated groups, typical signs for apoptosis were found. The rate of apoptosis in HepG(2) cells induced by solanine was found to be 6.0, 14.4, 17.3, 18.9, and 32.2%, respectively. Observation of the cell cycle showed that cells in the G(2)/M phases disappeared while the number of cells in the S phase increased significantly for treated groups. Western blot showed that solanine decreased the expression of Bcl-2 protein. Therefore, the target of solanine in inducing apoptosis in HepG(2) cells seems to be mediated by the inhibition in the expression of Bcl-2 protein.

  19. Gene Transfection Mediated by Ultrasound and Pluronic P85 in HepG2 Cells

    Institute of Scientific and Technical Information of China (English)

    WANG Fen; LI Kaiyan; CHEN Yunchao; DENG Yuan; HONG Kai

    2007-01-01

    In order to assess whether gene transfection could be mediated by ultrasound in associa- tion with P85 and find the appropriate parameters of ultrasound irradiation, the effects of ultrasound with or without P85 on gene transfection of HepG2 cells were examined. The HepG2 cells were irra- diated by ultrasound at 1 MHz, 0.4-2.0 W/cm2 and 50% duty cycle with plasmid encoding enhanced green fluorescent protein (EGFP) as a report gene. Forty-eight h later, the expression of EGFP was detected under the fluorescence microscopy. Transfection efficacy was quantitatively assessed by flow cytometry, and cell viability was evaluated by trypan blue exclusion. The results showed that the transfection efficacy was increased with the increases in ultrasound output power and the ideal trans- fection efficacy was achieved in HepG2 cells irradiated by ultrasound at 0.8 W/cm2 for 30 s. The transfection efficacy in ulstrasound+P85 group was three times higher than in single ultrasound group [(17.63±1.07)% vs (5.57±0.56)%, P<0.051. The cell viability was about 81% and 62% in ultrasound group and ultrasound+P85 group respectively. It was concluded that ultrasound in combination with P85 could mediate the gene transfection of HepG2 cells, ideal transfection efficacy was achieved by ultrasound irradiation at 0.8 W/cm2 for 30 s, and P85 could somewhat increase the damage to cells caused by ultrasound.

  20. A new approach to evaluate the leading hadronic corrections to the muon g-2

    Directory of Open Access Journals (Sweden)

    C.M. Carloni Calame

    2015-06-01

    Full Text Available We propose a novel approach to determine the leading hadronic corrections to the muon g-2. It consists in a measurement of the effective electromagnetic coupling in the space-like region extracted from Bhabha scattering data. We argue that this new method may become feasible at flavor factories, resulting in an alternative determination potentially competitive with the accuracy of the present results obtained with the dispersive approach via time-like data.

  1. ZGDHu-1 induces G2/M phase arrest and apoptosis in Kasumi-1 cells

    Science.gov (United States)

    XIA, JUN; CHEN, SU-FENG; LV, YA-PING; LU, LING-NA; HU, WEI-XIAO; ZHOU, YONG-LIE

    2015-01-01

    The present study examined the effects of N,N′-di-(m-methylphenyi)-3, 6-dimethyl-1, 4-dihydro-1,2,4,5-tetrazine-1,4-dicarboamide (ZGDHu-1), a novel oxazine derivative, in Kasumi-1 cells. Following incubation with various concentrations of ZGDHu-1, fluorescence-activated cell sorting (FACS) was used in order to detect changes in mitochondrial membrane permeability in Kasumi-1 cells. Western blot analysis was performed in order to analyze the expression of nuclear factor-κB, inhibitor of κB and AML1/ETO. In addition FACS was used to analyze leukemia cell cycles and the expression levels of cyclin, cyclin-dependent kinases and cyclin-dependent kinase inhibitors in G2/M phase were determined using FACS and western blot analysis. The upregulation of reactive oxygen species production and mitochondrial membrane permeability was ascribed to apoptosis. The growth of Kasumi-1 cells was inhibited through the downregulation of nuclear factor-κB, degradation of AML1/ETO fusion protein and cell cycle arrest at the G2/M phase. This study documented that G2/M regulatory molecules, including cyclin B1, cell division control (cdc)2 and cdc25c were downregulated and checkpoint kinase 1 (CHK1), p53, p27, phospho-cdc25c, phospho-CHK1 and phospho-p53 were upregulated following treatment with ZGDHu-1. In the present study, pretreatment with CHIR-124, a selective CHK1 inhibitor, abrogated G2/M arrest via ZGDHu-1. These results demonstrated the anti-tumor activity of ZGDHu-1, which may therefore a potential target for further investigation and may be useful for the treatment of patients with t(8;21) acute myeloid leukemia. PMID:25573277

  2. Efficacy of HIV antiviral polyanionic carbosilane dendrimer G2-S16 in the presence of semen

    Directory of Open Access Journals (Sweden)

    Ceña-Diez R

    2016-05-01

    Full Text Available Rafael Ceña-Diez,1–4,* Pilar García-Broncano,1–5,* Francisco Javier de la Mata,4,6 Rafael Gómez,4,6 Mª Ángeles Muñoz-Fernández1–4 1Hospital General Universitario Gregorio Marañon, 2Instituto de Investigación Sanitaria Gregorio Marañon, 3Spanish HIV HGM Biobank, 4Networking Research Center on Bioengineering, Biomaterials and Nanomedicine (CIBER-BBN, 5Laboratory of Viral Infection and Immunity, National Center of Microbiology, Health Institute of Carlos III, Majadahonda, 6Department of Organic Chemistry and Inorganic Chemistry, University of Alcalá, Alcalá de Henares, Madrid, Spain *These authors contributed equally to this work Abstract: The development of a safe and effective microbicide to prevent the sexual transmission of human immunodeficiency virus (HIV-1 is urgently needed. Unfortunately, the majority of microbicides, such as poly(L-lysine-dendrimers, anionic polymers, or antiretrovirals, have proved inactive or even increased the risk of HIV infection in clinical trials, most probably due to the fact that these compounds failed to prevent semen-exposed HIV infection. We showed that G2-S16 dendrimer exerts anti-HIV-1 activity at an early stage of viral replication, blocking the gp120/CD4/CCR5 interaction and providing a barrier to infection for long periods, confirming its multifactorial and nonspecific ability. Previously, we demonstrated that topical administration of G2-S16 prevents HIV transmission in humanized BLT mice without irritation or vaginal lesions. Here, we demonstrated that G2-S16 is active against mock- and semen-exposed HIV-1 and could be a promising microbicide against HIV infection. Keywords: G2-S16, dendrimer, HIV-1, SEVI, microbicide, antiretrovirals

  3. ECCO Golf BIOM G2健步高尔夫2代系列

    Institute of Scientific and Technical Information of China (English)

    2016-01-01

    北欧丹麦鞋履及皮具品牌ECC0推出全新ECCO Golf BIOM G2健步高尔夫2代系列,分别为男士和女士精心打造.采用专利NATURAL MOTION自然律动技术,提供出色的缓震性与稳定性.

  4. Cacao polyphenols influence the regulation of apolipoprotein in HepG2 and Caco2 cells.

    Science.gov (United States)

    Yasuda, Akiko; Natsume, Midori; Osakabe, Naomi; Kawahata, Keiko; Koga, Jinichiro

    2011-02-23

    Cocoa powder is rich in polyphenols, such as catechins and procyanidins, and has been shown to inhibit low-density lipoprotein (LDL) oxidation and atherogenesis in a variety of models. Human studies have also shown daily intake of cocoa increases plasma high-density lipoprotein (HDL) and decreases LDL levels. However, the mechanisms responsible for these effects of cocoa on cholesterol metabolism have yet to be fully elucidated. The present study investigated the effects of cacao polyphenols on the production of apolipoproteins A1 and B in human hepatoma HepG2 and intestinal Caco2 cell lines. The cultured HepG2 cells or Caco2 cells were incubated for 24 h in the presence of cacao polyphenols such as (-)-epicatechin, (+)-catechin, procyanidin B2, procyanidin C1, and cinnamtannin A2. The concentration of apolipoproteins in the cell culture media was quantified using an enzyme-linked immunoassay, and the mRNA expression was quantified by RT-PCR. Cacao polyphenols increased apolipoprotein A1 protein levels and mRNA expression, even though apolipoprotein B protein and the mRNA expression were slightly decreased in both HepG2 cells and Caco2 cells. In addition, cacao polyphenols increased sterol regulatory element binding proteins (SREBPs) and activated LDL receptors in HepG2 cells. These results suggest that cacao polyphenols may increase the production of mature form SREBPs and LDL receptor activity, thereby increasing ApoA1 and decreasing ApoB levels. These results elucidate a novel mechanism by which HDL cholesterol levels become elevated with daily cocoa intake.

  5. The reach of a future Linear Collider after the g-2 result

    CERN Document Server

    Richard, F

    2001-01-01

    Combining the cosmological requirement on dark matter with the recent BNL g-2 measurement it is argued that, within the mSUGRA framework, the preferred region for SUSY mass parameters falls well inside the area covered by the future linear colliders under consideration for right handed sleptons and of the 2 lightest neutralinos. The coverage for the lightest chargino and left handed sleptons is also favoured but with smaller confidence.

