
Sample records for predadores agistemus floridanus

  1. Seletividade de produtos fitossanitários sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae Selectivity ofthe pesticides tothe predaceous mite Agistemus brasiliensis Matioli,, Ueckermann & Oliveira (Acari: Stigmaeidae

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available Os ácaros predadores das famílias Phytoseiidae e Stigmaeidae constituem-se nos principais inimigos naturais de Brevipalpus phoenicis (Geijskes em citros. Este ácaro-praga causa sérios prejuízos na produção, devido à transmissão do vírus da leprose dos citros (CiLV. Apesar do grande volume de informações sobre a sensibilidade de ácaros Phytoseiidae a agrotóxicos, praticamente não existem informações sobre o efeito desses compostos em ácaros Stigmaeidae no Brasil. Sendo assim, o trabalho teve por objetivo avaliar o efeito dos principais agrotóxicos utilizados em citros sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae, em condições de laboratório. Arenas de folhas de citros da variedade Pera, contendo 25 fêmeas adultas de A. brasiliensis, foram pulverizadas em torre de Potter. Avaliaram-se as mortalidades dos ácaros 72 horas após a aplicação. O efeito dos produtos na reprodução do acarino e a viabilidade dos ovos também foram avaliados. Quanto à seletividade, conforme proposta da "Organização Internacional para o Controle Biológico" (IOBC, os produtos foram classificados como: classe 1 - inócuo (E99%, calda sulfocálcica, cyhexatin, flufenoxuron, hexythiazox, óxido de fenbutatin, propargite, pyridaben e spirodiclofen. Estudos conduzidos em condições de campo ainda são necessários para se compreender melhor o efeito desses agrotóxicos sobre o ácaro predador.The predaceous mites of the families Phytoseiidae and Stigmaeidae are the most important natural enemies of Brevipalpus phoenicis (Geijskes on citrus. This mite causes serious damages to the yield due to the transmission of Citrus leprosis virus (CiLV. Despite the considerable amount of information on susceptibility of phytoseiids to pesticides, the effect of these compounds is not very known for stigmaeid mites in Brazil. This work was carried out to evaluate the effect of the main pesticides used in

  2. Biology of three species of Agistemus (Acari: Stigmaeidae): life table parameters using eggs of Panonychus citri or pollen of Malephora crocea as food. (United States)

    Goldarazena, Arturo; Aguilar, Hugo; Kutuk, Halil; Childers, Carl C


    The biology and life table parameters of Agistemus industani Gonzalez, A. cyprius Gonzalez, and A. floridanus Gonzalez (Acari: Stigmaeidae) were studied under laboratory conditions using two food sources: Panonychus citri (McGregor) eggs or ice plant, Malephora crocea (Jacquin) Schwantes pollen at 25 degrees C. The larval, protonymph, deutonymph, and adult stages of A. industani fed on citrus red mite eggs. All active stages of A. industani, except the larva, fed on all P. citri stages and the larval stage could not feed on P. citri adults. All immature stages of A. industani fed on M. crocea pollen. Agistemus cyprius larvae fed on P. citri eggs and larvae or ice plant pollen. The nymphal stages fed on P. citri eggs, larvae, and protonymphs but not deutonymphs or adults while A. cyprius deutonymphs and adults fed on all P. citri stages. Adult and nymphal stages of A. cyprius fed on ice plant pollen and successfully completed their development while A. floridanus did not. Agistemus floridanus larvae fed only on P. citri eggs, while the other stages fed on P. citri eggs, larvae, and protonymphs. The developmental times from egg to adult for A. industani and A. cyprius when fed M. crocea pollen were 11.3 and 13.4 days, respectively. Agistemus floridanus was unable to complete its life cycle on a diet of only M. crocea pollen. Agistemus industani, A. cyprius, and A. floridanus completed development from egg to adult in 11.7, 13.8, and 10.8 days, respectively, when fed P. citri eggs. The intrinsic rate of increase (r(m)) values for A. cyprius and A. industani were 0.0311 and 0.1201 per day on the pollen diet. The net reproductive rate (Ro) was 3.58 for A. cyprius and 10.07 for A. industani with generation times (T) of 45.2 and 35.1 days, respectively, on the ice plant pollen diet. The r(m) values for A. cyprius, A. floridanus, and A. industani on the P. citri egg only diet were: 0.0562, 0.1001, and 0.1031 per day, respectively. The Ro values for each species fed P

  3. Seletividade de oito inseticidas a predadores de lagartas em citros

    Directory of Open Access Journals (Sweden)

    Galvan Tederson Luiz


    Full Text Available O objetivo deste trabalho foi avaliar a seletividade dos inseticidas abamectina, acefato, carbaril, deltametrina, fenitrotiom, fenpropatrina, paratiom metílico e triclorfom aos predadores Brachygastra lecheguana (Latreille, Protonectarina sylveirae (Saussure e Protopolybia exigua (Saussure (Hymenoptera: Vespidae em concentrações que corresponderam a 50% e 100% da dose recomendada para o controle de lagartas em citros. Os inseticidas estudados não foram seletivos em favor do predador P. sylveirae. Fenitrotiom, fenpropatrina, paratiom metílico e triclorfom não foram seletivos em favor dos predadores B. lecheguana e P. exigua. Abamectina, acefato e carbaril foram medianamente seletivos em favor de P. exigua, o mesmo foi verificado com abamectina e carbaril em favor de B. lecheguana. Acefato foi seletivo em favor de B. lecheguana e deltametrina em favor de P. exigua. As altas mortalidades causadas por deltametrina a P. sylveirae, triclorfom a B. lecheguana e acefato a P. exigua decresceram quando aplicados em subdose. B. lecheguana foi o predador mais tolerante à dose de acefato, seguido por P. exigua e P. sylveirae. O predador P. exigua foi mais tolerante à dose de deltametrina que B. lecheguana e P. sylveirae. As três espécies de predadores foram altamente suscetíveis às doses e subdoses de fenitrotiom, fenpropatrina e paratiom metílico, e à dose de triclorfom.

  4. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Vicosa, Minas Gerais state, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Matioli, Andre L. [Instituto Biologico, Campinas, SP (Brazil). Lab. de Entomologia Economica], e-mail:; Pallini, Angelo [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal], e-mail:; Tavares, Mara G. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Geral], e-mail:


    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Vicosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifications were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute ({+-} 360 {mu}m long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the fi rst molecular study carried out with stigmaeid mites. (author)

  5. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Vicosa, Minas Gerais state, Brazil

    International Nuclear Information System (INIS)

    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Vicosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifications were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute (± 360 μm long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the fi rst molecular study carried out with stigmaeid mites. (author)

  6. Social isolation and brain development in the ant Camponotus floridanus. (United States)

    Seid, Marc A; Junge, Erich


    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies. PMID:27126402

  7. Social isolation and brain development in the ant Camponotus floridanus (United States)

    Seid, Marc A.; Junge, Erich


    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  8. Sarcocystis sp. in the eastern cottontail (Sylvilagus floridanus). (United States)

    Cosgrove, M; Wiggins, J P; Rothenbacher, H


    Sarcocystis sp. was observed in 100 of 185 (54.1%) Eastern cottontails (Sylvilagus floridanus) examined in Pennsylvania over a three year period. Gross and histologic examination commonly revealed cysts in skeletal muscle of the fore and hind legs, flanks and loins. Two rabbits had cysts in esophageal skeletal muscle. Host response to Sarcocystis sp. is described. Adult rabbits had a significantly greater rate of infection (69.3%) than juveniles (20.7%) (P less than 0.01). PMID:6808158

  9. Two renal tumors in cottontail rabbits (Sylvilagus floridanus). (United States)

    Carlton, W W; Dietz, J M


    Renal tumors were found in two cottontail rabbits (Sylvilagus floridanus) about 1 year old. One tumor was intimately associated with the kidney and consisted of isolated ductular and tubular structures within an abundant connective tissue stroma and was diagnosed as a hamartoma of urogenital origin. The second was composed of epithelial cells arrange as alveolar structures with papillary projections, epithelium that was less differentiated into tubules and ducts, and neoplastic epithelial cells in solid sheets. The diagnosis of renal adenocarcinoma was based on the histologic features as metastasis had not occurred. PMID:850992

  10. Probable herpesvirus infection in an eastern cottontail (Sylvilagus floridanus). (United States)

    Schmidt, S P; Bates, G N; Lewandoski, P J


    One wild eastern cottontail (Sylvilagus floridanus) from Milwaukee County, Wisconsin was necropsied. The lungs contained numerous multifocal, circumscribed, tan foci; the spleen was markedly enlarged and had a mottled reddish tan color; and the brain had a red to tan friable tract in the left hemisphere. Microscopically, the lung had a severe bronchiolitis and pneumonia. The bronchiolitis was characterized by epithelial cells containing eosinophilic intranuclear inclusion bodies. The encephalomalacia of the left cerebral cortex featured tissue disruption and astrocytes or neurons containing intranuclear inclusion bodies. Herpesvirus particles were found within the bronchiolar epithelial cells. Based on histopathological and ultrastructural findings, a herpesvirus seemed the most likely etiologic agent. PMID:1335521

  11. Apuntes de José Antonio Valverde sobre predadores del hombre


    Valverde Gómez, José Antonio, 1926-2003


    Apuntes sobre predadores del hombre, que el autor utilizó para elaborar su conferencia "L'Evolution Humaine Apercue Generale", impartida en el Musèe de l'Homme de París, y patrocinada por la Société d’Anthropologie de Paris, el 21 de marzo de 1963.

  12. Eastern cottontail (sylvilagus floridanus) as carrier of dermatophyte fungi. (United States)

    Gallo, M G; Tizzani, P; Peano, A; Rambozzi, L; Meneguz, P G


    Eastern cottontail (Sylvilagus floridanus, fam. Leporidae), introduced into Piedmont (Italy) in the 1960s, was studied as carrier of dermatophyte fungi. Of 216 hair samples collected from animals culled between September 1999 and July 2000 in the Province of Alessandria (Piedmont, Italy) during a pest control project, 57 (26.4%) yielded dermatophyte colonies. As two different species of dermatophytes grew from two samples, a total of 59 fungal isolates (26.5%) were obtained. Six dermatophyte species both geophilic (M. gypseum, M. cookei, Trichophyton ajelloi, T. terrestre) and zoophilic (M. canis, T. mentagrophytes) were identified. No sex-related differences were found but season-related differences were observed. The highest prevalence of dermatophyte-positive samples was recorded in May-September, due to the geophilic fungi whose prevalence decreased during colder and increased during warmer months (p < 0.001). The presence of zoophilic dermatophytes, T. mentagrophytes, commonly associated with rodents, small mammals and lagomorphs and M. canis, usually correlated with domestic environment, did not change the whole year round. As Eastern cottontail has been showed to be a carrier of dermatophytes transmissible to man (M. canis, T. mentagrophytes and M. gypseum), it may represent a source of infection for gamekeepers, hunters and veterinarians. PMID:16170613

  13. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Viçosa, Minas Gerais State, Brazil. (United States)

    Matioli, André L; Pallini, Angelo; Tavares, Mara G


    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Viçosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifi cations were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute (+/- 360 microm long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the first molecular study carried out with stigmaeid mites. PMID:19488517

  14. Serologic evidence for rabbit syncytium virus in eastern cottontail rabbits (Sylvilagus floridanus) in Ohio. (United States)

    Theil, K W; McCloskey, C M; Scott, D P


    Thirteen of 20 eastern cottontail rabbit (Sylvilagus floridanus) sera collected near Delaware, Ohio (USA) in 1991 were positive by indirect immunofluorescent antibody test (IFAT) for antibody to rabbit syncytium virus (RSV), a Kemerovo serogroup orbivirus. In addition, two of 10 domestic bovine sera and three of 30 sheep sera collected in southeastern Ohio gave weak positive IFAT reactions to RSV. PMID:8394944

  15. Immune response of the ant Camponotus floridanus against pathogens and its obligate mutualistic endosymbiont. (United States)

    Ratzka, Carolin; Liang, Chunguang; Dandekar, Thomas; Gross, Roy; Feldhaar, Heike


    Numerous insect species harbor mutualistic endosymbionts that play a role in nutrient cycling or confer other fitness benefits to their hosts. Insect hosts face the problem of having to maintain such mutualistic bacteria while staging an immune response towards pathogens upon infection. In addition, hosts may regulate the number of endosymbionts present in their tissues via the innate immune system. Camponotus floridanus ants harbor the obligate endosymbiont Blochmannia floridanus in specialized midgut cells and ovaries. We identified genes transcriptionally induced in response to septic injury by suppression subtractive hybridization (SSH). Among these were genes involved in pathogen recognition (e.g. GNBP), signal transduction (e.g. MAPK-kinase), antimicrobial activity (e.g. defensin and hymenoptaecin), or general stress response (e.g. heat shock protein). A quantitative analysis of immune-gene expression revealed different expression kinetics of individual factors and also characteristic expression profiles after injection of gram-negative and gram-positive bacteria. Likewise, B. floridanus injected into the hemocoel elicited a comparable immune response of its host C. floridanus. Thus, the host immune system may contribute to controlling the endosymbiont population. PMID:21440063

  16. Effects of Hydrogen Peroxide and Metrifonate on Monogenean ligictaluridus floridanus on Catfish ( Ictalurus punctatus , Rafinesque) Gills. (United States)

    Benavides-González, Flaviano; Gomez-Flores, Ricardo Alberto; Rábago-Castro, Jaime Luis; Sánchez-Martínez, Jesús Genaro; Montelongo-Alfaro, Isidro Otoniel


    Hydrogen peroxide (H2O2) and metrifonate (Mtf) are common products used in ectoparasite infestations on fish cultures. The therapeutic efficacy of H2O2 and Mtf on a common monogenean parasite, Ligictaluridus floridanus, was evaluated in channel catfish ( Ictalurus punctatus ). In vitro trials were conducted using excised fish gills naturally infected with L. floridanus, which were immersed in H2O2 (150, 300, and 570 mg L(-1)) and Mtf (0.25, 0.5, and 0.75 mg L(-1)) solutions. The efficacy of the treatments was based on the survival time of the parasites, observed microscopically. In addition, an in vivo trial using catfish juveniles, naturally infected with L. floridanus, was also performed. One group received immersion baths of 570 mg L(-1) H2O2 (3%) during 4 min; the Mtf (90%) group received 0.5 mg L(-1) Mtf for 10 min. Treatments were done on days 3, 7, and 11 of the experiment. Results indicate that baths with Mtf do not significantly reduce the mean intensity of the parasite per gill arch, nor do they reduce the in vitro survival time of parasites during treatment; H2O2 baths at 570 mg L(-1) during 4 min were effective (P < 0.05) against adult and juvenile stages of L. floridanus. This study supports the use of H2O2 as an effective antiparasitic agent against I. punctatus . PMID:26286108

  17. Toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis


    Bruce Veronez; Mário Eidi Sato; Roberto Lomba Nicastro


    O objetivo deste trabalho foi avaliar a toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis. A mortalidade e a taxa de crescimento de T. urticae e seu predador foram avaliadas após a aplicação de: abamectina, clofentezina, fenpropatrina, fenpiroximato, propargito, enxofre e espiromesifeno, nas concentrações recomendadas; óleos de nim (Natuneem e Sempre Verde Killer Neem a 1%); e extratos aquosos a 10% de Dieffenbachia brasiliensis, Anno...