  6. Rotavirus G2P[4] detection in fresh vegetables and oysters in Mexico City.

    Science.gov (United States)

    Quiroz-Santiago, Carolina; Vázquez-Salinas, Carlos; Natividad-Bonifacio, Ivan; Barrón-Romero, Blanca Lilia; Quiñones-Ramírez, Elsa Irma

    2014-11-01

    Rotaviruses are the principal cause of dehydration caused by diarrhea in children younger than 2 years of age. Although these viral infections have mainly been associated with ingestion of fecally contaminated food and water, few studies have addressed the presence of the virus in food that is consumed raw or slightly cooked. In this work, 30 oyster samples and 33 vegetable samples were examined for the presence of rotavirus genotypes to evaluate their potential to produce gastrointestinal infections. The rotaviruses were identified by reverse transcriptase PCR amplification of the VP7 gene. G and P genotyping was also performed by reverse transcriptase PCR, with a detection sensitivity of up to 15 PFU/ml. Rotaviruses were found in 17 (26.9%) of 63 samples (10 oysters and 7 vegetables). The G2 genotype was found in 11 (64.7%) of 17 of the rotavirus strains, and 16 (94.1%) of 17 had the P[4] genotype. The combined genotypes found most frequently were G2P[4] (10 [58.82%] of 17), GNTP[4] (6 [35.29%] of 17), and G2P[NT] (1 [5.8%] of 17).

  7. No asymmetric outflows from Sagittarius A* during the pericenter passage of the gas cloud G2

    CERN Document Server

    Park, J -H; Krichbaum, T P; Kim, J -Y; Kino, M; Bertarini, A; Bremer, M; de Vicente, P

    2015-01-01

    The gas cloud G2 falling toward Sagittarius A* (Sgr A*), the supermassive black hole at the center of the Milky Way, is supposed to provide valuable information on the physics of accretion flows and the environment of the black hole. We observed Sgr A* with four European stations of the Global Millimeter Very Long Baseline Interferometry Array (GMVA) at 86 GHz on 1 October 2013 when parts of G2 had already passed the pericenter. We searched for possible transient asymmetric structure -- such as jets or winds from hot accretion flows -- around Sgr A* caused by accretion of material from G2. The interferometric closure phases remained zero within errors during the observation time. We thus conclude that Sgr A* did not show significant asymmetric (in the observer frame) outflows in late 2013. Using simulations, we constrain the size of the outflows that we could have missed to ~2.5 mas along the major axis, ~0.4 mas along the minor axis of the beam, corresponding to approximately 232 and 35 Schwarzschild radii, ...

  8. NPM phosphorylation stimulates Cdk1, overrides G2/M checkpoint and increases leukemic blasts in mice.

    Science.gov (United States)

    Du, Wei; Zhou, Yun; Pike, Suzette; Pang, Qishen

    2010-02-01

    An elevated level of nucleophosmin (NPM) is often found in actively proliferative cells including human tumors. To identify the regulatory role for NPM phosphorylation in proliferation and cell cycle control, a series of mutants targeting the consensus cyclin-dependent kinase (CDK) phosphorylation sites was created to mimic or abrogate either single-site or multi-site phosphorylation. Simultaneous inactivation of two CDK phosphorylation sites at Ser10 and Ser70 (NPM-AA) induced G(2)/M cell cycle arrest, phosphorylation of Cdk1 at Tyr15 (Cdc2(Tyr15)) and increased cytoplasmic accumulation of Cdc25C. Strikingly, stress-induced Cdk1(Tyr15) and Cdc25C sequestration was suppressed by expression of a phosphomimetic NPM mutant created on the same CDK sites (S10E/S70E, NPM-EE). Further analysis revealed that phosphorylation of NPM at both Ser10 and Ser70 was required for proper interaction between Cdk1 and Cdc25C. Moreover, NPM-EE directly bound to Cdc25C and prevented phosphorylation of Cdc25C at Ser216 during mitosis. Finally, NPM-EE overrided stress-induced G(2)/M arrest and increased leukemia blasts in a NOD/SCID xenograft model. Thus, these findings reveal a novel function of NPM on regulation of cell cycle progression, in which phosphorylation of NPM controls cell cycle progression at G(2)/M transition through modulation of Cdk1 and Cdc25C activities.

  9. SUMO-1 Enhancing the p53-induced HepG2 Cell Apoptosis

    Institute of Scientific and Technical Information of China (English)

    LU Xingrong; YI Jilin

    2005-01-01

    Summary: In order to investigate the effect of small ubiquitin-like modifier-1 (SUMO-1) on the p53-induced HepG2 cell apoptosis, HepG2 cells were transfected by recombinant plasmids as pwtp53, pMDM2 and pSUMO-1 respectively. Western blot was employed to detect the protein expression of the transfected recombinant plasmids and the rate of apoptosis was measured by flow cytometry. The results showed that in cells transfected with pwtp53 and pwtp53+pSUMO-1, the apoptosis rate was (16.79±1.62) % and (18.15±1.36) % respectively, while transfected with pwtp53+pMDM2, the rate was decreased to (5.17±1.23) %. The apoptosis rate was (14.06±1.84) % in the cells transfected with pwtp53+pMDM2+pSUMO-1, significantly higher than that in the cells Transfected with pwtp53+pMDM2 (P<0.01). The apoptosis rates in the cells were all less than 2 % and had no significant difference among the groups. It was suggested that in the HepG2 cells, SUMO-1 can increase the apoptosis induced by wild-type p53 through binding to p53 protein, post-translational modification and inhibiting the p53 degradation by MDM2.

  10. Dynamic (G2) Model Design Document, 24590-WTP-MDD-PR-01-002, Rev. 12

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Yueying; Kruger, Albert A.

    2013-12-16

    The Hanford Tank Waste Treatment and Immobilization Plant (WTP) Statement of Work (Department of Energy Contract DE-AC27-01RV14136, Section C) requires the contractor to develop and use process models for flowsheet analyses and pre-operational planning assessments. The Dynamic (G2) Flowsheet is a discrete-time process model that enables the project to evaluate impacts to throughput from eventdriven activities such as pumping, sampling, storage, recycle, separation, and chemical reactions. The model is developed by the Process Engineering (PE) department, and is based on the Flowsheet Bases, Assumptions, and Requirements Document (24590-WTP-RPT-PT-02-005), commonly called the BARD. The terminologies of Dynamic (G2) Flowsheet and Dynamic (G2) Model are interchangeable in this document. The foundation of this model is a dynamic material balance governed by prescribed initial conditions, boundary conditions, and operating logic. The dynamic material balance is achieved by tracking the storage and material flows within the plant as time increments. The initial conditions include a feed vector that represents the waste compositions and delivery sequence of the Tank Farm batches, and volumes and concentrations of solutions in process equipment before startup. The boundary conditions are the physical limits of the flowsheet design, such as piping, volumes, flowrates, operation efficiencies, and physical and chemical environments that impact separations, phase equilibriums, and reaction extents. The operating logic represents the rules and strategies of running the plant.

  11. [Establishment of a model for evaluating hypolipidemic effect in HepG2 cells].

    Science.gov (United States)

    Niu, Yucun; Lü, Na; Li, Ying; Zhao, Dan; Sun, Changhao

    2010-03-01

    To establish a model of evaluating hypolipidemic effect in vitro. Adding cholesterol to the culture medium for HepG2 cells to induce a hypercholesterolemia model. The content of cellular cholesterol and the expression of protein regulating cholesterol metabolism in HepG2 cells were determined. The validation of the model was identified by lovastatin, a widely used cholesterol-lowering drug. Free fatty acid was added to the culture medium for HepG2 cells to induce a hypertriglyceridemia model. The content of cellular triglyceride and the absorption rate of free fatty acid were determined. The validation of the model was identified by fenofibrate, a triglyceride-lowering drug. Cellular cholesterol content was increased and the expression of HMG-CoA redutase, SREBP-2 and LDLR were decreased after adding cholesterol and 25-hydrocholesterol to the culture medium. Cellular cholesterol was decreased and the expression of SREBP-2 and LDLR were up-regulated by Lovastatin. The absorption of oleic acid in cells was up to 40% after adding oleic acid (50 micromol) to the culture medium for 6 h. The absorption of free fatty acid was increased but the content of cellular triglyceride was not increased in cells by Fenofibrate. This model might be an effective method for screening and assessing functional factors for lowing plasma lipids.

  12. The inhibition of polo kinase by matrimony maintains G2 arrest in the meiotic cell cycle.

    Directory of Open Access Journals (Sweden)

    Youbin Xiang

    2007-12-01

    Full Text Available Many meiotic systems in female animals include a lengthy arrest in G2 that separates the end of pachytene from nuclear envelope breakdown (NEB. However, the mechanisms by which a meiotic cell can arrest for long periods of time (decades in human females have remained a mystery. The Drosophila Matrimony (Mtrm protein is expressed from the end of pachytene until the completion of meiosis I. Loss-of-function mtrm mutants result in precocious NEB. Coimmunoprecipitation experiments reveal that Mtrm physically interacts with Polo kinase (Polo in vivo, and multidimensional protein identification technology mass spectrometry analysis reveals that Mtrm binds to Polo with an approximate stoichiometry of 1:1. Mutation of a Polo-Box Domain (PBD binding site in Mtrm ablates the function of Mtrm and the physical interaction of Mtrm with Polo. The meiotic defects observed in mtrm/+ heterozygotes are fully suppressed by reducing the dose of polo+, demonstrating that Mtrm acts as an inhibitor of Polo. Mtrm acts as a negative regulator of Polo during the later stages of G2 arrest. Indeed, both the repression of Polo expression until stage 11 and the inactivation of newly synthesized Polo by Mtrm until stage 13 play critical roles in maintaining and properly terminating G2 arrest. Our data suggest a model in which the eventual activation of Cdc25 by an excess of Polo at stage 13 triggers NEB and entry into prometaphase.