  18. Eimeria azul sp. n. (protozoa: Eimeriidae) from the eastern cottontail, Sylvilagus floridanus, in Pennsylvania. (United States)

    Wiggins, J P; Rothenbacher, H


    Eimeria azul sp. n. is described from the cottontail rabbit, Sylvilagus floridanus, in central Pennsylvania. The oval oocysts are 19.5--27.0 micrometer by 15.0--19.0 (mean - 22.9 X 16.7 micrometer). The fusiform sporocysts are 7.8--14.0 micrometer by 3.3--6.5 micrometer (mean = 11.8 X 5.8 micrometer). A Stieda Body is present. There is no micropyle, oocyst residuum or polar granule. The sporocyst has a residuum which is variable in appearance. The oocysts are characterized by a blue tint when viewed with an apochromatic objective lens. PMID:480068

  19. Gastrointestinal parasites of the eastern cottontail (Sylvilagus floridanus) in central Pennsylvania. (United States)

    Wiggins, J P; Cosgrove, M; Rothenbacher, H


    During a 3 year period, 186 eastern cottontails (Sylvilagus floridanus) were trapped from two areas and examined for helminth and protozoan parasites. Fecal samples from 139 were evaluated for coccidia and helminth ova. Nine species of coccictia were identified: Eimera audubonii, E. azul, E. environ, E. honessi, E. maior, E.minima, E. neoirresidua, E. neoleporis, and E. sylvilagi. Ova from 5 helminth species were found: Cittotaenia sp., Hastilesia tricolor, Passalurus sp., a trichostrongyle-type nematode species, and Trichuris sp. Five helminths were recovered from stomachs and small intestines: Cittotaenia sp. H. tricolor, Obeliscoides cuniculi,, Passalurus ambiguus, and Trichostrongylus calcaratus. PMID:7463607

  20. Brugia lepori sp. n. (Filarioidea: Onchocercidae) from rabbits (Sylvilagus aquaticus, S. floridanus) in Louisiana. (United States)

    Eberhard, M L


    Brugia lepori sp. n., a filarial nematode from the abdominal lymphatics and subcutaneous tissues of rabbits (Sylvilagus aquaticus, S. floridanus), from St. Tammany Parish, Louisiana, is described. Brugia lepori is of moderate size (males 12 to 19 mm, females 39 to 45 mm) and within the genus most closely resembles Brugia beaveri of the raccoon, from which it can be distinguished by its larger size, smaller spicules, and smaller microfilaria which has a shorter cephalic space. Brugia lepori is only the second species of Brugia described from North America and the third species reported from the Western Hemisphere. PMID:6502360

  1. Toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis

    Directory of Open Access Journals (Sweden)

    Bruce Veronez


    Full Text Available O objetivo deste trabalho foi avaliar a toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis. A mortalidade e a taxa de crescimento de T. urticae e seu predador foram avaliadas após a aplicação de: abamectina, clofentezina, fenpropatrina, fenpiroximato, propargito, enxofre e espiromesifeno, nas concentrações recomendadas; óleos de nim (Natuneem e Sempre Verde Killer Neem a 1%; e extratos aquosos a 10% de Dieffenbachia brasiliensis, Annona squamosa, Ruta graveolens, Agave angustifolia, Melia azedarach, Sonchus oleraceus, Mentha spicata x M. suaveolens, Allium cepa, Laurus nobilis e Eucalyptus saligna. A toxicidade aguda e a influência dos compostos sobre a taxa de crescimento instantâneo dos ácaros foram avaliadas em laboratório. Extratos de A. cepa, A. angustifolia, produtos à base de óleo de nim, espiromesifeno, propargito, fenpiroximato, abamectina e fenpropatrina causaram mortalidade superior a 83% em T. urticae. Extrato de A. angustifolia, Natuneem e clofentezina não causaram mortalidade significativa em P. macropilis. Agave angustifolia e Natuneem não afetaram significativamente a taxa de crescimento deste predador. Propargito, fenpiroximato, abamectina, fenpropatrina, espiromesifeno e extrato de L. nobilis afetaram severamente a população de P. macropilis.

  2. Seletividade de inseticidas a predadores de pulgões Selectivity of insecticides to predators of aphids

    Directory of Open Access Journals (Sweden)

    Marcos Rafael Gusmão


    Full Text Available Estudou-se a seletividade dos inseticidas cipermetrina, diclorvós, diazinon, etion, fenitrotion, malation, metamidofós, paration metílico, permetrina, pirimicarbe e vamidation para adultos dos predadores Cycloneda sanguinea (L. e Eriopis connexa (Germ.(Coleoptera: Coccinellidae. Folhas de tomateiro foram imersas em caldas inseticidas nas doses utilizadas para o controle dos pulgões Myzus persicae (Sulzer e Macrosiphum euphorbiae (Thomas em tomateiro e também na metade das doses recomendadas. Os fatores em estudo foram os inseticidas, as doses, as espécies de predadores e o sexo para C. sanguinea. Vamidation e o pirimicarbe foram os inseticidas mais seletivos a C. sanguinea seguidos do etion e diclorvós (3,2; 6,7; 49,7 e 52,5% de mortalidade, respectivamente. Para E. connexa o pirimicarbe foi o mais seletivo seguido pelo etion e cipermetrina (1,96; 71,28 e 81,92% de mortalidade, respectivamente. Os machos de C. sanguinea foram mais tolerantes que as fêmeas ao etion (33 e 66,5% de mortalidade e permetrina (61 e 100% de mortalidade, respectivamente. A toxicidade da permetrina a E. connexa e do etion às fêmeas de C. sanguinea foi menor quando estes inseticidas foram aplicados em subdose (74,4 e 25% de mortalidade, respectivamente do que quando estes foram aplicados na dose recomendada (100 e 66,5% de mortalidade, respectivamente para o controle de pulgões no tomateiro.The selectivity of cypermethrin, dichlorvos, diazinon, ethion, fenitrothion, matathion, methamidophos, methyl parathion, permethrin, pirimicarb, and vamidathion to adults of Cycloneda sanguinea (L. and Eriopis connexa (Germ. (Coleoptera: Coccinellidae was studied. Tomato leaves were submerged in insecticide solution at recommended rate for controlling Myzus persicae (Sulzer and Macrosiphum euphorbiae (Thomas in tomatoes. The effect of insecticides, doses, predator species, and sex of C. Sanguinea in insecticide selectivity was evaluated. Pirimicarb and vamidathion were the

  3. Encephalitozoon cuniculi, Toxoplasma gondii and Neospora caninum infection in invasive Eastern Cottontail Rabbits Sylvilagus floridanus in Northwestern Italy. (United States)

    Zanet, S; Palese, V; Trisciuoglio, A; Cantón Alonso, C; Ferroglio, E


    Sylvilagus floridanus is a lagomorph introduced for hunting purposes from North America to Europe where, in certain areas like Northern Italy, its population reached high densities. Brain, kidney and skeletal muscle of 144 Eastern Cottontail Rabbits S. floridanus were examined by PCR for Encephalitozoon cuniculi, Toxoplasma gondii and Neospora caninum. DNA of E. cuniculi was found with a prevalence of 9.72% (CI 95% 0.058-0.156). T. gondii and N. caninum DNA was detected in 2.08% (CI 95% 0.0071-0.0595) and 2.78% (CI 95% 0.0109-0.0692) of the samples examined, respectively. This is the first report of E. cuniculi infection in a lagomorph species other than in its natural host Oryctolagus cuniculus, and this is also the first time N. caninum is found to naturally infect S. floridanus. E. cuniculi, T. gondii and N. caninum infect S. floridanus at low but relevant prevalences, considered the important role that these pathogens could play in both animal and human health. PMID:23747104

  4. Survival of vaccinated,feed-trained largemouth bass fry (Micropterus Salmoides Floridanus) during natural exposure to Flavobacterium columnare (United States)

    Largemouth bass (Micropterus salmoides floridanus; Centrarchidae) are often reared in government hatchery programs, then stocked to supplement wild fish populations. After the eggs obtained from broodstock are hatched, fry are stocked into ponds to feed on zooplankton and other small invertebrates....

  5. Potencial predador de arañas tejedoras sobre insectos plaga presentes en un cultivo de soja


    Rojas Buffet, Carolina; Ottati, Marcelo; Viera, Carmen


    Las arañas presentan características que las hace un buen agente de control biológico. Sin embargo, su papel como reguladores de las poblaciones de insectos plaga ha sido poco estudiado. Nuestro trabajo tuvo como objetivo caracterizar el comportamiento predador de las arañas de tela más representativas de un cultivo de soja ante dos tipos de presas plaga: áfidos y colémbolos. Se realizaron experiencias de alimentación donde a cada araña se le ofreció ambos tipos de presas. Se describieron ...

  6. Endoparasites of selected populations of cottontail rabbits (Sylvilagus floridanus) in the southeastern United States. (United States)

    Andrews, C L; Davidson, W R


    During the fall of 1966 and spring of 1967, 260 cottontail rabbits (Sylvilagus floridanus) were collected from 13 sites in 8 southeastern states and examined for endoparasites. In order of prevalence, the endoparasites found were: Obeliscoides cuniculi, Trichostrongylus calcaratus, Trichostrongylus affinis, Taenia pisiformis (cysticerci), Raillietina salmoni, Eimeria spp., Longistriata noviberiae, Cittotaenia variabilis, Hasstilesia tricolor, Trichuris leporis, Dermatoxys veligera, Passalurus ambiguus, Dirofilaria scapiceps, Sarcocystis sp., Linguatula serrata, Nematodirus leporis, and Gongylonema pulchrum. Data are presented on prevalance and intensity of infection with each parasite along with information on geographic distribution. Cottontail rabbits in the southeastern United States show a higher level of parasitism than has been reported from other regions, although these higher parasite burdens were not necessarily associated with increased host morbidity. PMID:7411746

  7. Tyzzer's disease in free-living cottontail rabbits (Sylvilagus floridanus) in Maryland. (United States)

    Ganaway, J R; McReynolds, R S; Allen, A M


    Complement-fixing (CF) antibody to Bacillus piliformis antigen was found in 9 of 14 (64%) serum samples obtained from cottontail rabbits (Sylvilagus floridanus) killed in the wild. CF antibody was not present in the serum of 8 cottontail rabbits trapped as juveniles in the same geographic areas and held in captivity for 4 years. Sero-negative cottontail rabbits died acutely with lesions typical of Tyzzer's disease following the intragastric administration of 10(3.8) ELD50 of B. piliformis spores. The possible influence of Tyzzer's disease upon the cyclic population pattern of cottontail rabbits in the wild is discussed. A hypothesis is presented that B. piliformis spores passed in the feces of diseased wild animals could contaminate pastures, hay and grain, and thereby serve as sources of infection to other animals. PMID:16502694

  8. Experimental infection of eastern cottontail rabbits Sylvilagus floridanus) with infectious bovine rhinotracheitis virus. (United States)

    Lupton, H W; Reed, D E


    Experimental infection of eastern cottontail rabbits (Sylvilagus floridanus) with infectious bovine rhinotracheitis virus caused acute keratoconjunctivitis and a fatal systemic infection. The clinical syndrome was characterized initially by blepharospasm and ocular discharge. The rabbits were markedly depressed on post-exposure day (PED) 5 and were dead or moribund on PED 6. The virus was readily recovered from liver and adrenal gland tissue on PED 6 and from conjunctival swabs on PED 1 to 6. Histopathologic studies revealed a few necrotic foci in the liver and multiple focal to diffuse necrosis of the adrenal glands. Viral isolation and immunofluorescence tests were used to demonstrate a direct association between infectious bovine rhinotracheitis viral antigens and the lesions. PMID:230773

  9. A new species of Paraheligmonella (Nematoda, Heligmonellidae), parasite of Sylvilagus floridanus (Leporidae) from Costa Rica Una especie nueva de Paraheligmonella (Nematoda, Heligmonellidae), parásita de Sylvilagus floridanus (Leporidae) en Costa Rica


    María Celina Digiani; Ramón A. Carreño; Marie-Claude Durette-Desset


    Paraheligmonella lamothei n. sp. (Heligmonellidae: Heligmonellinae) is described from the small intestine of a cottontail, Sylvilagus floridanus (Allen, 1890) (Leporidae), from Costa Rica. New morphological data on the synlophe and caudal bursa of Paraheligmonella romerolagi (Gibbons and Kumar, 1980), the most similar species, are also provided. The new species differs from P. romerolagi, parasitic of Romerolagus diazi (Ferrari-Pérez, 1893) from Mexico, mainly by the characters of the caudal ...

  10. Plantas cultivadas e invasoras como habitat para predadores do gênero Orius(Wolff (Heteroptera: anthocoridae

    Directory of Open Access Journals (Sweden)

    Silveira Luís Cláudio Paterno


    Full Text Available O objetivo deste trabalho foi registrar as espécies de Orius associadas a plantas cultivadas e invasoras presentes em uma localidade de Minas Gerais e três de São Paulo, nos anos de 1999 e 2000. As coletas foram realizadas através de batidas das plantas no interior de sacos plásticos para desalojar os insetos. Posteriormente, as espécies foram separadas em laboratório. O predador Orius insidiosus (Say foi coletado nas culturas de milho (Zea mays L., milheto (Pennisetum glaucum (L. R.Br., sorgo (Sorghum spp., feijão (Phaseolus vulgaris L., girassol (Helianthus annuus L., alfafa (Medicago sativa L., soja [Glycine max (L. Merr.], crisântemo (Chrysanthemum spp., tango (Solidago canadensis L. e cartamus (Carthamus tinctorius L. e nas plantas invasoras picão-preto (Bidens pilosa L., caruru (Amaranthus sp., losna-branca (Parthenium hysterophorus L. e apaga-fogo (Alternanthera ficoidea L.. Orius thyestes Herring foi encontrado nas plantas invasoras picão-preto, caruru e apaga-fogo. Orius perpunctatus (Reuter e Orius sp. foram coletados principalmente nas plantas invasoras picão-preto, caruru e apaga-fogo e no milho. Constatou-se que muitas dessas plantas são reservatórios naturais para esses predadores, em termos de habitat, abrigo, presas e pólen.

  11. In Vitro Cultivation of a Zoonotic Babesia sp. Isolated from Eastern Cottontail Rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts


    Holman, Patricia J.; Spencer, Angela M.; Droleskey, Robert E.; Goethert, Heidi K; Telford, Samuel R.


    A Babesia sp. found in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, is the same organism that caused human babesiosis in Missouri and Kentucky, on the basis of morphology and identical small-subunit rRNA (SSU rRNA) gene sequences. Continuous cultures of the rabbit parasite were established from infected blood samples collected from two cottontail rabbits livetrapped on Nantucket Island. HL-1 medium or minimal essential medium alpha medium supplemented...

  12. Invasive species and their parasites: eastern cottontail rabbit Sylvilagus floridanus and Trichostrongylus affinis (Graybill, 1924) from Northwestern Italy. (United States)

    Tizzani, P; Catalano, S; Rossi, L; Duignan, P J; Meneguz, P G


    The eastern cottontail Sylvilagus floridanus is a native American lagomorph. Within the genus Sylvilagus, the eastern cottontail is the species with the widest distribution. From 1950s, the species was introduced to several European countries. A rapid territorial expansion of the introduced eastern cottontails has been observed in many areas of Italy. The eastern cottontail has been demonstrated to play a main role as carrier of exotic parasites. To date, three nematode species, exotic in Italian ecosystems, have been reported from introduced S. floridanus. However, its parasite fauna biodiversity is richer in native populations of the American continent. The aim of this work was to further investigate the gastrointestinal parasites of S. floridanus, to evaluate the potential presence of other exotic species. During 2010, 101 hosts were examined, and three nematodes were collected from their digestive tract. Two parasite species (Obeliscoides cuniculi, Trichostrongylus calcaratus) were already reported in Italy; the isolation of Trichostrongylus affinis is instead the first report of this nematode in Italy and in Europe as a whole. This study wants to highlight the great risks related to the introduction of allochthonous species. The impact of the invasion by alien animal species may be particularly severe for public and animal health, due to the potential introduction of new pathogens. The good number of exotic parasites found in introduced eastern cottontails, together with the few sanitary surveys carried out, suggests that an epidemiological survey, with specimens from multiple localities on a wider geographic range, could lead to interesting findings on parasites of native and alien lagomorphs in Europe. PMID:24481904

  13. Eastern cottontail rabbits (Sylvilagus floridanus) develop West Nile virus viremias sufficient for infecting select mosquito species. (United States)

    Tiawsirisup, Sonthaya; Platt, Kenneth B; Tucker, Brad J; Rowley, Wayne A


    The potential of the eastern cottontail rabbit (CTR; Sylvilagus floridanus) to contribute to an enzootic West Nile virus (WNV) cycle was demonstrated by characterizing the WNV viremia profile of 15 CTRs and demonstrating that mosquitoes could become infected by feeding on these CTRs. Eight CTRs were infected with a titer of 10(5.0) cell-infectious dose 50% endpoints (CID50s) of WNV (NY99-Crow) by needle and seven CTRs by bite of one or more WNV-infected mosquitoes. There were no marked differences between the WNV viremia profiles of CTRs infected by either method. West Nile virus was detected in serums of all CTRs by 24 h p.i. The daily mean titers of all 15 CTRs on days 1-4 p.i. were 10(4.1+/-0.4), 10(4.7+/-0.3), 10(4.1+/-0.6), and 10(3.7+/-0.6) respectively, declining to 10(1.2+/-0.1) CID50s/ml of serum by day 6 p.i. No virus was detected in the blood of any CTR on day 7 p.i. The average duration of WNV titers of >or=10(4.3) and or=10(4.3) and >10(5.0) were 11.5 +/- 5.5 and 21 +/- 6.0%, respectively. These rates increased to 20.5 +/- 6.4% and 25.0 +/- 3.0% when CTR serum titers were >10(5.0) CID50s/mL. Neither Aedes aegypti (L.) nor Aedes albopictus (Skuse) were infected by feeding on CTRs with titers of 10(5.0) CID50s/ml. None of the CTRs infected by mosquito bite or by needle showed any symptoms of WNV disease. PMID:16417430

  14. Evolution of chromosomal variation in cottontails, genus Sylvilagus (Mammalia: Lagomorpha): S. aquaticus, S. floridanus, and S. transitionalis. (United States)

    Robinson, T J; Elder, F F; Chapman, J A


    The banding patterns of mitotic chromosome from three cottontail species, Sylvilagus aquaticus (2n = 38), S. floridanus (2n = 42), and S. transitionalis (2n = 46), are presented and compared with those of the proposed leporid ancestral karyotype, the latter being reflected in a species of hare, Lepus saxatilis (2n = 48). The differences in the diploid numbers of the cottontail species are primarily due to the fixation of Robertsonian fusions which have occurred during the evolution of their respective genomes. Of the eight fusion products identified, seven were species specific, while one, which is thought to reflect their more recent common ancestory, is shared by both S. aquaticus and S. floridanus. Other karyotypic differences include interspecific variation in the amount and distribution of constitutive heterochromatin, as well as the presence of two autosomal pairs in S. transitionalis which do not have apparent banding homologies either with the chromosomes of other cottontails or with those of the Lepus genome. The tendency for certain chromosomes in the ancestral karyotype to show a predisposition to undergo fusion events within the Leporidae is discussed. PMID:6861527

  15. The niches of Agistemus exsertus and its primary preys in the citrus ecosystem%橘园中重要天敌具瘤神蕊螨与其主要猎物的生态位

    Institute of Scientific and Technical Information of China (English)

    季洁; 张艳璇; 康玉妹; 陈霞; 林坚贞


    研究了柑橘园中具瘤神蕊螨(Agistemus exsertus)与其主要猎物柑橘皱叶刺瘿螨(Phyllocoptruta oleivora)、柑橘全爪螨(Panonychus citri)、柑橘粉虱(Dialeurodes citri)、黑刺粉虱(Aleurocanthus spiniferus)的生态位宽度、重叠和比例相似性.具瘤神蕊螨与其主要猎物相比,其时间和空间生态位宽度均最大,而其猎物中则以柑橘皱叶刺瘿螨的时间和空间生态位宽度最大,这表明具瘤神蕊螨和柑橘皱叶刺瘿螨的发生期较长,空间分布较广.具瘤神蕊螨与其猎物的生态位重叠在空间上与柑橘全爪螨的重叠值最大,在时间上与柑橘粉虱的重叠值最大.与其猎物相比,具瘤神蕊螨的时-空二维生态位宽度最大,在时空上占有明显的优势.


    Directory of Open Access Journals (Sweden)

    Julio Cezar Silveira Nunes


    Full Text Available

    The selectivity of insecticides for the complex of predators of the pests of cotton plant was evaluated in field experiment, in Goiânia- Goiás (Brazil, during the crop 1998/99. The experimental design was the randomized blocks with seven treatments and four repetitions (check, clorfluazuron, Bacillus thuringiensis, alanycarb, endosulfan and acephate in two amounts. The samplings were accomplished in beforeapplication, two days, seven and fourteen days after the treatment. For the obtained results (Henderson & Tilton, the products, in the decreasing order of selectivity, were: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    KEY-WORDS: Insecta; insecticides; cotton plant; predators.

    A seletividade de inseticidas para o complexo das pragas do algodoeiro foi avaliada em experimento de campo, em Goiânia (GO, durante a safra 1998/99. O delineamento experimental foi em blocos ao acaso com sete tratamentos testemunha, clorfluazuron, B. thuringiensis, alanycarb, endosulfan e acephate em duas dosagens, em quatro repetições. As amostragens foram realizadas em pré-aplicação; aos dois, sete e quatorze dias após as pulverizações. Pelos resultados obtidos (fórmula de Herderson & Tilton, os produtos, na ordem decrescente de seletividade, foram: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    PALAVRAS-CHAVE: Insecta; inseticidas; algodão; predadores.

  17. Seletividade de agrotóxicos utilizados em pessegueiro sobre ovos e pupas do predador Chrysoperla externa

    Directory of Open Access Journals (Sweden)

    Rodolfo Vargas Castilhos


    Full Text Available Objetivou-se com este trabalho avaliar a seletividade de dezenove agrotóxicos utilizados na cultura do pessegueiro sobre ovos e pupas do predador Chrysoperla externa em condições laboratoriais (temperatura 25±1ºC, umidade relativa 70±10% e fotofase 14 horas. Os agrotóxicos foram pulverizados diretamente sobre ovos e pupas por meio de uma torre de Potter, utilizando a máxima dosagem recomendada para a cultura do pessegueiro. Foi avaliada a viabilidade de ovos e pupas, além da fecundidade e fertilidade de adultos emergidos de pupas tratadas. Os agrotóxicos foram classificados para ovos em função da redução na eclosão e, para pupas, em função do efeito total, conforme a escala de toxicidade proposta pela IOBC. A maioria dos agrotóxicos avaliados (8 inseticidas, 8 fungicidas e 2 herbicidas se mostrou inócua (classe 1 a ovos e pupas, com redução na eclosão de larvas e efeito total em pupas inferiores a 30%. A exceção se deu para o inseticida óleo mineral, que reduziu a eclosão de larvas em 69,55% quando pulverizado em ovos e proporcionou efeito total em pupas de 36,22%, sendo classificado como levemente nocivo (classe 2 a ovos e pupas de C. externa

  18. Efeito de espécies vegetais em bordadura em cebola sobre a densidade populacional de tripes e sirfídeos predadores.


    Gonçalves Paulo Antonio de Souza; Sousa e Silva Carlos Roberto


    Analisou-se a relação entre o efeito do plantio de diferentes espécies vegetais, em bordadura, na cultura da cebola, Allium cepa L, na incidência de Thrips tabaci Lind. e sirfídeos predadores, Toxomerus spp. O experimento foi conduzido na Epagri, EE de Ituporanga, de agosto a dezembro de 1998. Os tratamentos foram cebola em monocultivo; cebola + trigo mourisco (Fagopyrum esculentum Moench); cebola + nabo forrageiro (Raphanus sativus L. var. oleiferus Metzg.); cebola + cenoura (Daucus carota L...

  19. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae) e os predadores Phytoseiulus macropilis (Banks) e Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae)


    Daniele Cristine Hoffmann Schlesener; Adriane Fonseca Duarte; Milton Fernando Cabezas Guerrero; Uemerson Silva da Cunha; Dori Edson Nava


    O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L) e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L) sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se...

  20. Local feeding specialization of the red fox (Vulpes vulpes) in response to eastern cottontail (Sylvilagus floridanus) introduction (NW Italy)


    Alessandro Balestrieri; Luigi Remonti; Claudio Prigioni


    Abstract To appreciate the influence of the introduction of the Eastern cottontail (Sylvilagus floridanus) on the food habits of the red fox (Vulpes vulpes), between June 1998 and February 2000 fox diet was investigated by means of scat analysis (N=115) in a 250 ha wide Natural Reserve of NW Italy, and compared with data collected in the same area prior to cottontail colonization (1988-1989). Comparison included also the diet of badgers (...

  1. Densità di Lepre (Lepus europaeus) e Silvilago (Sylvilagus floridanus) in ambienti planiziali


    Sandro Bertolino; Perrone, A.; Laura Gola


    Il silvilago (Sylvilagus floridanus) è un leporide d?origine nordamericana, introdotto in Italia a partire dal 1966 a scopo venatorio. Attualmente la specie è diffusa soprattutto in Piemonte e nella parte occidentale della Lombardia. Il silvilago potrebbe interferire con l?autoctona lepre comune (Lepus europaeus), anche se i dati al riguardo sono limitati. Nell?autunno-inverno 2002-2003 abbiamo condotto dei censimenti notturni con faro in alcune aree ...

  2. Richness, origin and structure of an Eimeria community in a population of Eastern cottontail (Sylvilagus floridanus) introduced into Italy. (United States)

    Bertolino, S; Hofmannová, L; Girardello, M; Modry, D


    The composition and structure of a community of Eimeria was investigated in a population of Eastern cottontail (Sylvilagus floridanus) introduced into Italy. Eight Eimeria species were found, of which all but 1 had North American origins and were presumably introduced into Italy together with imported cottontails. The success of cottontails in spreading microparasites is probably related to their massive release for hunting purposes. Nearly all cottontails were infected with at least 1 Eimeria species, with bimonthly prevalence ranging from 0-6.3% (E. leporis) to 42.9-89.3% (E. environ). Bayesian model averaging and multivariate techniques were used to investigate the relationships between the occurrence of each parasite and the structure of the relative community. Among the host parameters, only sex was found to be associated with the prevalence of E. honessi, while the rest of the parameters were only weakly correlated with prevalence and species richness. This indicates that individual phenotypic host characteristics are probably less important than environmental factors in determining levels of parasite prevalence and diversity. The community of Eimeria species was probably structured by competition, with less species co-occurrence than expected under a null hypothesis. This was made evident by the low co-occurrence of E. environ and E. neoirresidua with E. poudrei, E. honessi, and E. maior. PMID:20233489

  3. In vitro cultivation of a zoonotic Babesia sp. isolated from eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts. (United States)

    Holman, Patricia J; Spencer, Angela M; Droleskey, Robert E; Goethert, Heidi K; Telford, Samuel R


    A Babesia sp. found in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, is the same organism that caused human babesiosis in Missouri and Kentucky, on the basis of morphology and identical small-subunit rRNA (SSU rRNA) gene sequences. Continuous cultures of the rabbit parasite were established from infected blood samples collected from two cottontail rabbits livetrapped on Nantucket Island. HL-1 medium or minimal essential medium alpha medium supplemented with 20% human serum best supported in vitro propagation of the parasite in human or cottontail erythrocytes, respectively. Parasite growth was not sustained in domestic-rabbit erythrocytes or in medium supplemented with domestic-rabbit serum. The cultured parasites were morphologically indistinguishable from the Kentucky human isolate. Transmission electron microscopy revealed similar fine structures of the parasite regardless of the host erythrocyte utilized in the cultures. Two continuous lines of the zoonotic Babesia sp. were established and confirmed to share identical SSU rRNA gene sequences with each other and with the Missouri and Kentucky human Babesia isolates. PMID:16081941

  4. Daytime habitat selection by introduced eastern cottontail Sylvilagus floridanus and native european hare Lepus europaeus in Northern Italy. (United States)

    Bertolino, Sandro; Montezemolo, Nicola Cordero di; Perrone, Aurelio


    We used radiotelemetry to investigate resting sites habitat selection by introduced eastern cottontail (Sylvilagus floridanus) and native European hare (Lepus europaeus) under sympatric conditions. We tracked 24 hares and 34 cottontails in a protected area of northwestern Italy. Hares were found in different sites every week, while cottontails used the same site for two weeks, and occasionally for longer. It is supposed that this periodic nest switching reduces the risk of predation and parasitism. Hares and cottontails forms were located in different habitats and characterized by dense vegetation cover near the ground. This cover increased from winter to summer in both species, while in autumn it continued to increase in cottontails only, and decreased in hares. Cottontails selected shrubby habitats near the river, and avoided crop fields in all seasons. Hares were more adaptive in their search, using high herbs and shrubs all year round, wheat fields in spring, maize in spring and summer, and stubbles in winter. Arguably, partial niche differentiation is necessary to allow the coexistence of similar species. In our study area, hares and cottontails differentiated in the use of resting sites habitats, presumably so as not to compete in this part of their ecological niche. PMID:21627451

  5. Evaluation of the eastern cottontail Sylvilagus floridanus as an amplifying vertebrate host for Cache Valley virus (Bunyaviridae) in Indiana. (United States)

    Blackmore, Carina G M; Grimstad, Paul R


    To evaluate the importance of eastern cottontails (Sylvilagus floridanus) as amplifying hosts for Cache Valley virus (CVV), we tested hunter-provided blood samples from northern Indiana for specific neutralizing (N) antibodies against this mosquito-borne bunya-virus. Samples were collected during the winter of 1994-95. Two seronegative eastern cottontails, captured in July 1995, were also infected with CVV by subcutaneous inoculation, and two others were infected by allowing CVV-infected mosquitoes to feed on them. The results indicate that eastern cottontails probably are not important amplifying hosts for CVV. The prevalence of N antibodies against CVV was low (6.0%, n=82) among the hunter-killed animals. Low viremia (<1.8 log10 plaque-forming units/ml) of short duration (1-3 days) were seen in three of four experimentally infected eastern cottontails. The viremias were insufficient for infecting Coquillettidia perturbans, a mosquito species commonly found naturally infected with CVV. PMID:18263839

  6. Bot fly myiasis of the cottontail rabbit, Sylvilagus floridanus mallurus in Virginia with some biology of the parasite, Cuterebra buccata. (United States)

    Jacobson, H A; McGinnes, B S; Catts, E P


    Twenty four percent of 2,643 cottontail rabbits (Sylvilagus floridanus) collected in Virginia from 1949-1975 showed evidence of Cuterebra parasitism. Occurrence was seasonal with greatest prevalence from July to November. Some Oryctolagus cuniculus, S. palustris and one S. transitionalis also showed Cuterebra myiasis. Juvenile rabbits had higher infection rates (28%) than did adult rabbits 14.5%, P less than .001). Juveniles had greater numbers of larvae per host than adults, with means of 2.14 and 1.62, respectively. Larval development sites were in the genital region of most hosts. Twenty flies reared from wild cottontails were identified as C. buccata. Duration of induced infections in Oryctalagus was 30-33 days. Minimal generation time for C. buccata is concluded to be 11 weeks, allowing up to four generations of flies to occur annually in the southern and one generation to occur in the northern distributional limits of this bot fly. Peromyscus hosts were refractory to C. buccata infections. C. buccata fecundity averaged 1316 eggs. Field observations of adult flies are described. PMID:633518

  7. A new species of Paraheligmonella (Nematoda, Heligmonellidae, parasite of Sylvilagus floridanus (Leporidae from Costa Rica Una especie nueva de Paraheligmonella (Nematoda, Heligmonellidae, parásita de Sylvilagus floridanus (Leporidae en Costa Rica

    Directory of Open Access Journals (Sweden)

    María Celina Digiani


    Full Text Available Paraheligmonella lamothei n. sp. (Heligmonellidae: Heligmonellinae is described from the small intestine of a cottontail, Sylvilagus floridanus (Allen, 1890 (Leporidae, from Costa Rica. New morphological data on the synlophe and caudal bursa of Paraheligmonella romerolagi (Gibbons and Kumar, 1980, the most similar species, are also provided. The new species differs from P. romerolagi, parasitic of Romerolagus diazi (Ferrari-Pérez, 1893 from Mexico, mainly by the characters of the caudal bursa and the synlophe of the female within the posterior region of body. Males of P. lamothei n. sp. possess a caudal bursa not bell-shaped, with a pattern of type 2-2-1 for right lobe and 2-3 with a tendency to type 2-2-1 for left lobe, whereas males of P. romerolagi possess a bell-shaped caudal bursa, with a pattern of type 2-2-1 with a tendency to type 4-1 for both lobes. In P. lamothei n. sp. rays 3 are slightly longer than rays 2 and the genital cone is poorly developed, whereas in P. romerolagi rays 3 are much longer than rays 2 and the genital cone is large and bulbous. Females of P. lamothei n. sp. possess, at ovejector level, ventral and latero-ventral ridges hypertrophied and dorsal ridges reduced, whereas at the same level, females of P. romerolagi possess lateral ridges hypertrophied and dorsal and ventral ridges reduced. Additionally, hypertrophied cuticular ridges posterior to the vulva are present in P. lamothei n. sp., but absent in P. romerolagi.Se describe Paraheligmonella lamothei n. sp., parásita del intestino delgado de Sylvilagus floridanus (Allen, 1890 (Leporidae de Costa Rica. Se aportan además datos nuevos morfológicos sobre el synlophe y la bolsa caudal de Paraheligmonella romerolagi (Gibbons y Kumar, 1980, la especie morfológicamente más parecida. La especie nueva se diferencia de P. romerolagi, parásita de Romerolagus diazi (Ferrari-Pérez, 1893 de México, principalmente por caracteres de la bursa caudal y el synlophe de la

  8. Plantas transgênicas resistentes a insetos e organismos não-alvo: predadores, parasitóides e polinizadores - doi: 10.5102/ucs.v4i1.23

    Directory of Open Access Journals (Sweden)

    Marina Regina Frizzas


    Full Text Available Plantas geneticamente modificadas resistentes aos insetos oferecem benefícios à agricultura moderna. No entanto, esta tecnologia pode afetar o controle biológico natural e a biodiversidade por meio de efeitos diretos e indiretos das plantas transgênicas sobre o valor adaptativo e comportamental de predadores, parasitóides, polinizadores e outros artrópodes não-alvo. Neste artigo, são discutidos os impactos ou os efeitos potenciais de plantas transgênicas resistentes a insetos sobre organismos não-alvo, com ênfase em artrópodes predadores, parasitóides e polinizadores, e os principais estudos com plantas transgênicas resistentes a insetos, publicados nos últimos dez anos.