  13. High Precision Magnetic Field Scanning System for the New Muon g-2 Experiment

    Science.gov (United States)

    Hong, Ran; Muon g-2 collaboration Collaboration

    2017-01-01

    The New Muon g-2 Experiment (E989) at Fermilab will measure the anomalous magnetic moment of muon aμ aiming at a precision of 140 ppb. This new experiment will shed light on the long-standing 3.5 standard deviation between the previous muon g-2 measurement (E821) at Brookhaven National Laboratory and the Standard Model calculation, and potentially discover new physics. The New Muon g-2 Experiment measures the precession frequency of muon in a uniform magnetic field, and the magnetic field experienced by the muons needs to be measured with a precision better than 70 ppb. For the measurement of the magnetic field in the muon storage region, the former trolley system from E821 with 17 NMR probes was refurbished and upgraded with new electronics, probes and a modern motion control system. A test solenoid magnet was set up at Argonne National Laboratory for calibrating the NMR probes and the precision studies of systematic uncertainties. In this presentation, we will describe the trolley motion control scheme, the trolley position measurement methods, the electronic system for activating and reading the NMR probes and the test solenoid facility.

  14. Tea pigments induce cell-cycle arrest and apoptosis in HepG2 cells

    Institute of Scientific and Technical Information of China (English)

    Xu-Dong Jia; Chi Han; Jun-Shi Chen

    2005-01-01

    AIM: To investigate the molecular mechanisms by which tea pigments exert preventive effects on liver carcinogenesis.METHODS: HepG2 cells were seeded at a density of 5×105/well in six-well culture dishes and incubated overnight. The cells then were treated with various concentrations of tea pigments over 3 d, harvested by trypsinization, and counted using a hemocytometer. Flow cytometric analysis was performed by a flow cytometer after propidium iodide labeling. Bcl-2 and p21WAF1 proteins were determined by Western blotting. In addition, DNA laddering assay was performed on treated and untreated cultured HepG2 cells.RESULTS: Tea pigments inhibited the growth of HepG2 cells in a dose-dependent manner. Flow-cytometric analysis showed that tea pigments arrested cell cycle progression at G1 phase. DNA laddering was used to investigate apoptotic cell death, and the result showed that 100 mg/L of tea pigments caused typical DNA laddering. Our study also showed that tea pigments induced upregulation of p21WAF1 protein and downregulation of Bcl-2 protein.CONCLUSION: Tea pigments induce cell-cycle arrest and apoptosis. Tea pigments may be used as an ideal chemopreventive agent.

  15. Potentiation of resveratrol-induced apoptosis by matrine in human hepatoma HepG2 cells.

    Science.gov (United States)

    Ou, Xiuyuan; Chen, Yan; Cheng, Xinxin; Zhang, Xumeng; He, Qiyang

    2014-12-01

    Resveratrol, a natural polyphenolic phytochemical, has received considerable attention due to its potential chemopreventive and chemotherapeutic properties. In the present study, we first evaluated the growth-inhibitory effect of resveratrol on HepG2 cells and explored the underlying molecular mechanisms. Resveratrol inhibited proliferation and induced apoptosis in HepG2 cells via activation of caspase-9 and caspase-3, upregulation of the Bax/Bcl-2 ratio and induction of p53 expression. Cell cycle analysis demonstrated that resveratrol arrested cell cycle progression in the G1 and S phase. We further focused on the combination of matrine, a natural component extracted from the traditional Chinese medical herb Sophora flavescens Ait., as a mechanism to potentiate the growth-inhibitory effect of resveratrol on HepG2 cells. Both MTT and colony formation assay results indicated that the combined treatment of resveratrol and matrine exhibited a synergistic antiproliferative effect. In addition, resveratrol-induced apoptosis was significantly enhanced by matrine, which could be attributed to activation of caspase-3 and caspase-9, downregulation of survivin, induction of reactive oxygen species (ROS) generation and disruption of mitochondria membrane potential (Δψm). Our findings suggest that the combination treatment of resveratrol and matrine is a promising novel anticancer strategy for liver cancer; it also provides new insights into the mechanisms of combined therapy.

  16. Efficacy of HIV antiviral polyanionic carbosilane dendrimer G2-S16 in the presence of semen

    Science.gov (United States)

    Ceña-Diez, Rafael; García-Broncano, Pilar; de la Mata, Francisco Javier; Gómez, Rafael; Muñoz-Fernández, Mª Ángeles

    2016-01-01

    The development of a safe and effective microbicide to prevent the sexual transmission of human immunodeficiency virus (HIV)-1 is urgently needed. Unfortunately, the majority of microbicides, such as poly(L-lysine)-dendrimers, anionic polymers, or antiretrovirals, have proved inactive or even increased the risk of HIV infection in clinical trials, most probably due to the fact that these compounds failed to prevent semen-exposed HIV infection. We showed that G2-S16 dendrimer exerts anti-HIV-1 activity at an early stage of viral replication, blocking the gp120/CD4/CCR5 interaction and providing a barrier to infection for long periods, confirming its multifactorial and nonspecific ability. Previously, we demonstrated that topical administration of G2-S16 prevents HIV transmission in humanized BLT mice without irritation or vaginal lesions. Here, we demonstrated that G2-S16 is active against mock- and semen-exposed HIV-1 and could be a promising microbicide against HIV infection. PMID:27313457

  17. Protection of human HepG2 cells against oxidative stress by cocoa phenolic extract.

    Science.gov (United States)

    Martín, María Angeles; Ramos, Sonia; Mateos, Raquel; Granado Serrano, Ana Belén; Izquierdo-Pulido, María; Bravo, Laura; Goya, Luis

    2008-09-10

    Cocoa is a rich source of flavanols and procyanidin oligomers with antioxidative properties, providing protection against oxidation and nitration. The present study investigated the potential protective effect of a polyphenolic extract from cocoa on cell viability and antioxidant defenses of cultured human HepG2 cells submitted to oxidative stress induced by tert-butylhydroperoxide (t-BOOH). Pretreatment of cells with 0.05-50 microg/mL of cocoa polyphenolic extract (CPE) for 2 or 20 h completely prevented cell damage and enhanced activity of antioxidant enzymes induced by a treatment with t-BOOH. Moreover, lower levels of GSH caused by t-BOOH in HepG2 cells were partly recovered by a pretreatment with CPE. Increased reactive oxygen species (ROS) induced by t-BOOH was dose-dependently prevented when cells were pretreated for 2 or 20 h with CPE. These results show that treatment of HepG2 in culture with CPE (within the physiological range of concentrations) confers a significant protection against oxidation to the cells.

  18. Time-course regulation of survival pathways by epicatechin on HepG2 cells.

    Science.gov (United States)

    Granado-Serrano, Ana Belén; Angeles Martín, María; Goya, Luis; Bravo, Laura; Ramos, Sonia

    2009-02-01

    Polyphenols, such as epicatechin, have been reported to exhibit a wide range of biological activities. The objective of the present study was to investigate the time-dependent regulation by epicatechin of survival/proliferation pathways in HepG2 cells. Treatment of HepG2 cells with 10 micromol/L epicatechin did not result in any cell damage up to 18 h, as evaluated by the lactate dehydrogenase assay. Moreover, the enhanced cell death evoked by an oxidative stress induced with tert-butyl hydroperoxide was prevented in the cells pretreated 4 or 18 h with epicatechin. Epicatechin-induced survival was a rapid event that was accompanied by early and sustained activation of major survival signaling proteins, such as AKT/phosphatidylinositol 3-kinase and extracellular-regulated kinase (activated from 5 min to 18 h), as well as protein kinase C (PKC)-alpha (30 min to 18 h), in concert with unaltered c-jun N-amino terminal kinase levels and early inactivation of key death-related signals like PKC-delta (5 min to 18 h). Additionally, reactive oxygen species generation was transiently reduced when cells were treated with 10 micromol/L epicatechin (15-240 min). These data suggest that epicatechin induces cellular survival through a tight regulation of survival/proliferation pathways that requires the integration of different signals and persists over time, the ultimate effect on HepG2 cells being regulated by the balance among these signals.

  19. Muon’s (g-2): the obstinate deviation from the Standard Model

    CERN Multimedia

    Antonella Del Rosso

    2011-01-01

    It’s been 50 years since a small group at CERN measured the muon (g-2) for the first time. Several other experiments have followed over the years. The latest measurement at Brookhaven (2004) gave a value that obstinately remains about 3 standard deviations away from the prediction of the Standard Model. Francis Farley, one of the fathers of the (g-2) experiments, argues that a statement such as “everything we observe is accounted for by the Standard Model” is not acceptable.   Francis J. M. Farley. Francis J. M. Farley, Fellow of the Royal Society since 1972 and the 1980 winner of the Hughes Medal "for his ultra-precise measurements of the muon magnetic moment, a severe test of quantum electrodynamics and of the nature of the muon", is among the scientists who still look at the (g-2) anomaly as one of the first proofs of the existence of new physics. “Although it seems to be generally believed that all experiments agree with the Stan...