  9. Seletividade fisiológica de inseticidas a Vespidae predadores de Ascia monuste orseis Insecticide physiological selectivity to Vespidae predators of Ascia monuste orseis

    Directory of Open Access Journals (Sweden)

    André Luiz Barreto Crespo


    Full Text Available Este trabalho objetivou estudar a seletividade dos inseticidas carbaril, deltametrina, paratiom metílico, permetrina e triclorfom em relação a Ascia monuste orseis (Godart (Lepidoptera: Pieridae e a seus predadores Brachygastra lecheguana Latreille e Protonectarina sylveirae (Saussure (Hymenoptera: Vespidae. Por meio de curvas de concentração-mortalidade e das concentrações letais para 90% da população (CL90, calcularam-se os índices de seletividade diferencial (ISD90, de toxicidade relativa, e de tolerância relativa (ITRe90. O paratiom metílico e triclorfom apresentaram seletividade em favor de B. lecheguana (ISD90 = 2,83 e 1,75 e P. sylveirae (ISD90 = 2,95 e 3,59 em relação a A. monuste orseis. Deltametrina e permetrina apresentaram seletividade em favor de P. sylveirae (ISD90 = 1,98 e 2,70 em relação a A. monuste orseis, mas não apresentaram seletividade em favor de B. lecheguana (ISD90 = 0,21 e 0,64. B. lecheguana foi menos tolerante a deltametrina, permetrina e triclorfom do que P. sylveirae (ITRe90 = 9,36, 4,23 e 2,05, e mais tolerante ao carbaril (ITRe90 = 0,14. Os predadores apresentaram tolerância semelhante ao paratiom metílico (ITRe90 = 1,04. As curvas de concentração-mortalidade do carbaril, permetrina e triclorfom em ambos os predadores, de deltametrina em B. lecheguana, e de paratiom metílico em P. sylveirae, apresentaram maiores inclinações do que as curvas em A. monuste orseis.This work aimed to study the selectivity of the insecticides carbaryl, deltamethrin, methyl parathion, permethrin and trichlorfon in relation to Ascia monuste orseis (Godart (Lepidoptera: Pieridae and to their predators Brachygastra lecheguana Latreille and Protonectarina sylveirae (Saussure (Hymenoptera: Vespidae. Based on concentration-response curves and lethal concentrations for 90% of the population (LC90, the differential selectivity index (DSI90, relative toxicity index and relative tolerance index (ReTI90 were calculated

  10. Efeito de inseticidas em insetos predadores em culturas de algodão Effect of insecticides on predator insects associated with cotton

    Directory of Open Access Journals (Sweden)



    Full Text Available Com o objetivo de verificar o efeito de inseticidas em insetos predadores em cultura de algodão (Gossypium hirsutum L., instalaram-se, em 1993-1994, dois experimentos, um no campo, e outro, em laboratório. No experimento realizado no campo, os tratamentos foram: Fipronil 200 SC (75 g/ha de i.a.; Fipronil 800 WDG (64, 80 e 100 g/ha de i.a.; Endosulfan 350 CE (700 g/ha de i.a.; e testemunha. Em laboratório, além das formulações à base de Fipronil foi utilizado o Paration metílico 600 CE (480 g/ha de i.a.. Fipronil foi seletivo para os artrópodes predadores (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea e Doru lineare no campo, e a Cycloneda sanguinea (L., em laboratório, e pode ser recomendado em programas de manejo integrado de pragas na cultura do algodoeiro para o controle de Alabama argillacea (Rueb., e Anthonomus grandis Boh. Endosulfan foi seletivo em relação a Scymnus sp., Geocoris ventralis Thomazini e Doru lineare (Eschs no campo, com uma redução dos insetos inferior a 30%, e o Paration metílico não foi seletivo para C. sanguinea em laboratório.To assess the selectivity of insecticides to predator insects in cotton (Gossypium hirsutum L. crops two, trials, 1993-1994, under field and laboratory conditions were conducted. Under field conditions, the following treatments were compared: Fipronil 200 CS (75 g/ha of a.i.; Fipronil 800 WDG (64, 80 and 100 g/ha of a.i.; Endosulfan 350 EC (700 g/ha of a.i.; and control. Under laboratory conditions, in addition to Friponil, Methyl parathion 600 EC 480 g/ha of a.i. was also tested. Fipronil was selective to predators (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea and Doru lineare under field condition and to Cycloneda sanguinea (L. under laboratory conditions. This product can be used in integrated pest management programs in cotton crops to control Alabama argillacea (Rueb., and Anthonomus grandis Boh. Endosulfan was selective to Scymnus sp., Geocoris ventralis

  11. A new heligmonellid (Nematoda) from Sylvilagus floridanus (Leporidae) in Costa Rica, with some comments on species of Paraheligmonella Durette-Desset, 1971. (United States)

    Digiani, María Celina; Carreño, Ramón A; Durette-Desset, Marie-Claude


    Paraheligmonella kinsellai n. sp. (Nematoda: Heligmonellidae: Heligmonellinae) is described from the small intestine of a cottontail rabbit Sylvilagus floridanus (Allen, 1890) (Leporidae) from Costa Rica. The new species is similar to P. romerolagi (Gibbons and Kumar, 1980), parasitic in Romerolagus diazi from Mexico and to P. lamothei Digiani, Carreño, and Durette-Desset, 2008, parasitic in Sylvilagus floridanus from Costa Rica, by the characters of the synlophe at mid-body, i.e., 14 cuticular ridges and a single axis of orientation inclined at 30 degrees to the sagittal axis in both sexes. The males of the new species are distinguished from those of P. romerolagi by a caudal bursa that is not bell-shaped, a bursal pattern of type 2-3 with a tendency to 2-2-1, and a genital cone that is not hypertrophied. They are also distinguished from the males of P. lamothei by having the same bursal pattern in both lobes (in P. lamothei the pattern is 2-2-1 on the right lobe and 2-3, with a tendency to 2-2-1, on the left lobe), rays 3 are much longer than rays 2, rays 2 and 3 diverging more proximally, and rays 8 are longer than the dorsal ray. The females of the new species also differ from those of P. lamothei by the shape of the posterior extremity (long and strongly curved vs. short and nearly straight) and by the synlophe at the ovejector level (ridge no. 1' hypertrophied and remaining ridges reduced vs. ventral ridges hypertrophied and dorso-lateral ridges reduced). PMID:19071967

  12. Phytophagy on eucalyptus plants increases the development and reproduction of the predator Podisus nigrispinus (Hemiptera: Pentatomidae = Fitofagia em plantas de eucaliptos aumenta o desenvolvimento e a reprodução do predador Podisus nigrispinus (Hemiptera: Pentatomidae.

    Directory of Open Access Journals (Sweden)

    Anderson Mathias Holtz


    Full Text Available The effect of plant feeding on biological aspects of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae was evaluated. Nymphs and adults of this predator were fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae on Eucalyptus urophylla plants inthe field or only with pupae of this prey in the laboratory. The development and nymphal survival, as well as the pre-oviposition period, number of egg masses, number, fertility and viability of eggs and the longevity of females of this predator were evaluated. The eucalyptus plants improved the development of P. nigrispinus. This demonstrates that this predator can present higher population growth with eucalyptus plants and T. molitor pupae than in the laboratory (controlled conditions only with this prey. These plants can supply nutrients that can the population growth and efficiency of P. nigrispinus for biological control in eucalyptus plantations.O efeito da alimentação em plantas sobre os aspectos biológicos de Podisus nigrispinus (Hemiptera: Pentatomidae foi avaliado. Ninfas e adultos desse predador foram alimentados com pupas de Tenebrio molitor L. (Coleotpera: Tenebrionidae em plantas de Eucalyptus urophylla no campo ou, apenas, em laboratório. O desenvolvimento e a sobrevivência ninfal desse predador, além do período de pré-oviposição, número de posturas, viabilidade dos ovos e afertilidade e longevidade de fêmeas foram avaliados. A planta de eucalipto proporcionou um incremento no desenvolvimento de P. nigrispinus. Isto demonstra que esse predador pode apresentar maior crescimento populacional com plantas de eucalipto e pupas de T. molitor alimentado com apenas a presa (condições controladas. A planta pode fornecer nutrientes que aumentam o crescimento populacional e a eficiência de P. nigrispinus para o controle biológico em plantios de eucalipto.

  13. Toxicidade de natuneem sobre Tetranychus urticae Koch (Acari: Tetranychidae) e ácaros predadores da família Phytoseiidae Toxicity of the natuneem over the Tetranychus urticae Koch (Acari: Tetranychidae) and mites predators from the family Phytoseiidae


    Hilda Maria Brito; Manoel Guedes Corrêa Gondim Junior; José Vargas de Oliveira; Cláudio Augusto Gomes da Câmara


    A toxicidade de diferentes concentrações de Natuneem a Tetranychus urticae Koch e a dois ácaros predadores, Euseius alatus De Leon e Phytoseiulus macropilis (Banks), foi estudada. Foi avaliada a toxicidade sobre ovos, e o efeito residual e repelente, sobre adultos. O tratamento dos ovos consistiu na imersão em diluições de Natuneem por cinco segundos, e o efeito residual e repelente sobre adultos consistiu na imersão de discos de folhas de Canavalia ensiformes (L.) DC. também em diluições por...

  14. Ácaros predadores (Acari em plantas nativas e cultivadas do Estado do Rio Grande do Sul, Brasil Predators mites (Acari in native and cultivated plants of the State of Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Noeli Juarez Ferla


    Full Text Available This research was carried out in twenty counties of the following regions in the state of Rio Grande do Sul: Plain, Central Depression, Plateau and Coast Plain to find out the diversity of mite predators in these places. Forty-six vegetable species were sampled, thirty species of miles of the families Anystidae, Ascidae, Cheyletidae, Cunaxidae, Phyloseiidae and Stigmaeidae were mel. The Phytoseiidae were the mite that presented the greatest diversity, being present in the majority of the sample plants. Most of the Phytoseiidae that were met belong to five species of the Euseius Wainstein, 1962 genus, the second genus of this family was Iphiseiodes DeLeon, 1966, with just one species. The Stigmaeidae come up as second family in number but fewer than Phytoseiidae. In this family, the most common mite belong to the Agistemus Sumers, 1960 genus. The biggest of the mites species (13 species, was met in Morus spp. (Moraceae and Tabebuia spp. (Bignoniaceae; Phaseolus vulgaris (Papilionaceae; only one species of the mite was met in Campomanesia spp. (Myrtaceae, Phaseolus vulgaris (Papilionaceae and Rosa spp. (Rosaceae. In Alamanda spp.(Apocinaceae, Ficus spp. (Moraceae, Jacaranda mimosifolia (Bignoniaceae and Solanum spp. (Solanaceae were met mites predators. A dichotomic key is presented to separate the families, genus and species of the mites.

  15. Field and experimental data indicate that the eastern cottontail (Sylvilagus floridanus) is susceptible to infection with European brown hare syndrome (EBHS) virus and not with rabbit haemorrhagic disease (RHD) virus


    Lavazza, A.; P. Cavadini; I. Barbieri; P. Tizzani; A.C. Pinheiro; Abrantes, J.; Esteves, P.J.; G. Grilli; E. Gioia; Zanoni, M.; P. Meneguz; Guitton, J.; S. Merchandeau; M. Chiari; Capucci, L


    International audience The eastern cottontail (Sylvilagus floridanus) is an American lagomorph. In 1966, it was introduced to Italy, where it is currently widespread. Its ecological niche is similar to those of native rabbits and hares and increasing overlap in distribution brings these species into ever closer contact. Therefore, cottontails are at risk of infection with the two lagoviruses endemically present in Italy: Rabbit Haemorrhagic Disease virus (RHDV) and European Brown Hare Synd...

  16. Local feeding specialization of the red fox (Vulpes vulpes in response to eastern cottontail (Sylvilagus floridanus introduction (NW Italy

    Directory of Open Access Journals (Sweden)

    Alessandro Balestrieri


    Full Text Available Abstract To appreciate the influence of the introduction of the Eastern cottontail (Sylvilagus floridanus on the food habits of the red fox (Vulpes vulpes, between June 1998 and February 2000 fox diet was investigated by means of scat analysis (N=115 in a 250 ha wide Natural Reserve of NW Italy, and compared with data collected in the same area prior to cottontail colonization (1988-1989. Comparison included also the diet of badgers (Meles meles, considered as potential competitors for food resources. Alien lagomorphs (mean percent volume, Vm% = 68% represented by far the most exploited resource, only three other food items reaching values of mean percent volume barely higher than 5%. Cottontails frequency of occurrence did not vary according either to season or to their reproductive cycle (II-IX vs. X-I, whilst diet niche breadth varied inversely proportional to the use of this key-resource. Overall fox trophic niche breadth varied from 0.64 in 1988-89 to 0.31 in 1998-00 (B, Levin’s index. These findings led us to consider the feeding habits of the fox in the study area as a result of local specialization of a typical generalist carnivore, according to the predictions of optimal foraging theory. No variation occurred in the badger niche breadth since cottontail introduction, whilst niche overlap between foxes and badgers decreased from 0.59 to 0.13 (O, Pianka’s index, possibly reducing competition for food in summer. Riassunto Specializzazione alimentare a livello locale della Volpe Vulpes vulpes in risposta all’introduzione del Silvilago Sylvilagus floridanus (Italia nord occidentale. Per valutare gli effetti dell’introduzione del Silvilago (Sylvilagus floridanus sul comportamento alimentare della volpe (Vulpes vulpes, nel periodo giugno 1998-febbraio 2000, la dieta del carnivoro è stata definita tramite l’analisi di 115


    Ryan, S J; Gavard, E J; Cheeseman, A E; Cohen, J B; Whipps, C M


    From June 2014 to June 2015, capillary tube collections of blood were obtained concurrently with ear clips of trapped free-ranging, globally vulnerable New England cottontails (NEC; Sylvilagus transitionalis) and eastern cottontail rabbits (EC; Sylvilagus floridanus) in the Hudson Valley region of New York, United States. Species identification (NEC, EC) and sex (NEC) were determined genetically using a mitochondrial DNA assay and Y chromosome marker, respectively. Hematocrit values were obtained using a microhematocrit centrifuge. We provide the reference values 35.15-49.55 (2.5 and 97.5 percentiles) and 90% confidence intervals (CI) [lower: 33.00, 36.08; upper: 46.95, 51.00], for hematocrit of NEC. The mean hematocrit for NEC was 42.35% (SE = 0.58, n = 47) and a comparative contemporaneous mean in the same area for EC [39.96 (SE = 0.81, n = 26)], which was significantly different from NEC (P = 0.02). There was a significant sex difference for NEC [male: 43.99 (SE = 1.02, n = 28); female: 39.92 (SE = 0.78, n = 19), P < 0.0001], though not for EC. PMID:27468046

  18. In vitro host erythrocyte specificity and differential morphology of Babesia divergens and a zoonotic Babesia sp. from eastern cottontail rabbits (Sylvilagus floridanus). (United States)

    Spencer, Angela M; Goethert, Heidi K; Telford, Samuel R; Holman, Patricia J


    A Babesia sp. isolated from eastern cottontail rabbits (Sylvilagus floridanus) is morphologically similar and genetically identical, based on SSU rRNA gene comparisons, to 2 agents responsible for human babesiosis in the United States. This zoonotic agent is closely related to the European parasite, Babesia divergens. The 2 organisms were characterized by in vitro comparisons. In vitro growth of the rabbit Babesia sp. was supported in human and cottontail rabbit erythrocytes, but not in bovine cells. Babesia divergens was supported in vitro in bovine and human erythrocytes, but not in cottontail rabbit cells. Morphometric analysis classifies B. divergens as a small babesia in bovine erythrocytes, but the parasite exceeds this size in human erythrocytes. The rabbit Babesia sp. is large, the same size in both human or rabbit erythrocytes, and is significantly larger than B. divergens. Eight or more rabbit Babesia sp. parasites may occur within a single erythrocyte, sometimes in a floret array, unlike B. divergens. The erythrocyte specificity and morphological differences reported in this study agree with previous in vivo results and validate the use of in vitro methods for characterization of Babesia species. PMID:16729690

  19. Toxoplasmosis Silvestre: relación presa-predador y papel funcional de pequeños felinos silvestres neotropicales en la transmisión -resumen-

    Directory of Open Access Journals (Sweden)

    William A Cañón-Franco


    Full Text Available Pequeños felinos neotropicales se ubican en el tope de la cadena alimenticia y‚ aunque críticamente amenazados‚ ocho especies de felinos son relativamente abundantes en el continente americano‚ sin embargo‚ pocos estudios biológicos sobre la circulación de agentes infecciosos han sido realizados. Para determinar el papel epidemiológico que cumplen las poblaciones de felinos silvestres en la transmisión de la Toxoplasmosis en la región sur de Brasil (estado de Rio Grande do Sul‚ fue determinada la frecuencia molecular de Toxoplasma gondii. La amplificación del marcador ITS1 fue posible en 31 de los 90 felinos analizados (34‚4%‚ de las especies Puma yagouaroundi (9/22‚ Leopardus geoffroyi (6/22‚ Leopardus tigrinus (8/28‚ Leopardus wiedii (6/10‚ Leopardus pardalis (1/1 y Leopardus colocolo (1/7. Dos nuevos genotipos de T. gondii fueron caracterizados por PCR-RFLP (Lw#31Tn - Py#21Sm y el genotipo Py#56Br previamente descrito en gatos domésticos‚ perros y chigüiros del Brasil. Adicionalmente‚ fue parcialmente caracterizado el genotipo I (Py#36Sm‚ evidenciando la circulación ambiental y su posible relación en la presentación de toxoplasmosis ocular en humanos. Los resultados demuestran que pequeños felinos silvestres tienen un papel importante en la transmisión de la toxoplasmosis en la interfase animales domésticos-silvestres‚ por lo que no se descarta la posible hibridación con genotipos urbanos. La carnivoría y las relaciones presa-predador son fundamentales en la transmisión horizontal de Toxoplasma. Aunque existan variaciones biogeográficas y estacionales en la dieta de los felinos silvestres‚ aproximadamente 40% a 80%‚ corresponde a pequeños mamíferos no voladores (marsupiales y roedores. El estudio de la dinámica de transmisión en diferentes niveles tróficos es de gran interés para la comprensión ecológica del ciclo silvestre de este parásito. Esta propuesta se fundamenta en evaluar

  20. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Directory of Open Access Journals (Sweden)

    Rafael Braga da Silva


    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae? O percevejo Supputius cincticeps (Stål (Hemiptera, Pentatomidae é um predador encontrado em várias regiões brasileiras, que possui atributos desejáveis como agente de controle natural ou em

  1. Killer whales attack on South American sea lion associated with a fishing vessel: predator and prey tactics Ataque de orcas a un lobo marino sudamericano asociado a un barco pesquero: tácticas del predador y la presa

    Directory of Open Access Journals (Sweden)

    M. Florencia Grandi


    Full Text Available Interactions between killer whales and sea lions are widely known. This work describes the predator-prey behaviour of killer whales and South American sea lion associated with a trawling fishery. In Argentina the predatory behaviours of killer whales and anti-predatory behaviours of South American sea lions have been described from costal based observations, but predator-prey behaviour of these species is poorly known at open waters. Here we describe a killer whale group attack on an individual sea lion, using a video recorded from a trawling vessel and an interview of the ship captain. This predator-prey behaviour represents an example of the complexity of interactions between marine mammals and fisheries along the Patagonian coast.Las interacciones entre orcas y lobos marinos son ampliamente conocidas. Este trabajo describe el comportamiento predador-presa entre orcas y un lobo marino sudamericano asociados a un barco pesquero de arrastre. Particularmente en Argentina el comportamiento predatorio de las orcas y el anti-predatorio de los lobos marinos comunes fueron descriptos mediante observaciones costeras, pero se sabe poco sobre el comportamiento de estas especies en aguas abiertas. En este trabajo, a partir de un video grabado desde un barco de pesca arrastrero, junto con la entrevista del capitán del barco, se describe cómo un grupo de orcas ataca a un lobo marino Sudamericano. Este comportamiento predador-presa representa un ejemplo sobre la complejidad de las interacciones entre mamíferos marinos y las pesquerías a lo largo de la costa patagónica.

  2. Pathology and epizootiology of Dirofilaria scapiceps (Leidy, 1886) (Nematoda: Filarioidea) in Sylvilagus floridanus (J.A. Allen) and Lepus americanus erxleben. (United States)

    Bartlett, C M


    Dirofilaria scapiceps was found between the synovial sheath and tendons, i.e., within the tendon sheath, in the ankle region of eastern cottontail rabbits (Sylvilagus floridanus) and snowshoe hares (Lepus americanus). In cottontail rabbits, tendons and sheaths appeared normal and all worms were adults. Only one (4%) of 24 infected rabbits contained dead worms. All female worms were gravid in rabbits killed in late winter or early spring. Microfilaremias in rabbits were high (approximately 30-100 microfilariae/60 microliter blood) and of long duration (at least 8-28 mo), and rabbits were considered normal hosts of D. scapiceps. In some snowshoe hares, tendons and sheaths also appeared normal; however, in other hares a chronic proliferative tenosynovitis, characterized by fibrinous exudate, hyperplasia and hypertrophy of the intima and inflammatory cell (predominantly lymphocytes and plasma cells) infiltration of the intimal and fibrous layers of the synovial sheath led to encapsulation of worms. Dead subadult, dead adult, and live adult worms were found in the ankles of hares; 86 (46%) of 186 infected hares contained some or only dead worms. Fibrosis commonly occurred around dead worms. Dead subadults were also found in subcutaneous connective tissues over the trunk of the body. Degenerate embryos and amorphous material were observed in uteri of some female worms in hares killed in late winter or early spring. Few (1-5 microfilariae/60 microliter blood) or no microfilariae were observed in the peripheral blood of hares and microfilaremias were of short duration (less than 8 mo). Microfilariae in hares are probably trapped and destroyed in the chronic inflammatory lesions in the tendon sheaths since normal, degenerate, and calcified microfilariae were observed in the capsules around adult worms. Some microfilariae might also be destroyed in lymph nodes. Although D. scapiceps can be maintained within snowshoe hare populations, hares are considered abnormal hosts of D


    Directory of Open Access Journals (Sweden)

    Francisco Jorge Cividanes


    -style: normal; font-weight: normal; line-height: 120%; text-decoration: none;" lang="pt-BR" align="JUSTIFY">Com o objetivo de estudar a abundância e a diversidade de artrópodes predadores associados à cultura do algodoeiro e analisar a influência de fatores meteorológicos, interações entre inimigos naturais e a dinâmica populacional de coccinelídeos associados à sua principal presa, o pulgão Aphis gossypii, um experimento foi realizado na região de Ipameri (GO, no Campus da Universidade Estadual de Goiás. O delineamento experimental utilizado foi o de blocos ao acaso, com cinco tratamentos, constituídos pelas cultivares DeltaOPAL, FMX 966, FMX 993, FMX 910 e NuOPAL, em quatro repetições. Dentre os artrópodes observados na cultura do algodoeiro, os coccinelídeos e as aranhas foram os mais abundantes, nas cultivares avaliadas. As aranhas ocorreram em todo o ciclo do algodoeiro. Já os coccinelídeos aumentaram sua população, gradativamente, até 55 DAE, apresentando pico populacional aos 34 DAE, coincidindo com o pico populacional dos pulgões A. gossypii. Dentre os coccinelídeos observados nas cultivares em estudo, verificou-se que Scymnus spp. foi o gênero mais abundante no algodoeiro. Os pentatomídeos e forficulídeos predominaram dos 99 aos 128 dias após a emergência do algodão, período que corresponde à maior densidade de pragas-alvo destes insetos. Verificou-se que não houve influência dos fatores meteorológicos e nem interaçã

  4. Densità di Lepre (Lepus europaeus e Silvilago (Sylvilagus floridanus in ambienti planiziali

    Directory of Open Access Journals (Sweden)

    Sandro Bertolino


    Full Text Available Il silvilago (Sylvilagus floridanus è un leporide d?origine nordamericana, introdotto in Italia a partire dal 1966 a scopo venatorio. Attualmente la specie è diffusa soprattutto in Piemonte e nella parte occidentale della Lombardia. Il silvilago potrebbe interferire con l?autoctona lepre comune (Lepus europaeus, anche se i dati al riguardo sono limitati. Nell?autunno-inverno 2002-2003 abbiamo condotto dei censimenti notturni con faro in alcune aree protette lungo il fiume Po (Breme, Fontanetto Po, Pobietto e il torrente Orba (Predosa, Monferrino. I censimenti erano effettuati percorrendo con automezzo itinerari prefissati. Il territorio ai lati del percorso era illuminato con faro alogeno (100 W, segnando periodicamente l?ampiezza della fascia illuminata. L?area effettivamente censita è stata in seguito verificata mediante GIS ArcView, usando una cartografia informatizzata d?uso del suolo (1:10.000. L?uso reale del suolo al momento del censimento (esempio: arato, grano o stoppie è stato verificato durante sopralluoghi diurni. Per ogni area sono state condotte tre repliche del censimento. Di seguito sono riportate per ogni località le densità rilevate (individui/Km² rispettivamente di lepre comune e silvilago. Breme (1,7; 32,8, Fontanetto Po (0; 4,4, Pobietto (0,3; 13,9, Predosa (1,1; 19,5, Monferrino (29,6; 110,4. Solo l?area di Monferrino è risultata ospitare una popolazione di lepri con densità corrispondente a territori ad alta vocazionalità. La zona censita si trova a cavallo tra una riserva regionale e una ZRC della Provincia di Alessandria. Nella stessa area il silvilago presenta una densità elevata, ma comunque inferiore ai valori massimi riportati negli Stati Uniti. Nelle altre aree sono state osservate pochissime lepri. Tale scarsità è probabilmente legata alla presenza di popolazioni relitte e habitat non sempre idonei. Il silvilago, per quanto non abbondante come a Monferrino, è presente con popolazioni

  5. Toxicidade letal e subletal do nim sobre o pulgão-verde e seu predador Eriopis connexa Lethal and sublethal toxicity of neem on green peach aphid and on its predator Eriopis connexa

    Directory of Open Access Journals (Sweden)

    Madelaine Venzon


    Full Text Available O objetivo deste trabalho foi avaliar, em laboratório, os efeitos do extrato de semente de nim sobre uma praga da pimenteira, o pulgão-verde Myzus persicae (Sulzer, e seu predador Eriopis connexa (Germar. Folhas de pimenteira foram imersas em solução aquosa de extrato de semente de nim (1% de azadiractina a 0,5%, 1%, em acefato (0,75 g L-1 e em água. Fêmeas do pulgão foram transferidas para essas folhas e, após seis dias, avaliou-se a população final. Larvas de quarto ínstar do predador foram colocadas em plantas de pimenteira infestadas com pulgões e pulverizadas com solução aquosa de nim a 0,25 e, 0,5%, em acefato (0,75 g L-1 e em água. Após 48 horas, as larvas foram transferidas para tubos de plástico e alimentadas com pulgões. A mortalidade larval, a viabilidade pupal e a emergência de adultos foram avaliadas. A população de pulgões foi significativamente menor em folhas tratadas com nim e com acefato do que nas tratadas com água. A mortalidade de larvas do predador foi maior em plantas tratadas com acefato do que com nim. No entanto, somente 9,1 e 10% das larvas em plantas tratadas com nim a 0,25% e a 0,5%, respectivamente, formaram pupas e não houve emergência de adultos. Apesar do potencial do nim em reduzir a população de M. persicae, o produto apresenta efeitos nocivos a E. connexa.The aim of this work was to assess, in laboratory, the effects of neem seed extract on chilli pepper pest, the green peach aphid Myzus persicae (Sulzer and on its predator Eriopis connexa (Germar. Chilli pepper leaves were treated with an aqueous solution of neem seed extract (1% of azadiractin at concentrations of 0.5 and 1.0%, using acephate (0.75 g L-1 and water. Aphid females were transferred to treated leaves and after six days the aphid population was checked. Fourth-instar larvae of E. connexa were placed on pepper seedlings infested with aphids and sprayed with an aqueous solution of neem at 0.25 and 0.5%, using acephate (0

  6. Artrópodes fitófagos e predadores associados em 20 acessos Luffa sp. em sistema orgânico Phytophagous and predators arthropods associated in 20 accesses of Luffa sp in organic system

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available Os objetivos desta pesquisa foram verificar os artrópodes fitófagos e seus predadores em 20 acessos de bucha vegetal Luffa sp. (Cucurbitaceae, a distribuição destes no dossel das plantas em cultivo orgânico e a produção de frutos dos acessos. O experimento foi em blocos casualizados com 20 tratamentos e quatro repetições. Os tratamentos foram os acessos P159, P304, P466, P03, P570, P569, P467, P30, P446, P495, P125, P263, P644 e P32, provenientes da Embrapa (CENARGEN, DF, e P01, P02, P04, P05, P06 e P07, obtidos em Porteirinha-MG. As parcelas foram compostas por quatro plantas de Luffa sp. A maior abundância de Diabrotica speciosa (Germar (Coleoptera: Chrysomelidae foi observada nas folhas do acesso P467 em referência aos demais acessos de Luffa sp. Trigona spinipes (Fabricius (Hymenoptera: Apidae foi mais observada nas flores dos acessos P01, P03, P30, P32, P263 e P569 e menos abundantes nos acessos P05, P125, P159, P304, P446 e P570. Os acessos de Luffa sp. com maior número de frutos/planta foram P01, P03, P05, P06, P07, P30, P32, P125, P263, P446 e P570. Os predadores aranhas e Coccinellidae (Coleoptera bem como o fitófago Cicadellidae (Hemiptera preferiram atacar a face adaxial, sendo que não se detectou diferença estatística entre as faces para os demais artrópodes. T. spinipes esteve mais presente na parte apical do dossel das plantas. Com esses resultados, o acesso P06 é o mais indicado para o cultivo, pois foi um dos que apresentou maiores produtividades e menores taxas de ataque de insetos.The objectives of this research were to verify the phytophagous arthropods and their predators in 20 accesses of vegetable loofah Luffa sp. (Cucurbitaceae, the distribution of the canopy of the plants in organic system and the production of fruits of the accesses. The experiment was in randomized blocks designed with 20 treatments and four replicates. The treatments were the accesses P159, P304, P466, P03, P570, P569, P467, P30, P446

  7. Does predator benefits prey? Commensalism between Corynoneura Winnertz (Diptera, Chironomidae and Corydalus Latreille (Megaloptera, Corydalidae in Southeastern Brazil O predador beneficia sua presa? Comensalismo entre Corynoneura Winnertz (Diptera, Chironomidae e Corydalus Latreille (Megaloptera, Corydalidae no Sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Marcos Callisto


    retiradas do material regurgitado por Corydalus. É importante observar que fixados aos predadores de grande tamanho corporal as presas se tornam livres de outros predadores além de serem transportados por eles.

  8. Reproductive characteristics of the predator Podisus nigrispinus fed with an insect resistant soybean variety Características reprodutivas do predador Podisus nigrispinus alimentado com variedade de soja resistente a insetos

    Directory of Open Access Journals (Sweden)

    Fausto da Costa Matos Neto


    17, e lagartas de A. gemmatalis, criadas em folhas desta cultivar. Avaliou-se a longevidade das fêmeas, períodos de pré-oviposição, oviposição e pós-oviposição, número de ovos e de posturas/fêmea, peso dos ovos, intervalo entre posturas, número de ovos/postura, porcentagem de ovos eclodidos, número de ninfas/fêmea e número total de presas mortas/fêmea de P. nigrispinus. A maioria das características avaliadas mostrou resultados semelhantes entre tratamentos, exceto o período de oviposição, que foi mais longo para fêmeas criadas no genótipo resistente que no susceptível, e a porcentagem de fêmeas que ovipositaram antes de morrer, que foi menor na IAC 17. Além disso, o genótipo IAC 17 causou maior mortalidade de fêmeas de P. nigrispinus no início de sua fase adulta e distribuição mais uniforme da produção de ovos ao longo do período adulto desse predador. Por outro lado, os resultados não sugerem efeito desse genótipo na prole do predador.

  9. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae) e os predadores Phytoseiulus macropilis (Banks) e Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae) Effects of neem on tetranychus urticae Koch (Acari: Tetranychidae) and the predators Phytoseiulus macropilis (Banks) and Neoseiulus Californicus (Mcgregor) (Acari: phytoseiidae)


    Daniele Cristine Hoffmann Schlesener; Adriane Fonseca Duarte; Milton Fernando Cabezas Guerrero; Uemerson Silva da Cunha; Dori Edson Nava


    O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L) e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L) sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se...