  20. Retinopathy of prematurity outcome in infants with Prethreshold Retinopathy of Prematurity and oxygen saturation > 94% in room air : The High Oxygen Percentage in Retinopathy of Prematurity study

    NARCIS (Netherlands)

    McGregor, ML; Bremer, DL; Cole, C; McClead, RE; Phelps, DL; Fellows, RR; Oden, N

    2002-01-01

    Objectives. To determine the rate of progression from prethreshold to threshold retinopathy of prematurity (ROP) in infants excluded from Supplemental Therapeutic Oxygen for Prethreshold Retinopathy of Prematurity (STOP-ROP) because their median arterial oxygen saturation by pulse oximetry (Spo(2))

  1. Molecular Effects on Evaporation and Condensation

    OpenAIRE

    Meland, Roar

    2002-01-01

    In this thesis the evaporation from and condensation on a plane liquid surface have been studied by analysis and molecular dynamics simulations. The effect of the condensation coefficient on the inverted temperature gradient for a two-surface evaporation-condensation geometry is investigated by the moment method. The influence of the molecular exchange phenomenon on the gas-kinetic treatment of evaporation and condensation is shown to be neglible under certain assumptions. Methods to simulate...

  2. Premature menopause linked to CVD and osteoporosis.

    Science.gov (United States)

    Park, Claire; Overton, Caroline

    2010-03-01

    Premature menopause affects 1% of women under the age of 40, the usual age of the menopause is 51. Most women will present with irregular periods or no periods at all with or without climacteric symptoms. Around 10% of women present with primary amenorrhoea. A careful history and examination are required. It is important to ask specifically about previous chemotherapy or radiotherapy and to look for signs of androgen excess e.g. polycystic ovarian syndrome, adrenal problems e.g. galactorrhoea and thyroid goitres. Once pregnancy has been excluded, a progestagen challenge test can be performed in primary care. Norethisterone 5 mg tds po for ten days or alternatively medroxyprogesterone acetate 10 mg daily for ten days is prescribed. A withdrawal bleed within a few days of stopping the norethisterone indicates the presence of oestrogen and bleeding more than a few drops is considered a positive withdrawal bleed. The absence of a bleed indicates low levels of oestrogen, putting the woman at risk of CVD and osteoporosis. FSH levels above 30 IU/l are an indicator that the ovaries are failing and the menopause is approaching or has occurred. It should be remembered that FSH levels fluctuate during the month and from one month to the next, so a minimum of two measurements should be made at least four to six weeks apart. The presence of a bleed should not exclude premature menopause as part of the differential diagnosis as there can be varying and unpredictable ovarian function remaining. The progestagen challenge test should not be used alone, but in conjunction with FSH, LH and oestradiol. There is no treatment for premature menopause. Women desiring pregnancy should be referred to a fertility clinic and discussion of egg donation. Women not wishing to become pregnant should be prescribed HRT until the age of 50 to control symptoms of oestrogen deficiency and reduce the risks of osteoporosis and CVD.

  3. The pathophysiology of lifelong premature ejaculation.

    Science.gov (United States)

    Waldinger, Marcel D

    2016-08-01

    For many decades it has been thought that lifelong premature ejaculation (PE) is only characterized by persistent early ejaculations. Despite enormous progress of in vivo animal research, and neurobiological, genetic and pharmacological research in men with lifelong PE, our current understanding of the mechanisms behind early ejaculations is far from complete. The new classification of PE into four PE subtypes has shown that the symptomatology of lifelong PE strongly differs from acquired PE, subjective PE and variable PE. The phenotype of lifelong PE and therefore also the pathophysiology of lifelong PE is much more complex. A substantial number of men with lifelong PE not only have PE, but also premature erection and premature penile detumescence as part of an acute hypertonic or hypererotic state when engaged in an erotic situation or when making love. As both erectio praecox, ejaculatio praecox, detumescentia praecox, and the hypererotic state are part of the phenotype lifelong PE, it is argued that lifelong PE is not only a disturbance of the timing of ejaculation but also a disturbance of the timing of erection, detumescence and arousal. Since 1998, the pathophysiology of lifelong PE was thought to be mainly mediated by the central serotonergic system in line with genetic polymorphisms of specific serotonergic genes. However, by accepting that lifelong PE is characterized by the reversible hypertonic state the hypothesis of mainly serotonergic dysfunction is no longer tenable. Instead, it has been postulated that the pathophysiology of lifelong PE is mediated by a very complex interplay of central and peripheral serotonergic, dopaminergic, oxytocinergic, endocrinological, genetic and probably also epigenetic factors. Progress in research of lifelong PE can only be accomplished when a stopwatch is used to measure the IELT and the cut-off point of 1 minute for the definition of lifelong PE is maintained. Current use of validated questionnaires, neglect of

  4. The pathophysiology of lifelong premature ejaculation

    Science.gov (United States)

    2016-01-01

    For many decades it has been thought that lifelong premature ejaculation (PE) is only characterized by persistent early ejaculations. Despite enormous progress of in vivo animal research, and neurobiological, genetic and pharmacological research in men with lifelong PE, our current understanding of the mechanisms behind early ejaculations is far from complete. The new classification of PE into four PE subtypes has shown that the symptomatology of lifelong PE strongly differs from acquired PE, subjective PE and variable PE. The phenotype of lifelong PE and therefore also the pathophysiology of lifelong PE is much more complex. A substantial number of men with lifelong PE not only have PE, but also premature erection and premature penile detumescence as part of an acute hypertonic or hypererotic state when engaged in an erotic situation or when making love. As both erectio praecox, ejaculatio praecox, detumescentia praecox, and the hypererotic state are part of the phenotype lifelong PE, it is argued that lifelong PE is not only a disturbance of the timing of ejaculation but also a disturbance of the timing of erection, detumescence and arousal. Since 1998, the pathophysiology of lifelong PE was thought to be mainly mediated by the central serotonergic system in line with genetic polymorphisms of specific serotonergic genes. However, by accepting that lifelong PE is characterized by the reversible hypertonic state the hypothesis of mainly serotonergic dysfunction is no longer tenable. Instead, it has been postulated that the pathophysiology of lifelong PE is mediated by a very complex interplay of central and peripheral serotonergic, dopaminergic, oxytocinergic, endocrinological, genetic and probably also epigenetic factors. Progress in research of lifelong PE can only be accomplished when a stopwatch is used to measure the IELT and the cut-off point of 1 minute for the definition of lifelong PE is maintained. Current use of validated questionnaires, neglect of

  5. Polymer induced condensation of dna supercoils

    NARCIS (Netherlands)

    Bessa Ramos Jr., J.E.; Ruggiero Neto, J.; Vries, de R.J.

    2008-01-01

    Macromolecular crowding is thought to be a significant factor driving DNA condensation in prokaryotic cells. Whereas DNA in prokaryotes is supercoiled, studies on crowding-induced DNA condensation have so far focused on linear DNA. Here we compare DNA condensation by poly(ethylene oxide) for superco

  6. The drug treatment of premature ejaculation.

    Science.gov (United States)

    Hisasue, Shin-Ichi

    2016-08-01

    The management recommendation for both acquired premature ejaculation (APE) and lifelong PE (LPE) are similar, such as a behavioral/psychotherapy, a pharmacotherapy and a combination of these treatments. For the drug treatment for PE, gold standard is selective serotonin reuptake inhibitors (SSRIs) including dapoxetine or paroxetine. The drug treatment for PE is still developing and some new promising therapeutic options have been proposed. Topical anesthetics, tramadol, and alpha-1 blockers will be the next strategies of the drug treatment for PE in the future.

  7. Premature ejaculation: current and future treatments

    Institute of Scientific and Technical Information of China (English)

    Levent Gurkan; Matthew Oommen; Wayne J. G. Hellstrom

    2008-01-01

    Premature ejaculation (PE) is recognized to be the most common male sexual disorder. PE provides difficulties for professionals who treat this condition because there is neither a universally accepted definition nor a medication approved by the Food and Drug Administration (FDA). Despite these shortcomings, physicians continue to diagnose their patients with PE according to major guidelines and treat them with either behavioral therapies or off-label medications. This review focuses on current and emerging treatment options and medications for PE. Advantages and limitations of each treatment option are discussed in the light of current published peer-reviewed literature.

  8. Condensed matter analogues of cosmology

    Science.gov (United States)

    Kibble, Tom; Srivastava, Ajit

    2013-10-01

    It is always exciting when developments in one branch of physics turn out to have relevance in a quite different branch. It would be hard to find two branches farther apart in terms of energy scales than early-universe cosmology and low-temperature condensed matter physics. Nevertheless ideas about the formation of topological defects during rapid phase transitions that originated in the context of the very early universe have proved remarkably fruitful when applied to a variety of condensed matter systems. The mathematical frameworks for describing these systems can be very similar. This interconnection has led to a deeper understanding of the phenomena in condensed matter systems utilizing ideas from cosmology. At the same time, one can view these condensed matter analogues as providing, at least in a limited sense, experimental access to the phenomena of the early universe for which no direct probe is possible. As this special issue well illustrates, this remains a dynamic and exciting field. The basic idea is that when a system goes through a rapid symmetry-breaking phase transition from a symmetric phase into one with spontaneously broken symmetry, the order parameter may make different choices in different regions, creating domains that when they meet can trap defects. The scale of those domains, and hence the density of defects, is constrained by the rate at which the system goes through the transition and the speed with which order parameter information propagates. This is what has come to be known as the Kibble-Zurek mechanism. The resultant scaling laws have now been tested in a considerable variety of different systems. The earliest experiments illustrating the analogy between cosmology and condensed matter were in liquid crystals, in particular on the isotropic-to-nematic transition, primarily because it is very easy to induce the phase transition (typically at room temperature) and to image precisely what is going on. This field remains one of the

  9. [Application of massage therapy in premature infant nursing care].