  10. Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) within citrus orchards in Florida: species distribution, relative and seasonal abundance within trees, associated vines, and ground cover plants. (United States)

    Childers, Carl C; Ueckermann, Eduard A


    Seven citrus orchards on reduced- to no-pesticide spray programs were sampled for predacious mites in the families Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) in central and south central Florida. Inner and outer canopy leaves, fruit, twigs, and trunk scrapings were sampled monthly between August 1994 and January 1996. Open flowers were sampled in March from five of the sites. Two species of eupalopsellid mites (Exothorhis caudata Summers and Saniosulus harteni (van-Dis and Ueckermann)) were identified from 252 specimens collected within citrus tree canopies within the seven citrus orchards of which 249 were E. caudata. Only two E. caudata were collected from ground cover plants within five of the seven orchards. Eight species of Stigmaeidae were identified from 5,637 specimens: Agistemus floridanus Gonzalez, A. terminalis Gonzalez, Eustigmaeus arcuata (Chandhri), E. sp. near arcuata, E. segnis (Koch), Mediostigmaeus citri (Rakha and McCoy), Stigmaeus seminudus Wood, and Zetzellia languida Gonzalez were collected from within citrus tree canopies from seven orchard sites. Agistemus floridanus was the only species in either family that was abundant with 5,483 collected from within citrus tree canopies compared with only 39 from vine or ground cover plants. A total of 431 samples from one or more of 82 vines and ground cover plants were sampled monthly between September 1994 and January 1996 in five of these orchards and one or more eupalopsellids or stigmaeids were collected from 19 of these plants. Richardia brasiliensis (Meg.) Gomez had nine A. floridanus from 5 of 25 samples collected from this plant. Solanum sp. had five A. floridanus from three samples taken. Both eupalopsellid and stigmaeid species numbers represented orchards were on full herbicide programs and ground cover plants were absent. Agistemus floridanus was more abundant in the citrus orchards with on-going or recent herbicide programs compared with orchards having well-developed ground


    Directory of Open Access Journals (Sweden)

    Érico Amaral


    Full Text Available

    Esta nota prévia apresenta alguns dados bionômicos do predador de abelhas Apiomerus nigrilobus Stal, 1872 obtidos sob condições de laboratório. O estudo foi realizado no Departamento de Entomologia da Escola Superior de Agricultura “Luiz de Queiroz” da Universidade do Estado de São Paulo, no período de março de 1972 a dezembro de 1973. O ciclo biológico médico constatado para este predador foi de 246 dias. Os autores apresentam três quadros que resumem os dados obtidos.

    This preliminary note presents some bionomics data of the honeybee predator Apiomerus nigrilobus Stal, 1872 obtained in laboratory. The study was conducted at the Agricultural College ";Luiz de Queiroz” U.S.P. — São Pau1o, Brazil, from March 1972 to December 1973. The evolutionary cycle of this predator, on an average, is 246 days. A table is presented showing the results.

  12. Controle biológico do ácaro rajado com ácaros predadores fitoseídeos (Acari: Tetranychidae, Phytoseiidae em culturas de pepino e morango Biological control of the two-spotted spider mite (Acari: Tetranychidae, Phytoseiidae in cucumber and strawberry crops

    Directory of Open Access Journals (Sweden)

    M.A. Watanabe


    Full Text Available O ácaro rajado, Tetranychus urticae Koch, é considerado uma das principais pragas de hortaliças e várias outras culturas no Brasil, em áreas onde um considerável volume de acaricidas é anualmente empregado no seu controle. O objetivo deste trabalho foi testar a viabilidade técnica do emprego dos fitoseídeos Amblyseius idaeus (Denmark & Muma e Phytoseudus macropilis (Banks, comum ente encontrados no Brasil, no controle de T. urticae em pepino e morangueiro em Jaguaríúna,SP. Utilizou-se o delineamento experimental em blocos casualizados, com 4 repetições e 4 tratamentos (T1-T4 para o pepino e 5 tratamentos para o morangueiro (T1-T5: T1, testemunha; T2, pulverizações semanais de Malation para a exclusão de predadores nativos; T3, liberações periódicas de A.idaeus; T4, liberações periódicas de P.macropilis; T5, pulverizações semanais de avermectina para a exclusão de ácaros fitófagos e predadores nativos. Apenas A.idaeus se estabeleceu na cultura de pepino, reduzindo significativamente a população de T. urticae. Ambas espécies de predadores se estabeleceram na cultura do morango e reduziram significativamente a população de T.urticae.The two-spotted spider mite, Tetranychus urticae Koch, is considered one of the main pests of horticultural and other crops in Brazil, in areas where a considerable volume of acaricides is annually used for its control. The objective of this work was to test the technical viability of using phytoseiids Amblyseius idaeus (Denmark & Muma and Phytoseudus macropilis (Banks, commonly found in Brazil, to control T .urticae in cucumber and strawberry crops in Jaguaríúna,SP. A randomized complete block design was used, with 4 replicates and 4 treatments for cucumber (T1-T4 and 5 treatments for strawberry crops (T1-T5: T1, control; T2, weekly sprays of malathion for exclusion of native predators; T3, periodical releases of A.idaeus; T4, periodical releases of P. macropilis; T5, weekly sprays of

  13. Field and experimental data indicate that the eastern cottontail (Sylvilagus floridanus) is susceptible to infection with European brown hare syndrome (EBHS) virus and not with rabbit haemorrhagic disease (RHD) virus. (United States)

    Lavazza, Antonio; Cavadini, Patrizia; Barbieri, Ilaria; Tizzani, Paolo; Pinheiro, Ana; Abrantes, Joana; Esteves, Pedro J; Grilli, Guido; Gioia, Emanuela; Zanoni, Mariagrazia; Meneguz, Pier; Guitton, Jean-Sébastien; Marchandeau, Stéphane; Chiari, Mario; Capucci, Lorenzo


    The eastern cottontail (Sylvilagus floridanus) is an American lagomorph. In 1966, it was introduced to Italy, where it is currently widespread. Its ecological niche is similar to those of native rabbits and hares and increasing overlap in distribution brings these species into ever closer contact. Therefore, cottontails are at risk of infection with the two lagoviruses endemically present in Italy: Rabbit Haemorrhagic Disease virus (RHDV) and European Brown Hare Syndrome Virus (EBHSV). To verify the susceptibility of Sylvilagus to these viruses, we analyzed 471 sera and 108 individuals from cottontail populations in 9 provinces of north-central Italy from 1999 to 2012. In total, 15-20% of the cottontails tested seropositive for EBHSV; most titres were low, but some were as high as 1/1280. All the cottontails virologically tested for RHDV and EBHSV were negative with the exception of one individual found dead with hares during a natural EBHS outbreak in December 2009. The cottontail and the hares showed typical EBHS lesions, and the EBHSV strain identified was the same in both species (99.9% identity). To experimentally confirm the diagnosis, we performed two trials in which we infected cottontails with both EBHSV and RHDV. One out of four cottontails infected with EBHSV died of an EBHS-like disease, and the three surviving animals developed high EBHSV antibody titres. In contrast, neither mortality nor seroconversion was detected after infection with RHDV. Taken together, these results suggest that Sylvilagus is susceptible to EBHSV infection, which occasionally evolves to EBHS-like disease; the eastern cottontail could therefore be considered a "spill over" or "dead end" host for EBHSV unless further evidence is found to confirm that it plays an active role in the epidemiology of EBHSV. PMID:25828691

  14. Effect of plant diversification on abundance of South American tomato pinworm and predators in two cropping systems Efeito da diversificação de plantas na abundância da traça-do-tomateiro e predadores em dois sistemas de cultivo

    Directory of Open Access Journals (Sweden)

    Maria A Medeiros


    do tomate e de predadores. O experimento foi conduzido em condições de campo, no Distrito Federal, de julho a outubro de 2004. O desenho experimental foi em blocos ao acaso, com três repetições e no arranjo fatorial 3 x 2 [três níveis de diversificação cultural: tomate em monocultivo, tomate consorciado com coentro, e consórcio tomate com coentro e botão-de-ouro e dois sistemas de cultivo: orgânico e convencional]. Cada parcela experimental tinha 80 plantas de tomateiro, sendo os insetos-praga e artrópodes predadores semanalmente coletados em cinco plantas/parcela. Tuta absoluta (Meyr. foi a espécie-praga mais comum em ambos os sistemas de cultivo. O tomate consorciado como coentro e botão-de-ouro, no sistema de cultivo orgânico, apresentou menor abundância e maior diversidade de pragas, e maior abundância e diversidade de artrópodes predadores, principalmente aos 80 dias após o transplantio do tomate, coincidindo com o pico populacional da T. absoluta (ovos e adultos. Os predadores mais abundantes foram aranhas, joaninhas e formigas. As aranhas foram abundantes e uniformemente distribuídas em ambos os sistemas. As joaninhas apareceram tardiamente no sistema orgânico, no período de florescimento do coentro. As formigas foram mais abundantes no sistema convencional.

  15. Efeito de espécies vegetais em bordadura em cebola sobre a densidade populacional de tripes e sirfídeos predadores Effect of different species of border plants on the population density of thrips and syrphids predators in onion crop

    Directory of Open Access Journals (Sweden)

    Paulo Antonio de Souza Gonçalves


    Full Text Available Analisou-se a relação entre o efeito do plantio de diferentes espécies vegetais, em bordadura, na cultura da cebola, Allium cepa L, na incidência de Thrips tabaci Lind. e sirfídeos predadores, Toxomerus spp. O experimento foi conduzido na Epagri, EE de Ituporanga, de agosto a dezembro de 1998. Os tratamentos foram cebola em monocultivo; cebola + trigo mourisco (Fagopyrum esculentum Moench; cebola + nabo forrageiro (Raphanus sativus L. var. oleiferus Metzg.; cebola + cenoura (Daucus carota L., cv. Nantes e cv. Brasília; cebola + milho (Zea mays L.; cebola + rúcula (Eruca sativa L. + vegetação espontânea. O plantio de diferentes espécies vegetais em bordadura não provocou diferenças significativas na incidência de tripes e sirfídeos predadores. A produtividade comercial de bulbos de cebola foi similar em sistema de monocultivo e diversificado, sugerindo ser possível adotar tais sistemas sem perdas em rendimento.The effect of planting different species of border plants on the population density of thrips (Thrips tabaci Lind, and syrphid predators (Toxomerus spp., population density were evaluated at EPAGRI, Santa Catarina State, Brazil. The research was carried out from August to December 1998. The treatments were onion monoculture; onion intercropped with buck wheat (Fagopyrum esculentum Moench (Poligonaceae; onion intercropped with fodder radish (Raphanus sativus L. var. oleiferus Metzg.; onion intercropped with carrots (Daucus carota L. Nantes and Brasília cultivars; onion intercropped with maize (Zea mays L.; onion intercropped with Eruca sativa and weed. The onion thrips and syrphid predators population density were similar in onion monoculture and policulture. The yields were similar in onion monoculture and policulture, suggesting the possibility to intercrop onion without losses.

  16. Mortalidade do ácaro predador Neoseiulus californicus (Acari: Phytoseiidae em testes de toxicidade residual de inseticidas e acaricidas usuais em pomáceas Mortality of predatory mite Neoseiulus californicus (Acari: Phytoseiidae in residual toxicity persistence tests

    Directory of Open Access Journals (Sweden)

    Marcelo Gustavo Ruiz


    . Azimphos-methyl foi o produto que menos afetou a sobrevivência do ácaro predador. Os inseticidas testados, usados na região do "Alto Valle del Río Negro y Neuquén" para o controle de Cydia pomonella, praga-chave das culturas de pomáceas, apresentaram baixa toxicidade sobre N. californicus.Phytoseiid mites, mainly Neoseiulus californicus (McGregor, are important biological control agents of Tetranychidae pest mites in pip fruit crops in the region known as "Alto Valle del Río Negro y Neuquén", Argentina. We assessed the mortality of N. californicus when exposed to residues of the insecticides azimphos-methyl, carbaryl and cyfluthrin, as well as the acaricides cyhexatin and propargite. Pear plants were sprayed up to dip-point with pesticides in their recommended label concentrations. One, 3, 6 and 10 days after application (DAA, leaves were collected from treated plants and used to establish experimental arenas. Five adult laboratory-reared N. californicus specimens were transferred into each arena which contained Southern cattail pollen as food source. Experimental arenas were kept at 25 ± 2 ºC, 60 ± 10% RH and a photoperiod of 14 hours. Mite mortality was assessed 24 hours after the confinement. The completely randomized design was adopted for data statistical analysis, mortality means were compared by Dunnett's test (p < 0.05. Progression of pesticide's effect decline was submitted to regression analysis. On 1 and 3 DAA mean mortality in all of the treatments was significantly different from that of the water-treated control. On the sixth DAA, propargite, cyhexatin and cyfluthrin treatments caused about 30% mortality, while mortality levels in treatments with azimphos-methyl and carbaryl were statistically similar to that of control treatment. On the tenth DAA, mortality in none of the pesticide treatments differed from that of control. All of the pesticide treatments presented progressive decline throughout the experimental period, being significant (p < 0

  17. Efeito de doses e de refúgio sobre a seletividade de inseticidas a predadores e parasitóides de pragas de soja Effect of doses and of refuge on the insecticide selectivity to predators and parasitoids of soybean insect pests

    Directory of Open Access Journals (Sweden)

    Ivan Carlos Corso


    Full Text Available Com o objetivo de avaliar o impacto sazonal de alguns inseticidas sobre predadores e parasitóides de pragas da cultura da soja, instalou-se um experimento com delineamento de blocos ao acaso, constando de oito tratamentos e três repetições, no campo experimental da Embrapa-Centro Nacional de Pesquisa de Soja, em Londrina, PR. Os tratamentos consistiram de aplicações de inseticidas para o controle da lagarta-da-soja (pulverizados em 21/1/93 e percevejos (4/3/93. A técnica empregada para levantamento da população de insetos foi a do método do choque, que consiste na aplicação de um inseticida de alto impacto sobre a comunidade de insetos presente nas plantas, sua coleta sobre panos estendidos no solo, e sua posterior identificação e contagem em laboratório. A análise da variância revelou não haver diferenças significativas entre as populações de predadores, himenópteros e dípteros encontrados, nos diferentes tratamentos estudados. Também n��o foram verificados os fenômenos de ressurgência de pragas ou o aparecimento de elevadas populações de pragas secundárias.A field experiment was conducted to evaluate seasonal effect of insecticides on predators and parasitoids of soybean insect pests. A randomized block design was used, with three replications, and the experiment was set up in the experimental station of the Embrapa-Centro Nacional de Pesquisa de Soja, located at Londrina, PR, Brazil. Treatments consisted of insecticide application to control the velvetbean caterpillar (1/21/1993 or the stink bug complex (3/4/1993. Insect population was sampled through the shock technique, consisting of an application of a broad spectrum insecticide over the plants to be sampled, being the insects collected on cloths placed on the ground, and transferred to the laboratory to be identified and counted. Statistical analysis revealed no differences on the populations of species of predators, diptera or himenoptera as a group. No

  18. Funktionelle Analyse von Blochmannia floridanus, dem primären Endosymbionten der Rossameise Camponotus floridanus


    Stoll, Sascha


    Ameisen der Gattung Camponotus beherbergen bakterielle Symbionten der Gattung Blochmannia in spezialisierten Zellen des Mitteldarms (Blochmann, 1882; Buchner, 1965; Sauer, 2000; Schröder et al., 1996). Die Genomsequenzierung dieser Symbionten zeigte, dass Blochmannia, ähnlich den Symbionten von Blattläusen, hauptsächlich Gene der Aminosäurebiosynthese beibehalten hat (Degnan et al., 2005; Gil et al., 2003). Die Relevanz dieser nahrungsaufwertenden Funktion konnte experimentell bestätigt werde...