    Science.gov (United States)

    Chang, Shu-Min; Sung, Huei-Chuan

    2007-02-01

    Massage therapy has been used in the care of premature infants for many years in western countries, and a significant body of research has already shown the effectiveness of massage therapy in significantly increasing body weight, decreasing infant hospital durations, enhancing bone formation, and improving behavior. Key considerations when applying massage therapy on premature infants include gestational age, bodyweight, and physical condition. Nurses can teach parents to administer massage therapy on their premature infants to enhance parent-child attachment and interaction. This article introduces massage therapy principles and methods, the effectiveness of massage therapy in premature infant care, and an approach to teaching parents how to apply massage therapy on their premature infants. Massage therapy can be included in premature infant care programs in the future.

  10. [Developmental change in facial recognition by premature infants during infancy].

    Science.gov (United States)

    Konishi, Yukihiko; Kusaka, Takashi; Nishida, Tomoko; Isobe, Kenichi; Itoh, Susumu

    2014-09-01

    Premature infants are thought to be at increased risk for developmental disorders. We evaluated facial recognition by premature infants during early infancy, as this ability has been reported to be impaired commonly in developmentally disabled children. In premature infants and full-term infants at the age of 4 months (4 corrected months for premature infants), visual behaviors while performing facial recognition tasks were determined and analyzed using an eye-tracking system (Tobii T60 manufactured by Tobii Technologics, Sweden). Both types of infants had a preference towards normal facial expressions; however, no preference towards the upper face was observed in premature infants. Our study suggests that facial recognition ability in premature infants may develop differently from that in full-term infants.

  11. Fundamentals of condensed matter physics

    CERN Document Server

    Cohen, Marvin L

    2016-01-01

    Based on an established course and covering the fundamentals, central areas, and contemporary topics of this diverse field, Fundamentals of Condensed Matter Physics is a much-needed textbook for graduate students. The book begins with an introduction to the modern conceptual models of a solid from the points of view of interacting atoms and elementary excitations. It then provides students with a thorough grounding in electronic structure as a starting point to understand many properties of condensed matter systems - electronic, structural, vibrational, thermal, optical, transport, magnetic and superconductivity - and methods to calculate them. Taking readers through the concepts and techniques, the text gives both theoretically and experimentally inclined students the knowledge needed for research and teaching careers in this field. It features 200 illustrations, 40 worked examples and 150 homework problems for students to test their understanding. Solutions to the problems for instructors are available at w...

  12. Polymer Bose–Einstein condensates

    Energy Technology Data Exchange (ETDEWEB)

    Castellanos, E., E-mail: ecastellanos@fis.cinvestav.mx [Departamento de Física, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional, A.P. 14-740, México D.F. 07000 (Mexico); Chacón-Acosta, G., E-mail: gchacon@correo.cua.uam.mx [Departamento de Matemáticas Aplicadas y Sistemas, Universidad Autónoma Metropolitana-Cuajimalpa, Artificios 40, México D.F. 01120 (Mexico)

    2013-05-13

    In this work we analyze a non-interacting one-dimensional polymer Bose–Einstein condensate in a harmonic trap within the semiclassical approximation. We use an effective Hamiltonian coming from the polymer quantization that arises in loop quantum gravity. We calculate the number of particles in order to obtain the critical temperature. The Bose–Einstein functions are replaced by series, whose high order terms are related to powers of the polymer length. It is shown that the condensation temperature presents a shift respect to the standard case, for small values of the polymer scale. In typical experimental conditions, it is possible to establish a bound for λ{sup 2} up to ≲10{sup −16} m{sup 2}. To improve this bound we should decrease the frequency of the trap and also decrease the number of particles.

  13. Atomistic modeling of dropwise condensation

    Science.gov (United States)

    Sikarwar, B. S.; Singh, P. L.; Muralidhar, K.; Khandekar, S.

    2016-05-01

    The basic aim of the atomistic modeling of condensation of water is to determine the size of the stable cluster and connect phenomena occurring at atomic scale to the macroscale. In this paper, a population balance model is described in terms of the rate equations to obtain the number density distribution of the resulting clusters. The residence time is taken to be large enough so that sufficient time is available for all the adatoms existing in vapor-phase to loose their latent heat and get condensed. The simulation assumes clusters of a given size to be formed from clusters of smaller sizes, but not by the disintegration of the larger clusters. The largest stable cluster size in the number density distribution is taken to be representative of the minimum drop radius formed in a dropwise condensation process. A numerical confirmation of this result against predictions based on a thermodynamic model has been obtained. Results show that the number density distribution is sensitive to the surface diffusion coefficient and the rate of vapor flux impinging on the substrate. The minimum drop radius increases with the diffusion coefficient and the impinging vapor flux; however, the dependence is weak. The minimum drop radius predicted from thermodynamic considerations matches the prediction of the cluster model, though the former does not take into account the effect of the surface properties on the nucleation phenomena. For a chemically passive surface, the diffusion coefficient and the residence time are dependent on the surface texture via the coefficient of friction. Thus, physical texturing provides a means of changing, within limits, the minimum drop radius. The study reveals that surface texturing at the scale of the minimum drop radius does not provide controllability of the macro-scale dropwise condensation at large timescales when a dynamic steady-state is reached.

  14. Advances in condensed matter optics

    CERN Document Server

    Chen, Liangyao; Jiang, Xunya; Jin, Kuijuan; Liu, Hui; Zhao, Haibin

    2015-01-01

    This book describes some of the more recent progresses and developmentsin the study of condensed matter optics in both theoretic and experimental fields.It will help readers, especially graduate students and scientists who are studying and working in the nano-photonic field, to understand more deeply the characteristics of light waves propagated in nano-structure-based materials with potential applications in the future.

  15. Radiative corrections to Bose condensation

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, A. (Academia de Ciencias de Cuba, La Habana. Inst. de Matematica, Cibernetica y Computacion)

    1985-04-01

    The Bose condensation of the scalar field in a theory behaving in the Coleman-Weinberg mode is considered. The effective potential of the model is computed within the semiclassical approximation in a dimensional regularization scheme. Radiative corrections are shown to introduce certain ..mu..-dependent ultraviolet divergences in the effective potential coming from the Many-Particle theory. The weight of radiative corrections in the dynamics of the system is strongly modified by the charge density.

  16. The Effects of Fetal Surgery on Retinopathy of Prematurity Development

    Directory of Open Access Journals (Sweden)

    Sudha Nallasamy

    2009-10-01

    Full Text Available Background: Fetal surgery is selectively offered for severe or life-threatening fetal malformations. These infants are often born prematurely and are thus at risk for retinopathy of prematurity (ROP. It is not known whether fetal surgery confers an increased risk of developing severe ROP relative to published rates in standard premature populations ≤37 weeks of age grouped by birth weight (

  17. Theory of laminar film condensation

    CERN Document Server

    Fujii, Tetsu

    1991-01-01

    Since the petroleum crisis in the 1970s, a lot of effort to save energy was made in industry, and remarkable achievements have been made. In the research and development concerning thermal energy, however, it was clar­ ified that one of the most important problems was manufacturing con­ densing systems with smaller size and higher performance. To solve this problem we need a method which synthesizes selections_ of the type of con­ denser, cooling tube and its arrangement, assessment of fouling on the cooling surfaces, consideration of transient characteristics of a condenser, etc. The majority of effort, however, has been to devise a surface element which enhances the heat transfer coefficient in condensation of a single or multicomponent vapor. Condensation phenomena are complexly affected by a lot of physical property values, and accordingly the results of theo­ retical research are expressed with several dimensionless parameters. On the other hand, the experimental research is limited to those with som...

  18. Condensation on Slippery Asymmetric Bumps

    Science.gov (United States)

    Park, Kyoo-Chul; Kim, Philseok; Aizenberg, Joanna

    2016-11-01

    Controlling dropwise condensation by designing surfaces that enable droplets to grow rapidly and be shed as quickly as possible is fundamental to water harvesting systems, thermal power generation, distillation towers, etc. However, cutting-edge approaches based on micro/nanoscale textures suffer from intrinsic trade-offs that make it difficult to optimize both growth and transport at once. Here we present a conceptually different design approach based on principles derived from Namib desert beetles, cacti, and pitcher plants that synergistically couples both aspects of condensation and outperforms other synthetic surfaces. Inspired by an unconventional interpretation of the role of the beetle's bump geometry in promoting condensation, we show how to maximize vapor diffusion flux at the apex of convex millimetric bumps by optimizing curvature and shape. Integrating this apex geometry with a widening slope analogous to cactus spines couples rapid drop growth with fast directional transport, by creating a free energy profile that drives the drop down the slope. This coupling is further enhanced by a slippery, pitcher plant-inspired coating that facilitates feedback between coalescence-driven growth and capillary-driven motion. We further observe an unprecedented six-fold higher exponent in growth rate and much faster shedding time compared to other surfaces. We envision that our fundamental understanding and rational design strategy can be applied to a wide range of phase change applications.