  19. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae e os predadores Phytoseiulus macropilis (Banks e Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae Effects of neem on tetranychus urticae Koch (Acari: Tetranychidae and the predators Phytoseiulus macropilis (Banks and Neoseiulus Californicus (Mcgregor (Acari: phytoseiidae

    Directory of Open Access Journals (Sweden)

    Daniele Cristine Hoffmann Schlesener


    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.The aim of the present study was to evaluate the efficiency of control and adverse effects of two neem based products: Azamax TM (Azadirachtin A/B 12g/L and Neemseto TM (Azadirachtin A/B, Nimbin and Salanin 2,389 g/L over two-spotted spider mite Tetranychus urticae and the predators Phytoseiulus macropilis and Neoseiulus californicus in laboratory. Effects over the mortality, fecundity, eggs and biological persistence of the two-spotted spider mite when treated with neem based products were evaluated. For the phytoseiids the effects on mortality and fecundity were evaluated. The maximum mortality of two-spotted spider mites rates observed were 89.7% and 91.5% for Azamax TM and Neemseto TM respectively, on the 0.5% concentration after reapplying the product on the seventh day. Adverse effects were also observed over the fecundity and viability of the eggs when treated with

  20. Seletividade de acaricidas e inseticidas a ácaros predadores (Acari: Phytoseiidae encontrados em seringueira no centro-oeste do Brasil Side-effect of acaricides and insecticides to predatory mites (Acari: Phytoseiidae found in rubber-trees in mid-west Brazil

    Directory of Open Access Journals (Sweden)

    Noeli Juarez Ferla


    Full Text Available Euseius concordis (Chant e Neoseiulus anonymus (Chant & Baker são ácaros predadores da família Phytoseiidae comumente encontrados em seringueira (Hevea brasiliensis Muell. Arg. em Mato Grosso, região centro-oeste do Brasil. Este trabalho foi realizado para verificar o efeito de acaricidas e inseticidas-acaricidas empregados em plantações de seringueira, e outros que teriam potencial para serem empregados contra insetos e ácaros considerados pragas dessa cultura, sobre E. concordis e N. anonymus. Utilizou-se o método residual de pulverização em superfície, recomendado como padrão pelo Grupo de Trabalho "Pesticidas e Artrópodes Benéficos", da Organização Internacional de Controle Biológico e Integrado de Plantas e Animais Nocivos/Seção Regional do Paleártico Oeste. Duas concentrações de cada um dos seguintes ingredientes ativos foram utilizadas: acefato, dicofol, endosulfan, formetanate, metomil, monocrotofós, óxido de fenbutatin e propargite. Uma das concentrações utilizadas foi uma média daquelas sugeridas pelos fabricantes para o controle de ácaros e insetos fitófagos presentes em outras culturas, uma vez que nenhum dos produtos testados tem registro para o uso em seringueira e a outra correspondeu à cerca de um terço da primeira. Endosulfan a 320ppm, dicofol a 100ppm e óxido de fenbutatin a 100 e 320ppm foram inócuos a E. concordis, enquanto que endosulfan a 320ppm e dicofol a 100ppm foram inócuos a N. anonymus. Acefato, formetanate e monocrotofós, nas concentrações testadas, foram nocivos às duas espécies.Euseius concordis (Chant and Neoseiulus anonymus (Chant & Baker are predatory mites of the family Phytoseiidae commonly found on rubber trees (Hevea brasiliensis Muell. Arg. in the State of Mato Grosso, in the mid-west Brazil. This work was conducted to verify the effect of acaricides and insecticides-acaricides occasionally used in rubber tree plantations, and other products that could be used against

  1. Composição faunística de insetos predadores em fragmento florestal e em área de hortaliças na região de Jaboticabal, Estado de São Paulo - DOI: 10.4025/actascibiolsci.v25i2.2015 Faunal composition of predator insects in forest fragment and area of vegetables in Jaboticabal region, state of São Paulo, Brazil - DOI: 10.4025/actascibiolsci.v25i2.2015

    Directory of Open Access Journals (Sweden)

    Luciano Kenji Sakemi


    Full Text Available Efetuou-se um levantamento populacional em área de fragmento florestal e em área de hortaliças, entre novembro de 1996 a fevereiro/1998, visando determinar as espécies de insetos predadores e a influência de fatores abióticos. A amostragem foi efetuada semanalmente por meio de armadilha luminosa, aplicando-se aos resultados análise faunística e correlação simples com temperatura, umidade relativa e precipitação. No fragmento florestal foi observado maior semelhança na abundância de espécies do que na área de hortaliças, mas neste hábitat capturou-se maior número de indivíduos (95%. As espécies Metius sp., Polpochila impressifrons (Dej., Eulissus sp. e Doru sp. foram predominantes nas duas áreas, evidenciando a importância dessas espécies como predadoras de pragas de hortaliças. Arthrostictus speciosus (Dej. e Leptotrachelus sp. predominaram no fragmento florestal, o mesmo ocorrendo com Paederus sp. na área de hortaliças. Esta espécie deve preferir locais abertos e quentes, enquanto A. speciosus e Leptotrachelus sp. podem estar melhor adaptadas para locais escuros e úmidos de florestasA population survey was carried out in a forest fragment and in an area of vegetables, from November/1996 to February/1998, aiming to determine the predator insect species and the influence of abiotic factors. The samples were taken weekly by light traps. The results were evaluated using faunistic analysis and simple correlation with temperature, relative humidity and rainfall. In the forest fragment higher similarity in the abundance of species was observed comparing to the area of vegetables, but the largest number of captured individuals (95% occurred in this last habitat. Metius sp., Polpochila impressifrons (Dej., Eulissus sp. and Doru sp. were predominant species in both areas, evidencing they may play an important role as pest predators in areas of vegetables. Arthrostictus speciosus (Dej. and Leptotrachelus sp. predominated in

  2. O olhar predador: A arte e a violência do olhar

    Directory of Open Access Journals (Sweden)

    Angélica Lima Cruz


    Full Text Available Na primeira parte deste ensaio é abordada a forma como a teoria feminista tem reflectido a prática artística, constituindo‑se como um contributo para o conhecimento sobre as relações entre artes visuais, sexualidades e poder. Depois de uma breve apresentação do tratamento do nu feminino e do corpo da mulher nos diversos movimentos artísticos ao longo da história da arte ocidental, é abordado o lugar, ou não lugar, que coube às mulheres na arte, nomeadamente na pintura.

  3. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria


    Fabrizio Silvano; Camilla Acquarone; Marco Cucco


    Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spr...

  4. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria

    Directory of Open Access Journals (Sweden)

    Fabrizio Silvano


    Full Text Available Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spring and in autumn along 51 transects which were 10 km long on average. Road deaths were extracted from our 6715 records regarding 85 species of mammals, birds and reptiles found dead along the roads. The distribution area expanded markedly from the 1980s, and the expansion persisted between 1996 and 1997, while in 1998 the area failed to increase further, settling at around 620-660 km². The species is not present, at the moment, in the entire Apennine sector nor in the eastern and southern plains. The densities reach maximum values of 2.5-2.75 individuals/10 ha. From the road-death data we found a progressive increase of the Eastern cottontail, its proportion of the total mammals rising from 2.2% in 1995 to 3.7% in 1996 and 6.0% in 1997.

  5. Observações sobre a ocorrência de Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae na costa do Rio de Janeiro, Brasil Remarks about the Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae occurrence in Rio de Janeiro coast, Brazil

    Directory of Open Access Journals (Sweden)

    Lydia M. S. Oliveira


    Full Text Available Os espécimes foram coletados na Baía de Sepetiba, Rio de Janeiro no inverno. Sua distribuição era conhecida para Off Cape Lookout, Carolina do Norte até a Flórida, Golfo do México, Canal de Yucatan, Honduras, Antilhas, Venezuela e Brasil (Alagoas, Sergipe e Bahia.The specimens were collected in Sepetiba Bay during the winter. Their distribution was formerly known from Off Cape Lookout, North Carolina until Florida, Gulf of Mexico, Yucatan Channel, Honduras, Antilles, Venezuela and Brazil (Alagoas, Sergipe and Bahia.

  6. Tick infestations of the eastern cottontail rabbit (Sylvilagus floridanus) and small rodentia in northwest Alabama and implications for disease transmission. (United States)

    Cooney, Joseph C; Burgdorfer, Willy; Painter, Martin K; Russell, Cynthia L


    Studies were conducted over a four-county area of northwest Alabama to determine the association of eastern cottontail rabbits with Dermacentor variabilis, the eastern United States vector of Rocky Mountain spotted fever. A secondary objective was to compare infestations of this tick on rabbits with infestations on commonly encountered rodent species as a means of determining the relative importance of each in the disease transmission cycle. These epidemiologic surveys were conducted in response to reported fatal cases of Rocky Mountain Spotted Fever in two counties of the study area. From 202 eastern cottontail rabbits, 3,956 ticks were collected. Of this total, 79.87% were Haemphysalis leporispalustris, 9.15% Amblyomma americanum, 8.22% Ixodes dentatus, and 2.76% D. variabilis. Only immature stages of D. variabilis were collected from cottontail rabbits. Ticks were collected on rabbits in all months except November, and only one specimen was taken in January. Based on the average number of ticks per host collected in each month, April was the peak month for D. variabilis and I. dentatus. High values for H. leporispalustris also occurred at this time, but even higher values occurred in October and December. The heaviest infestation of A. americanum occurred during the month ofAugust and coincides with the activity period for the larvae of this species. Two hundred sixty-nine of the smaller Rodentia, comprising 13 species, yielded 264 ticks, all D. variabilis, and all but two were immature stages. Five rodent species, Microtus ochragaster Orozomys palustris, Peromyscus gossypinus, Peromyscus leucopus, and Sigmodon hispidus accounted for 95.83% of the ticks collected, and appeared to be preferred hosts for D. variabilis; all five had higher infestation levels per host than did the eastern cottontail rabbit. Data on host relationships in association with seasonal activity are presented. PMID:16599149

  7. 77 FR 71759 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition To List the Prairie... (United States)


    ... cottontail (Sylvilagus floridanus mearnsi) in Illinois and western Indiana as endangered or threatened... (Sylvilagus floridanus mearnsi) in Illinois and western Indiana be listed as endangered or threatened species..., small mammals, including eastern cottontail (Sylvilagus floridanus), voles (Microtus pennsylvanicus...

  8. Seletividade de agrotóxicos utilizados em pomares de pêssego a adultos do predador Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Rodolfo Vargas Castilhos


    Full Text Available A seletividade de dezesseis agrotóxicos utilizados na produção integrada e convencional de pêssego foi avaliada sobre a fase adulta de Chrysoperla externa através de bioensaios de exposição residual conduzidos em laboratório (temperatura de 25±1ºC, umidade relativa 70±10% e fotofase 14 horas, utilizando-se de metodologia prescrita pela "International Organization for Biological Control" (IOBC. Os agrotóxicos (% de ingrediente ativo na calda azoxystrobina (0,016, captana (0,192, dodina (0,126, folpete (0,200, mancozebe (0,256, mancozebe + oxicloreto de cobre (0,140 + 0,096, tebuconazole (0,320, abamectina (0,002, óleo mineral 1 (2,420, óleo mineral 2 (1,920, dicloreto de paraquate (0,300 e glifosato (1,440 foram inócuos; deltametrina (0,002 foi levemente nocivo e dimetoato (0,160, fosmete (0,160 e malationa (0,240 foram nocivos a adultos de C. externa.

  9. Estudio comparado de la alimentación entre algunos predadores de alto nivel trófico de la comunidad marina del norte y centro de patagonia


    Koen Alonso, M.


    The comparative analysis of the food habits between top predator allows the evaluation of how these species use the trophic resources. They also make possible the study of potentially competitive relationships and the role of these predators in the regulation and structure of the community. The marine community of northern and central Patagonia is structured on the tri-trophic system composed by the Argentine anchovy (Engraulis anchoita), the Argentine shortfin squid (Illex argent...

  10. Seletividade de inseticidas a três Vespidae predadores de Dione juno juno (Lepidoptera: Heliconidae) Selectivity of insecticides to three Vespidae predators of Dione juno juno (Lepidoptera: Heliconidae)




    Dentre os insetos que atacam o maracujazeiro, Dione juno juno (Lepidoptera: Heliconidae) é considerada a praga-chave. Estudou-se a seletividade dos inseticidas fentiom, cartape, malatiom e deltametrina a Dione juno juno, em relação às vespas predadoras Polybia fastidiosuscula, Polybia scutellaris e Protonectarina sylveirae (Hymenoptera: Vespidae). Estimaram-se as curvas concentração-mortalidade e mediante o uso da concentração letal do inseticida em 90% dos indivíduos (CL90) calcularam-se os ...

  11. Seletividade de inseticidas a três Vespidae predadores de Dione juno juno (Lepidoptera: Heliconidae Selectivity of insecticides to three Vespidae predators of Dione juno juno (Lepidoptera: Heliconidae

    Directory of Open Access Journals (Sweden)



    Full Text Available Dentre os insetos que atacam o maracujazeiro, Dione juno juno (Lepidoptera: Heliconidae é considerada a praga-chave. Estudou-se a seletividade dos inseticidas fentiom, cartape, malatiom e deltametrina a Dione juno juno, em relação às vespas predadoras Polybia fastidiosuscula, Polybia scutellaris e Protonectarina sylveirae (Hymenoptera: Vespidae. Estimaram-se as curvas concentração-mortalidade e mediante o uso da concentração letal do inseticida em 90% dos indivíduos (CL90 calcularam-se os índices de seletividade diferencial e índices de tolerância. A deltametrina foi seletiva à P. scutellaris e P. fastidiosuscula e medianamente seletiva à P. sylveirae e o cartape foi medianamente seletivo às três espécies de vespas predadoras. O malatiom foi seletivo a P. sylveirae e medianamente seletivo a P. fastidiosuscula. As vespas predadoras P. fastidiosuscula eP. scutellaris foram mais tolerantes a deltametrina e ao fentiom do que P. sylveirae, enquanto o P. fastidiosuscula e P. sylveirae toleraram mais o cartape do que P. scutellaris. O malatiom foi mais tolerado pela espécie P. sylveirae do que por P. fastidiosuscula e P. scutellaris.Among insects that attack passion fruit, Dione juno juno (Lepidoptera: Heliconidae is considered the most dangerous plague. The selectivity of the insecticides fenthion, cartap, malathion and deltamethrin to the predatory wasps Polybia fastidiosuscula, Polybia scutellaris and Protonectarina sylveirae (Hymenoptera: Vespidae was studied based on these insecticide toxicities to their prey Dione juno juno. Concentration-mortality regression lines were obtained and the estimated lethal concentration of insecticide to 90% (LC90 of the individuals were used for the calculation of the differential selectivity index and tolerance index. Deltamethrin was selective in favor of P. scutellaris and P. fastidiosuscula and showed intermediate selectivity to P. sylveirae, while cartap showed intermediate selectivity to all three species of predatory wasps. Malathion was selectivite to P. sylveirae and showed intermediate selectivity to P. fastidiosuscula. The predatory wasps P. sylveirae and P. fastidiosuscula were more tolerant to cartap than P. scutellaris and P. sylveirae was more tolerant to malathion than P. fastidiosuscula and P. scutellaris.

  12. Biología y comportamiento de polistes erythrocephalus ltr. (hyrnenoptera: vespidae), predador del "gusano cachón" de la yuca erinnyis ello l. (lepidoptera: sphingidae)


    Martin P., Carlos A.; Bellotti, Anthony C.


    El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7°) tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m) depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar). No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con e...

  13. Biología y comportamiento de Polistes erythrocephalus Ltr. (Hyrnenoptera: vespidae), predador del "Gusano cachón" de la yuca Erinnyis ello L. (Lepidoptera: Sphingidae)


    Bellotti Anthony C.; Martin P. Carlos A.


    El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7°) tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m) depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar). No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con el ...

  14. Biología y comportamiento de Polistes erythrocephalus Ltr. (Hyrnenoptera: vespidae, predador del "Gusano cachón" de la yuca Erinnyis ello L. (Lepidoptera: Sphingidae

    Directory of Open Access Journals (Sweden)

    Bellotti Anthony C.


    Full Text Available El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7° tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar. No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con el crecimiento del nido llegando a ser casi igual al de las hembras. De 412 nidos el17 % estaban parasitados por Oxysarcodexia sp., (Diptera: Sacophagidae siendo el enemigo natural más frecuente de larvas y pupas de Polistes. Este insecto es a su vez parasitado por los himenópteros Pachyneuron sp. (Pteromalidae y Brachymeria conica Ashmead (Chalcididae.The duration average of the cycle life of P. erythrocephalus (Iatitude 3°30'N, longitude 76°22'21"W; 965 altitude; 23.7°C was 110 days and ranged between91 and 131 days. Predatory capacity depends on the number of larva. The maximum number of larva consumed by one Polistes larva per day was 1.3 and the minimum was 0.08 with a mean of 0.5 hornworm larva (11 y III instar. Males were not found in nests with less than 50 cells. In nests with more than 50 cells the number of males increase with increasing number of cells until they equal the number of female. Of the 412 nests examined, 17 % were attached by Oxysarcodexia sp [(Diptera: sarcophaqidae. This insect is in turn parasitized by several hymenoptera such as Pachyneuron sp (Pteromalidae y Brachymeria conica (Chalcididea.

  15. Toxoplasmosis Silvestre: relación presa-predador y papel funcional de pequeños felinos silvestres neotropicales en la transmisión -resumen-


    William A Cañón-Franco; N López-Orozco; A F Malheiros; M Santos-Filho; Gennari, S.M.


    Pequeños felinos neotropicales se ubican en el tope de la cadena alimenticia y‚ aunque críticamente amenazados‚ ocho especies de felinos son relativamente abundantes en el continente americano‚ sin embargo‚ pocos estudios biológicos sobre la circulación de agentes infecciosos han sido realizados. Para determinar el papel epidemiológico que cumplen las poblaciones de felinos silvestres en la transmisión de la Toxoplasmosis en la región sur de Brasil (estado de Rio Grande do Sul)‚ fue determina...

  16. Modernidade seletiva e estado predador: primeira aproximação às revoltas populares em maputo de 2008 e 2010

    Directory of Open Access Journals (Sweden)

    Héctor Guerra Hernández


    Full Text Available Nos dias 5 de fevereiro de 2008 e 1 e 2 de setembro de 2010 Maputo foi o cenário de duas revoltas populares de grandes proporções, cada uma delas motivadas pelo descontentamento generalizado da população frente a reajustes econômicos, impostos pelo governo, que aumentariam significativamente o custo da vida dos maputenses. Essa situação mobilizou tanto a elite política como intelectual a desenvolver apressadamente algumas hipóteses que pudessem explicar esses eventos. Neste texto pretende-se contrastar essas hipóteses para, em seguida, propor uma análise que possibilite um entendimento mais abrangente a respeito das causas que teriam levado à população a sair às ruas. Parte-se da constatação que o estado seria o produto histórico de violentos conflitos, cujas sequelas podem ser percebidas no receio e desconfiança que a população teria desenvolvido, e a partir da qual o estado seria percebido menos como um facilitador e mais como um concorrente invasivo e predatório.