  19. Apoptosis induced by nucleosides in the human hepatoma HepG2

    Institute of Scientific and Technical Information of China (English)

    Suh-Ching Yang; Che-Lin Chiu; Chi-Chang Huang; Jiun-Rong Chen

    2005-01-01

    AIM: To investigate the apoptotic effects of nucleosides on the human hepatoma HepG2.METHODS: The nucleosides included inosine (I), cytidine(C), uridine (U), thymidine (T), adenosine (A), and guanosine (G). Cells were incubated by the mediums with or without nucleosides at 37 ℃ in a 50 mL/L CO2 humidified atmosphere.RESULTS: It was found that the cell viabilities were significantly decreased, when cells were treated with 30 mmol/L I, 30 mmol/L C, 30 mmol/L U, 30 mmol/L T,0.5 mmol/L A, and 0.5 mmol/L G after 12 h incubation (P<0.05). About the apoptotic phenomenon, the cell percentages of sub-G1 cells were significantly increased in the mediums containing nucleosides such as C, U, T,A, and G (P<0.05). Furthermore, the caspase-3 activity was increased, when the cells were incubated with T(P<0.05). The protein expressions of p53 and p21 showed no difference in each group. To investigate the mechanism of apoptosis induced by nucleosides, it was found that the contents of soluble Fas ligand contents were increased in HepG2 cells following I, U, T, and A treatment (P<0.05).But, TNF-α and cytochrome c were undetectable.CONCLUSION: Thymidine may induce the apoptosis in HepG2, but the effective dosages and reactive time must be investigated in the future study. However, the apoptosis-inducing abilities of other nucleosides were still unclear in this study.

  20. Lipid synthesis and secretion in HepG2 cells is not affected by ACTH

    Directory of Open Access Journals (Sweden)

    Nilsson-Ehle Peter

    2010-05-01

    Full Text Available Abstract Apolipoprotein B (apoB containing lipoproteins, i.e. VLDL, LDL and Lp(a, are consequently lowered by ACTH treatment in humans. This is also seen as reduced plasma apoB by 20-30% and total cholesterol by 30-40%, mostly accounted for by a decrease in LDL-cholesterol. Studies in hepatic cell line (HepG2 cells showed that apoB mRNA expression is reduced in response to ACTH incubation and is followed by a reduced apoB secretion, which may hypothesize that ACTH lowering apoB containing lipoproteins in humans may be mediated by the inhibition of hepatic apoB synthesis. This was recently confirmed in vivo in a human postprandial study, where ACTH reduced transient apoB48 elevation from the small intestine, however, the exogenic lipid turnover seemed unimpaired. In the present study we investigated if lipid synthesis and/or secretion in HepG2 cells were also affected by pharmacological levels of ACTH to accompany the reduced apoB output. HepG2 cells were incubated with radiolabelled precursors ([14C]acetate and [3H]glycerol either before or during ACTH stimuli. Cellular and secreted lipids were extracted with chloroform:methanol and separated by the thin layer chromatography (TLC, and [14C]labelled cholesterol and cholesteryl ester and [3H]labelled triglycerides and phospholipids were quantitated by the liquid scintillation counting. It demonstrated that ACTH administration did not result in any significant change in neither synthesis nor secretion of the studied lipids, this regardless of presence or absence of oleic acid, which is known to stabilize apoB and enhance apoB production. The present study suggests that ACTH lowers plasma lipids in humans mainly mediated by the inhibition of apoB synthesis and did not via the reduced lipid synthesis.

  1. Mechanism for G2 phase-specific nuclear export of the kinetochore protein CENP-F.

    Science.gov (United States)

    Loftus, Kyle M; Cui, Heying; Coutavas, Elias; King, David S; Ceravolo, Amanda; Pereiras, Dylan; Solmaz, Sozanne R

    2017-08-03

    Centromere protein F (CENP-F) is a component of the kinetochore and a regulator of cell cycle progression. CENP-F recruits the dynein transport machinery and orchestrates several cell cycle-specific transport events, including transport of the nucleus, mitochondria and chromosomes. A key regulatory step for several of these functions is likely the G2 phase-specific export of CENP-F from the nucleus to the cytosol, where the cytoplasmic dynein transport machinery resides; however, the molecular mechanism of this process is elusive. Here, we have identified 3 phosphorylation sites within the bipartite classical nuclear localization signal (cNLS) of CENP-F. These sites are specific for cyclin-dependent kinase 1 (Cdk1), which is active in G2 phase. Phosphomimetic mutations of these residues strongly diminish the interaction of the CENP-F cNLS with its nuclear transport receptor karyopherin α. These mutations also diminish nuclear localization of the CENP-F cNLS in cells. Notably, the cNLS is phosphorylated in the -1 position, which is important to orient the adjacent major motif for binding into its pocket on karyopherin α. We propose that localization of CENP-F is regulated by a cNLS, and a nuclear export pathway, resulting in nuclear localization during most of interphase. In G2 phase, the cNLS is weakened by phosphorylation through Cdk1, likely resulting in nuclear export of CENP-F via the still active nuclear export pathway. Once CENP-F resides in the cytosol, it can engage in pathways that are important for cell cycle progression, kinetochore assembly and the faithful segregation of chromosomes into daughter cells.

  2. Observations of Sagittarius A* during the pericenter passage of the G2 object with MAGIC

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Buson, S.; Carosi, A.; Chatterjee, A.; Clavero, R.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; González Muñoz, A.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Overkemping, A.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Steinbring, T.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Verguilov, V.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.

    2017-05-01

    Context. We present the results of a multi-year monitoring campaign of the Galactic center (GC) with the MAGIC telescopes. These observations were primarily motivated by reports that a putative gas cloud (G2) would be passing in close proximity to the super-massive black hole (SMBH), associated with Sagittarius A*, located at the center of our galaxy. This event was expected to give astronomers a unique chance to study the effect of in-falling matter on the broad-band emission of a SMBH. Aims: We search for potential flaring emission of very-high-energy (VHE; ≥100 GeV) gamma rays from the direction of the SMBH at the GC due to the passage of the G2 object. Using these data we also study the morphology of this complex region. Methods: We observed the GC region with the MAGIC Imaging Atmospheric Cherenkov Telescopes during the period 2012-2015, collecting 67 h of good-quality data. In addition to a search for variability in the flux and spectral shape of the GC gamma-ray source, we use a point-source subtraction technique to remove the known gamma-ray emitters located around the GC in order to reveal the TeV morphology of the extended emission inside that region. Results: No effect of the G2 object on the VHE gamma-ray emission from the GC was detected during the 4 yr observation campaign. We confirm previous measurements of the VHE spectrum of Sagittarius A*, and do not detect any significant variability of the emission from the source. Furthermore, the known VHE gamma-ray emitter at the location of the supernova remnant G0.9+0.1 was detected, as well as the recently discovered VHE source close to the GG radio arc.

  3. Metallomics Study of CdSe/ZnS Quantum Dots in HepG2 Cells.

    Science.gov (United States)

    Peng, Lu; He, Man; Chen, Beibei; Qiao, Yu; Hu, Bin

    2015-10-27

    Toxicity of quantum dots (QDs) has been a hot research concern in the past decade, and there is a lot of challenge in this field. The physicochemical characteristics of QDs can affect their toxicity, while little is known about the specific chemical form of QDs in living cells after incubation so far. In this work, speciation of four CdSe/ZnS QDs in HepG2 cells was carried out from the metallomics' point of view for the first time by using size exclusion chromatography (SEC) coupled with inductively coupled plasma-mass spectrometry (ICP-MS). On the basis of the signal of Cd, two kinds of chemical forms, named as QD-1 and QD-2, were observed in HepG2 cells incubated with CdSe/ZnS QDs. QD-1 was demonstrated to be a kind of QD-like nanoparticles, confirmed by chromatographic retention time, transmission electron microscopy (TEM) characterization, and fluorescence detection. QD-2 was demonstrated to be cadmium-metallothioneins complex (Cd-MTs) by reversed phase liquid chromatography (RPLC) synchronously coupled with ICP-MS and electrospray ionization quadrupole time-of-flight mass spectrometry (ESI-Q-TOF-MS) analysis. Meanwhile, speciation of QDs in HepG2 cells incubated with different conditions was analyzed. With the variation of QDs incubation concentration/time, and elimination time, the species of QD-1 and QD-2 were also observed without other obvious species, and both the amount of QD-1 and QD-2 increased with incubation concentration and time. The obtained results provide valuable information and a strategy for the study of existing chemical form of QDs, greatly benefiting the understanding of QDs toxicity in living cells.

  4. Pinolenic Acid Downregulates Lipid Anabolic Pathway in HepG2 Cells.

    Science.gov (United States)

    Lee, Ah Ron; Han, Sung Nim

    2016-07-01

    Pine nut oil (PNO) was reported to reduce lipid accumulation in the liver. However, the specific effect of pinolenic acid (18:3, all-cis-Δ5,9,12), a unique component of PNO, on lipid metabolism has not been studied. We hypothesized that pinolenic acid downregulates the lipid anabolic pathway in HepG2 cells. HepG2 cells were incubated in serum-free medium supplemented with 50 μM bovine serum albumin (BSA), palmitic acid, oleic acid, γ-linolenic acid, pinolenic acid, eicosapentaenoic acid (EPA), or α-linolenic acid for 24 h. Lipid accumulation was determined by Oil Red O (ORO) staining. The mRNA levels of genes related to fatty acid biosynthesis (SREBP1c, FAS, SCD1, and ACC1), fatty acid oxidation (ACC2, PPARα, CPT1A, and ACADL), cholesterol synthesis (SREBP2 and HMGCR), and lipoprotein uptake (LDLr) and of genes that may be involved in the downregulation of the lipogenic pathway (ACSL3, ACSL4, and ACSL5) were determined by qPCR. LDLR protein levels were measured by Western blot analysis. The mRNA levels of SREBP1c, FAS, and SCD1 were significantly downregulated by pinolenic acid treatment compared to BSA control (53, 54, and 38 % lower, respectively). In addition, the mRNA levels of HMGCR, ACSL3, and LDLr were significantly lower (30, 30, and 43 % lower, respectively), and ACSL4 tended to be lower in the pinolenic acid group (20 % lower, P = 0.082) relative to the control group. In conclusion, pinolenic acid downregulated the lipid anabolic pathway in HepG2 cells by reducing expression of genes related to lipid synthesis, lipoprotein uptake, and the regulation of the lipogenic pathway.

  5. Animal models of premature and retarded ejaculation.

    Science.gov (United States)

    Waldinger, Marcel D; Olivier, Berend

    2005-06-01

    Most of our current understanding of the neurobiology of sexual behavior and ejaculatory function has been derived from animal studies using rats with normal sexual behaviour. However, none of these proposed models adequately represents human ejaculatory disorders. Based on the "ejaculation distribution theory", which postulates that the intravaginal ejaculation latency time in men is represented by a biological continuum, we have developed an animal model for the research of premature and delayed ejaculation. In this model, a large number of male Wistar rats are investigated during 4-6 weekly sexual behavioural tests. Based on the number of ejaculations during 30 min tests, rapid and sluggish ejaculating rats are distinguished, each representing approximately 10% at both ends of a Gaussian distribution. Together with other parameters, such as ejaculation latency time, these rats at either side of the spectrum resemble men with premature and delayed ejaculation, respectively. Comparable to the human situation, in a normal population of rats, endophenotypes exist with regard to basal sexual (ejaculatory) performance.

  6. Neuro-ophthalmic manifestations of prematurity.

    Science.gov (United States)

    Chhablani, Preeti Patil; Kekunnaya, Ramesh

    2014-10-01

    Increasing rates of preterm births coupled with better survival of these infants have resulted in higher prevalence of systemic and ocular complications associated with prematurity. In addition to retinopathy of prematurity, infants who are born preterm may suffer from severe visual impairment as a result of hypoxic ischemic encephalopathy, hypoglycemia, and other metabolic imbalances. The effect of these processes on the anterior visual pathway may result in optic atrophy, optic nerve hypoplasia or optic disc cupping and affection of the posterior visual pathway leads to cortical visual impairment (CVI). Other ocular associations include strabismus, nystagmus, and ocular motor abnormalities such as tonic down gaze and defective saccades and pursuits. Cortical and subcortical involvement also manifests as defects in functional vision and these have not yet been completely understood. Children with CVI may have visual field defects, photophobia, defective visual processing, and deficient color vision. Since most of these children also suffer from additional systemic disabilities, evaluation, and management remains a challenge. However, early diagnosis and initiation of rehabilitation therapy can prove to be of significant benefit in these children.

  7. [Intraventricular haemorrhage in premature newborn babies].

    Science.gov (United States)

    Nazar, N

    This work is the product of the checking of the pathogenesis, incidence, treatment, and prognostic of the intraventricular hemorrhage in the premature newborn. In the revised publications, that include important series of following, this pathology is present in 25% of the infants weighing less than 1,500 g, in which the mortality and morbidity is greater than that of normal newborns, since the development of intraventricular hemorrhage can produce alterations of cerebral blood flow in the immature germinal matrix and in the microvascular net. In consequence the prevention of the intraventricular hemorrhage is directly related with its pathogenesis. It is said that the use of dexamethasone steroids in low doses in the prenatal period, and low doses of indomethacin in the postnatal period, can give better neuroprotection. The surgical treatment is exceptional and has very precise indications, when a progresive hydrocephalus of later apparition is proven. Therefore in premature newborns with intraventricular hemorrhage the best actual treatment is to use an appropiate pharmacological and medical following

  8. The pathophysiology of acquired premature ejaculation.

    Science.gov (United States)

    McMahon, Chris G; Jannini, Emmanuele A; Serefoglu, Ege C; Hellstrom, Wayne J G

    2016-08-01

    The second Ad Hoc International Society for Sexual Medicine (ISSM) Committee for the Definition of Premature Ejaculation defined acquired premature ejaculation (PE) as a male sexual dysfunction characterized by a the development of a clinically significant and bothersome reduction in ejaculation latency time in men with previous normal ejaculatory experiences, often to about 3 minutes or less, the inability to delay ejaculation on all or nearly all vaginal penetrations, and the presence of negative personal consequences, such as distress, bother, frustration and/or the avoidance of sexual intimacy. The literature contains a diverse range of biological and psychological etiological theories. Acquired PE is commonly due to sexual performance anxiety, psychological or relationship problems, erectile dysfunction (ED), and occasionally prostatitis and hyperthyroidism, consistent with the predominant organic etiology of acquired PE, men with this complaint are usually older, have a higher mean BMI and a greater incidence of comorbid disease including hypertension, sexual desire disorder, diabetes mellitus, chronic prostatitis, and ED compared to lifelong, variable and subjective PE.

  9. Premature ovarian insufficiency: Pathogenesis and management

    Directory of Open Access Journals (Sweden)

    Anna J Fenton

    2015-01-01

    Full Text Available The term premature ovarian insufficiency (POI describes a continuum of declining ovarian function in a young woman, resulting in an earlier than average menopause. It is a term that reflects the variable nature of the condition and is substantially less emotive than the formerly used "premature ovarian failure" which signaled a single event in time. Contrary to the decline in the age of menarche seen over the last 3-4 decades there has been no similar change in the age of menopause. In developed nations, the average age for cessation of menstrual cycles is 50-52 years. The age is younger among women from developing nations. Much has been written about POI despite a lack of good data on the incidence of this condition. It is believed that 1% of women under the age of 40 years and 0.1% under the age of 30 years will develop POI. Research is increasingly providing information about the pathogenesis and treatments are being developed to better preserve ovarian function during cancer treatment and to improve fertility options. This narrative review summarizes the current literature to provide an approach to best practice management of POI.

  10. Treatment of threshold retinopathy of prematurity

    Directory of Open Access Journals (Sweden)

    Deshpande Dhanashree

    1998-01-01

    Full Text Available This report deals with our experience in the management of threshold retinopathy of prematurity (ROP. A total of 45 eyes of 23 infants were subjected to treatment of threshold ROP. 26.1% of these infants had a birth weight of >l,500 gm. The preferred modality of treatment was laser indirect photocoagulation, which was facilitated by scleral depression. Cryopexy was done in cases with nondilating pupils or medial haze and was always under general anaesthesia. Retreatment with either modality was needed in 42.2% eyes; in this the skip areas were covered. Total regression of diseases was achieved in 91.1% eyes with no sequelae. All the 4 eyes that progressed to stage 5 despite treatment had zone 1 disease. Major treatment-induced complications did not occur in this series. This study underscores the importance of routine screening of infants upto 2,000 gm birth weight for ROP and the excellent response that is achieved with laser photocoagulation in inducing regression of threshold ROP. Laser is the preferred method of treatment in view of the absence of treatment-related morbidity to the premature infants.

  11. Neuro-ophthalmic manifestations of prematurity

    Directory of Open Access Journals (Sweden)

    Preeti Patil Chhablani

    2014-01-01

    Full Text Available Increasing rates of preterm births coupled with better survival of these infants have resulted in higher prevalence of systemic and ocular complications associated with prematurity. In addition to retinopathy of prematurity, infants who are born preterm may suffer from severe visual impairment as a result of hypoxic ischemic encephalopathy, hypoglycemia, and other metabolic imbalances. The effect of these processes on the anterior visual pathway may result in optic atrophy, optic nerve hypoplasia or optic disc cupping and affection of the posterior visual pathway leads to cortical visual impairment (CVI. Other ocular associations include strabismus, nystagmus, and ocular motor abnormalities such as tonic down gaze and defective saccades and pursuits. Cortical and subcortical involvement also manifests as defects in functional vision and these have not yet been completely understood. Children with CVI may have visual field defects, photophobia, defective visual processing, and deficient color vision. Since most of these children also suffer from additional systemic disabilities, evaluation, and management remains a challenge. However, early diagnosis and initiation of rehabilitation therapy can prove to be of significant benefit in these children.

  12. Inactivation of PTEN is responsible for the survival of Hep G2 cells in response to etoposide-induced damage.

    Science.gov (United States)

    Mukherjee, Ananda; Samanta, Saheli; Karmakar, Parimal

    2011-10-01

    The chemo-resistance character of human hepatocellular carcinoma cells is well known but the anomalies associated with such resistance character are not completely understood. In this study, etoposide-induced signaling events in human hepatocellular carcinoma cell line, Hep G2 has been compared with Chang Liver cells, a normal human liver cell line. Hep G2 cells are resistant to etoposide when compared with Chang Liver cells. Etoposide-induced γH2AX foci in Hep G2 cells are persisted for a longer time without affecting cell cycle, indicating that Hep G2 cells are able to maintain its growth with damaged DNA. Further, Akt signaling pathway is deregulated in Hep G2 cells. The upstream negative regulator of Akt, PTEN remains inactive, as it is hyperphosphorylated in Hep G2 cells. Inhibition of PI-3K pathway by wortmannin partially reverses the etoposide-resistance character of Hep G2 cells. Either Hep G2 or Chang Liver cells when transfected with plasmid carrying active Akt (myr-Akt) become resistance towards etoposide compared to the cells transfected with empty vectors or kinase defective Akt. Transient transfection of wild type PTEN in Hep G2 cells does not change its response towards etoposide whereas Chang Liver cells become sensitive after transfection with same plasmid. These results suggest that inactivation of PTEN, which renders activation of Akt, may contribute largely for the etoposide-resistance character of Hep G2 cells. 2011 Elsevier B.V. All rights reserved.

  13. Condensate from a two-stage gasifier

    DEFF Research Database (Denmark)

    Bentzen, Jens Dall; Henriksen, Ulrik Birk; Hindsgaul, Claus

    2000-01-01

    that the organic compounds and the inhibition effect are very low even before treatment with activated carbon. The moderate inhibition effect relates to a high content of ammonia in the condensate. The nitrifiers become tolerant to the condensate after a few weeks of exposure. The level of organic compounds......Condensate, produced when gas from downdraft biomass gasifier is cooled, contains organic compounds that inhibit nitrifiers. Treatment with activated carbon removes most of the organics and makes the condensate far less inhibitory. The condensate from an optimised two-stage gasifier is so clean...

  14. Quality factors to consider in condensate selection

    Energy Technology Data Exchange (ETDEWEB)

    Lywood, B. [Crude Quality Inc., Edmonton, AB (Canada)

    2009-07-01

    Many factors must be considered when assessing the feasibility of using condensates as a diluent for bitumen or heavy crude production blending. In addition to commercial issues, the effect of condensate quality is a key consideration. In general, condensate quality refers to density and viscosity. However, valuation decisions could be enhanced through the expansion of quality definitions and understanding. This presentation focused on the parameters that are important in choosing a diluent grade product. It also reviewed pipeline and industry specifications and provided additional information regarding general properties for bitumen and condensate compatibility; sampling and quality testing needs; and existing sources of information regarding condensate quality. tabs., figs.

  15. 关于例外群G2的旧知与新识

    Institute of Scientific and Technical Information of China (English)

    Ilka Agricola; 高燕芳(译); 李福安(校)

    2010-01-01

    1900年6月11日,在德国莱比锡(Leipzig)的一次演讲中,Friedrich Engel(弗里德里希·恩格尔)第一次公开报告了他新近发现的最小例外李群G2的刻画,并且他在给萨克森皇家科学院(the Royal Saxonian Academy of Sciences)的通讯评论中写到:

  16. Characterization of Cubic Graphs G with irt(G = Irt(G = 2

    Directory of Open Access Journals (Sweden)

    Eslahchi Changiz

    2014-08-01

    Full Text Available A subset S of vertices in a graph G is called a total irredundant set if, for each vertex v in G, v or one of its neighbors has no neighbor in S −{v}. The total irredundance number, ir(G, is the minimum cardinality of a maximal total irredundant set of G, while the upper total irredundance number, IR(G, is the maximum cardinality of a such set. In this paper we characterize all cubic graphs G with irt(G = IRt(G = 2

  17. The SM extensions with additional light scalar singlet, nonrenormalizable Yukawa interactions and $(g-2)_{\\mu}$

    CERN Document Server

    Gninenko, S N

    2016-01-01

    We consider the SM extension with additional light real singlet scalar, right-handed neutrino and nonrenormalizable Yukawa interaction for the first two generations. We show that the proposed model can explain the observed $(g - 2)$ muon anomaly. Phenomenological consequences as flavour violating decays $\\tau \\rightarrow \\mu\\mu\\mu, \\mu \\mu e, \\mu e e $ are briefly discussed. We also propose the $U_R(1)$ gauge generalization of the SM with complex scalar singlet and nonzero right-handed charges for the first two generations.

  18. No Microwave Flare of Sagittarius A* around the G2 Periastron Passing

    CERN Document Server

    Tsuboi, Masato; Kameya, Osamu; Yonekura, Yoshinori; Miyamoto, Yusuke; Kaneko, Hiroyuki; Seta, Masumichi; Nakai, Naomasa; Takaba, Hiroshi; Wakamatsu, Ken-ichi; Miyoshi, Makoto; Fukuzaki, Yoshihiro; Uehara, Kenta; Sekido, Mamoru

    2014-01-01

    In order to explore any change caused by the G2 cloud approaching, we have monitored the flux density of Sgr A* at 22 GHz from Feb. 2013 to Aug. 2014 with a sub-array of Japanese VLBI Network . The observation period included the expected periastron dates. The number of observation epochs was 283 days. We have observed no significant microwave enhancement of Sgr A* in the whole observation period. The average flux density in the period is $S=1.23+/-0.33$ Jy. The average is consistent with the usually observed flux density range of Sgr A* at 22 GHz.

  19. Moments of the neutron g2 structure function at intermediate Q2

    Science.gov (United States)

    Solvignon, P.; Liyanage, N.; Chen, J.-P.; Choi, Seonho; Slifer, K.; Aniol, K.; Averett, T.; Boeglin, W.; Camsonne, A.; Cates, G. D.; Chang, C. C.; Chudakov, E.; Craver, B.; Cusanno, F.; Deur, A.; Dutta, D.; Ent, R.; Feuerbach, R.; Frullani, S.; Gao, H.; Garibaldi, F.; Gilman, R.; Glashausser, C.; Gorbenko, V.; Hansen, O.; Higinbotham, D. W.; Ibrahim, H.; Jiang, X.; Jones, M.; Kelleher, A.; Kelly, J.; Keppel, C.; Kim, W.; Korsch, W.; Kramer, K.; Kumbartzki, G.; LeRose, J. J.; Lindgren, R.; Ma, B.; Margaziotis, D. J.; Markowitz, P.; McCormick, K.; Meziani, Z.-E.; Michaels, R.; Moffit, B.; Monaghan, P.; Munoz Camacho, C.; Paschke, K.; Reitz, B.; Saha, A.; Shneor, R.; Singh, J.; Sulkosky, V.; Tobias, A.; Urciuoli, G. M.; Wang, K.; Wijesooriya, K.; Wojtsekhowski, B.; Woo, S.; Yang, J.-C.; Zheng, X.; Zhu, L.; Jefferson Lab E01-012 Collaboration

    2015-07-01

    We present new experimental results for the 3He spin structure function g2 in the resonance region at Q2 values between 1.2 and 3.0 (GeV/c )2. Spin dependent moments of the neutron were extracted. Our main result, the inelastic contribution to the neutron d2 matrix element, was found to be small at =2.4 (GeV/c ) 2 and in agreement with the lattice QCD calculation. The Burkhardt-Cottingham sum rule for 3He and the neutron was tested with the measured data and using the Wandzura-Wilczek relation for the low x unmeasured region.

  20. BMI1 attenuates etoposide-induced G2/M checkpoints via reducing ATM activation.

    Science.gov (United States)

    Wei, F; Ojo, D; Lin, X; Wong, N; He, L; Yan, J; Xu, S; Major, P; Tang, D

    2015-06-04

    The BMI1 protein contributes to stem cell pluripotency and oncogenesis via multiple functions, including its newly identified role in DNA damage response (DDR). Although evidence clearly demonstrates that BMI1 facilitates the repair of double-stranded breaks via homologous recombination (HR), it remains unclear how BMI1 regulates checkpoint activation during DDR. We report here that BMI1 has a role in G2/M checkpoint activation in response to etoposide (ETOP) treatment. Ectopic expression of BMI1 in MCF7 breast cancer and DU145 prostate cancer cells significantly reduced ETOP-induced G2/M arrest. Conversely, knockdown of BMI1 in both lines enhanced the arrest. Consistent with ETOP-induced activation of the G2/M checkpoints via the ATM pathway, overexpression and knockdown of BMI1, respectively, reduced and enhanced ETOP-induced phosphorylation of ATM at serine 1981 (ATM pS1981). Furthermore, the phosphorylation of ATM targets, including γH2AX, threonine 68 (T68) on CHK2 (CHK2 pT68) and serine 15 (S15) on p53 were decreased in overexpression and increased in knockdown BMI1 cells in response to ETOP. In line with the requirement of NBS1 in ATM activation, we were able to show that BMI1 associates with NBS1 and that this interaction altered the binding of NBS1 with ATM. BMI1 consists of a ring finger (RF), helix-turn-helix-turn-helix-turn (HT), proline/serine (PS) domain and two nuclear localization signals (NLS). Although deletion of either RF or HT did not affect the association of BMI1 with NBS1, the individual deletions of PS and one NLS (KRMK) robustly reduced the interaction. Stable expression of these BMI1 mutants decreased ETOP-induced ATM pS1981 and CHK2 pT68, but not ETOP-elicited γH2AX in MCF7 cells. Furthermore, ectopic expression of BMI1 in non-transformed breast epithelial MCF10A cells also compromised ETOP-initiated ATM pS1981 and γH2AX. Taken together, we provide compelling evidence that BMI1 decreases ETOP-induced G2/M checkpoint activation via