  17. Field study of the relationship between skin-sensitizing antibody production in the cottontail rabbit, Sylvilagus floridanus, and infestation by the rabbit tick, Haemaphysalis leporispalustris (Acri: Ixodidae). (United States)

    McGowan, M J; Camin, J H; McNew, R W


    The resistance of cottontail rabbits to tick feeding appears correlated with the rabbits' development of skin-sensitizing antibodies. Resistance appeared to be greatest in adult rabbits which had been repeatedly infested with ticks. Rabbits with little exposure to ticks, usually the young cottontails, showed little or no skin-sensitizing antibody present in their blood and usually had relatively high tick loads when compared with adult rabbits. Models used to interpret the data show promise as tools for predicting tick population fluctuations and, perhaps, incidence of vector borne disease outbreaks. The existence of resistance to tick attachment has important implications for the host-parasite relationship. The research lends support to the hypothesis that the resistance may function as a homeostatic regulatory mechanism capable of maintaining the size of the tick population in equilibrium with the size of the rabbit population. In this way, host resistance may be advantageous to the parasite as well as to the host. PMID:512764

  18. Aplicação de formulação do fungo predador de nematóides Monacrosporium thaumasium (Drechsler, 1937 no controle de nematóides de bovinos

    Directory of Open Access Journals (Sweden)

    Alves P.H.


    Full Text Available A viabilidade de uma formulação do fungo Monacrosporium thaumasium (Drechsler, 1937 foi avaliada no controle biológico de nematóides parasitos gastrintestinais de bovinos. Dois grupos de sete bezerras cada, mestiças Holandês ´ Zebu, de quatro a seis meses de idade, foram colocados em pastagens de Cynodon dactilon. No grupo A, cada animal recebeu 20g de pellets (formulação granulada de M. thaumasium via oral, duas vezes por semana, durante quatro meses, com início na estação chuvosa (outubro, 2001. No grupo B (controle, as bezerras não receberam nenhum tratamento. As contagens de ovos por grama de fezes (OPG e das larvas infectantes encontradas na pastagem do grupo B foram significativamente maiores (P<0,05 do que as do grupo A e a diferença entre o OPG dos animais dos grupos A e B, no final do experimento, foi de 88,8%. O gênero Cooperia foi o mais prevalente em ambas as pastagens. Conclui-se que a aplicação de pellets de M. thaumasium na dosagem e periodicidade de aplicação usadas foi eficiente no controle de nematóides parasitos gastrintestinais de bovinos.

  19. Control of bovine gastrointestinal nematode parasites using pellets of the nematode-trapping fungus Monacrosporium thaumasium Controle de nematóides parasitos gastrintestinais de bovinos com pellets do fungo predador de nematóides Monacrosporium thaumasium

    Directory of Open Access Journals (Sweden)

    Jackson Victor de Araújo


    Full Text Available The viability of a formulation of the fungus Monacrosporium thaumasium associated with ivermectin was evaluated for the biological control of bovine gastrointestinal nematode parasites. Four groups of five calves each were placed in pastures with a stocking rate of 1.6 animal/hectare. In group 1 (control, the calves did not receive any treatment. In group 2, each animal received 20g of pellets of M. thaumasium orally twice a week during a six-month period that began with the onset of the rainy season (October 23, 2000. In group 3, each animal received 20g of pellets of M. thaumasium orally twice a week during the same period as 2, as well as two strategic treatments with ivermectin (200 mcg/kg on May 10, 2001 and July 5, 2001. In group 4, the animals were treated with ivermectin alone as described for group 3. EPG counts for group 1 were significantly greater (PA viabilidade de uma formulação do fungo Monacrosporium thaumasium associada com ivermectina foi avaliada no controle biológico de nematóides parasitos gastrintestinais de bovinos. Quatro grupos de cinco bezerros foram colocados em pastagens com uma taxa de lotação de 1,6 animal/hectare. No grupo 1 (controle, os bezerros não receberam nenhum tratamento. No grupo 2, cada animal recebeu 20 g de pellets de M. thaumasium, via oral, duas vezes por semana e durante um período de seis meses que começou na estação chuvosa (23 de outubro, 2000. No grupo 3, cada animal recebeu 20g de pellets de M. thaumasium, via oral, duas vezes por semana e durante o mesmo período do grupo 2, assim como dois tratamentos estratégicos com ivermectina (200 mcg/kg em 10 de maio de 2001 e em 5 de julho de 2001. No grupo 4, os animais foram tratados somente com ivermectina como descrito no grupo 3. As contagens de OPG dos animais do grupo 1 foram significativamente maiores (P< 0,01 do que os animais dos grupos 2 e 3 e a diferença no final do experimento foi próxima de 100%. Os OPGs dos animais do grupo 4 permaneceram altos até o primeiro tratamento estratégico com ivermectina. Os resultados do grupo 1 e 4 diferiram significativamente (P< 0,05 daqueles dos grupos 2 e 3 a partir de dezembro de 2000. Concluiu-se que a aplicação de pellets de M. thaumasium nesta dosagem e periodicidade de aplicação tornaram os tratamentos anti-helmínticos desnecessários.

  20. Seletividade de agrotóxicos utilizados em pomares de pêssego a adultos do predador Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae Selectivity of pesticides used in peach orchard on adults of Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Rodolfo Vargas Castilhos


    Full Text Available A seletividade de dezesseis agrotóxicos utilizados na produção integrada e convencional de pêssego foi avaliada sobre a fase adulta de Chrysoperla externa através de bioensaios de exposição residual conduzidos em laboratório (temperatura de 25±1ºC, umidade relativa 70±10% e fotofase 14 horas, utilizando-se de metodologia prescrita pela "International Organization for Biological Control" (IOBC. Os agrotóxicos (% de ingrediente ativo na calda azoxystrobina (0,016, captana (0,192, dodina (0,126, folpete (0,200, mancozebe (0,256, mancozebe + oxicloreto de cobre (0,140 + 0,096, tebuconazole (0,320, abamectina (0,002, óleo mineral 1 (2,420, óleo mineral 2 (1,920, dicloreto de paraquate (0,300 e glifosato (1,440 foram inócuos; deltametrina (0,002 foi levemente nocivo e dimetoato (0,160, fosmete (0,160 e malationa (0,240 foram nocivos a adultos de C. externa.The selectivity of sixteen pesticides used in integrated and conventional peach production was evaluated on adults of Chrysoperla externa (Hagen,1861 (Neuroptera: Chrysopidae under bioassays in laboratory conditions (temperature of 25±1ºC, relative humidity 70±10% and 14 hours photophase, using the "International Organization for Biological Control" (IOBC methodology. The pesticides (% active ingredient azoxystrobin (0.016, captan (0.192, dodine (0.126, pholpet (0.200, mancozeb (0.256, mancozeb + cooper oxichloride (0.140 + 0.096, tebuconazole (0.320, abamectin (0.002, mineral oil 1 (2.420, mineral oil 2 (1.920, paraquat dichloride (0.300 and gliphosate (1.440 were harmless; deltametrin (0.002 was slightly harmful and dimetoate (0.160, phosmet (0.160 and malathion (0.240, were harmful to C. externa adults.

  1. Effect of doses and of refuge on the insecticide selectivity to predators and parasitoids of soybean insect pests; Efeito de doses e de refugio sobre a seletividade de inseticidas a predadores e parasitoides de pragas de soja

    Energy Technology Data Exchange (ETDEWEB)

    Corso, Ivan Carlos; Gazzoni, Decio Luiz; Nery, Manoel Eugenio [EMBRAPA, Londrina, PR (Brazil). Centro Nacional de Pesquisa de Soja]. E-mail:


    A field experiment was conducted to evaluate seasonal effect of insecticides on predators and parasitoids of soybean insect pests. A randomized block design was used, with three replications, and the experiment was set up in the experimental station of the EMBRAPA-Centro Nacional de Pesquisa de Soja, located at Londrina, PR, Brazil. Treatments consisted of insecticide application to control the velvet bean caterpillar (1/21/1993) or the stink bug complex (3/4/1993). Insect population was sampled through the shock technique, consisting of an application of a broad spectrum insecticide over the plants to be sampled, being the insects collected on cloths placed on the ground, and transferred to the laboratory to be identified and counted. Statistical analysis revealed no differences on the populations of species of predators, diptera or himenoptera as a group. No effects of pest resurgence or secondary pest outbreaks were also observed. (author)

  2. Does predator benefits prey? Commensalism between Corynoneura Winnertz (Diptera, Chironomidae) and Corydalus Latreille (Megaloptera, Corydalidae) in Southeastern Brazil O predador beneficia sua presa? Comensalismo entre Corynoneura Winnertz (Diptera, Chironomidae) e Corydalus Latreille (Megaloptera, Corydalidae) no Sudeste do Brasil


    Marcos Callisto; Michael D.C. Goulart; Pablo Moreno; Martins, Rogério P.


    Commensalism between Corydalus Latreille, 1802 (Megaloptera, Corydalidae) and Corynoneura Winnertz, 1846 (Diptera, Chironomidae, Orthocladiinae) larvae was recorded in Indaiá stream, at 1,380 m a.s.l. (Parque Nacional da Serra do Cipó, 19º-20ºS, 43º-44ºW) and in the headwaters of São Francisco river, at 1,300-1,700 m a.s.l. (Parque Nacional da Serra da Canastra, 20º00'-20º30'S, 46º15'-47º00'W), in Minas Gerais state, Brazil. Seventy eight Corydalus larvae (range 22-88 mm) were sampled: 61 in ...

  3. In vitro evaluation of nematophagous fungi patogenicity against nematode of domestic animals/
    Avaliação in vitro da patogenicidade de fungos predadores de nematóides parasitos de animais domésticos


    Alvimar José da Costa; Giane Serafim da Silva; Regina Célia Cândido; Jaime Maia dos Santos; Arlete Silveira Maia; Érika Barbosa Neves Graminha


    Biological control is a promising alternative for the control of pre-parasitic stages through the action of nematophagous fungi’s. The present study evaluated in vitro the patogenicity of both Arthrobotrys musiformis and A. conoides fungi on “infective larvae (or L3 state larvae)” of Haemonchus contortus, L3 larvae of Ancylostoma spp. And larvated eggs of the nematode Ascaridia galli. Nine groups were formed: six treated groups (G1A and G2A: L3 of H. contortus; G1B and G2B: L3 of Ancylostoma ...

  4. In vitro evaluation of nematophagous fungi patogenicity against nematode of domestic animals/ Avaliação in vitro da patogenicidade de fungos predadores de nematóides parasitos de animais domésticos

    Directory of Open Access Journals (Sweden)

    Alvimar José da Costa


    Full Text Available Biological control is a promising alternative for the control of pre-parasitic stages through the action of nematophagous fungi’s. The present study evaluated in vitro the patogenicity of both Arthrobotrys musiformis and A. conoides fungi on “infective larvae (or L3 state larvae” of Haemonchus contortus, L3 larvae of Ancylostoma spp. And larvated eggs of the nematode Ascaridia galli. Nine groups were formed: six treated groups (G1A and G2A: L3 of H. contortus; G1B and G2B: L3 of Ancylostoma spp.; G1C and G2C: larvated eggs of A. galli, being that G1 with A. musiformis and G2 with A. conoides and three untreated groups (G3A, G3B and G3C: larvae of H. contortus, Ancylostoma spp. And eggs of A. galli, respectively, without fungi. Each treatment had ten repetitions (ten Petri dishes with an average of 120 larvae of H. contortus and 200 larvae of Ancylostoma spp. and, approximately, 100 larvated A. galli eggs. The results showed A. musiformis plundered 66% and 94% of Ancylostoma spp. L3 larvae and H. contortus L3 larvae, respectively. While that A. conoides plundered 51,7% and 89,4% at the same larvae. The nematophagous fungi evaluated have not presented any predation type on A. galli larvated eggs. Afterwards, both are promising fungi as to their use for biological control of parasitic helminths of animal hosts.O controle biológico é uma alternativa promissora no controle dos estágios pré-parasitários de helmintos, por meio da ação de fungos nematófagos. Com este propósito, o presente estudo avaliou in vitro a patogenicidade dos fungos Arthrobotrys musiformis e A. conoides sobre larvas infectantes de Haemonchus contortus, Ancylostoma spp. e ovos larvados de Ascaridia galli. Foram utilizados nove grupos: seis tratamentos (G1A e G2A: L3 de H. contortus; G1B e G2B: L3 de Ancylostoma spp.; G1C e G2C: ovos larvados de A. galli, com A. musiformis (G1 e A. conoides (G2, respectivamente e três testemunhos (G3A, G3B e G3C: larvas de H. contortus, Ancylostoma spp. e ovos de A. galli, respectivamente, na ausência do fungo. Cada tratamento constou de dez repetições (placas de Petri, de 90mm de diâmetro, com média de 120 larvas de H. contortus, 200 larvas de Ancylostoma spp. e média de 100 ovos de A. galli. Os resultados demostraram que A. musiformis predou 66,33% e 94,44% das larvas infectantes de Ancylostoma spp. e H. contortus, respectivamente. Enquanto que A. conoides predou 51,76% e 89,39% das mesmas larvas. Os fungos nematófagos avaliados não apresentaram predação sobre ovos larvados de A. galli. Portanto, ambos os fungos mostraram-se promissores quanto a sua utilização no biocontrole desses helmintos parasitos de animais domésticos.

  5. Influence of the webbing produced by Oligonychus ilicis (McGregor) (Acari: Tetranychidae) on associated predatory phytoseiids; Influencia da teia de Oligonychus ilicis (McGregor) (Acari: Tetranychidae) sobre os fitoseideos predadores associados

    Energy Technology Data Exchange (ETDEWEB)

    Franco, Renato A. [Bioagri Laboratorios Ltda., Piracicaba, SP (Brazil)], e-mail:; Reis, Paulo R. [Empresa de Pesquisa Agropecuaria de Minas Gerais (EPAMIG), Belo Horizonte, MG (Brazil). Ecocentro], e-mail:; Zacarias, Mauricio S. [EMBRAPA Cafe, Lavras, MG (Brazil)], e-mail:; Oliveira, Daniel C. [Universidade Federal de Lavras (UFLA), MG (Brazil)


    Oligonychus ilicis (McGregor) is among those mite species that can cause damage to coffee plants (Coffea spp.). Species of Phytoseiidae acari are considered the most important and studied predatory mites. The objective of this study was to evaluate the effects of the webbing produced by O. ilicis on its predation by females of the phytoseiids Iphiseiodes zuluagai Denmark and Muma, Euseius citrifolius Denmark and Muma and Amblyseius herbicolus (Chant). Four bioassays were conducted, with three treatments and ten replicates. Each replicate consisted of 25 O. ilicis per experimental unit (a leaf disc of Coffea arabica) according to the tested developmental stage, in independent experiments. To spin the web, 15 adult females were put on each experimental unit for 24h; females were then removed, leaving only the web, and predators and prey to be tested were introduced. Predation was assessed after 24h. In the presence of webbing, the consumption of eggs, larvae and nymphs by I. zuluagai and eggs and larvae by E. citrifolius was lower. For A. herbicolus, egg predation was lower, but larval predation did not vary significantly and predation of nymphs and adults was higher in the presence of webbing. Predators as a whole were more efficient consuming larvae regardless of the presence of webbing. Considering the stages of O. ilicis altogether, webbing reduced the predation potential of I. zuluagai and E. citrifolius, but not of A. herbicolus. (author)

  6. Seletividade de alguns agrotóxicos em uso na citricultura ao ácaro predador Neoseiulus californicus (McGregor (Acari: Phytoseiidae Residual toxicity of the main pesticides recommended in citrus orchards on predaceous mite Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available Objetivou-se avaliar o efeito dos principais agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor, em condições de laboratório, por tratar-se de um fitoseídeo com grande potencialidade para ser utilizado no controle dos ácaros fitófagos na cultura. O método de bioensaio adotado foi o de contato direto e residual. Folhas de citros da variedade Pêra, contendo 25 fêmeas adultas de N. californicus procedentes de uma criação-estoque, foram pulverizadas em torre de Potter. Avaliaram-se a mortalidade do ácaro 72 horas após a aplicação e o efeito dos produtos na viabilidade dos ovos. Quanto à seletividade, conforme proposta da "Organização Internacional para o Controle Biológico e Integrado de Plantas e Animais Nocivos" (IOBC, os produtos foram classificados como: classe 1 inócuo (E99%, clorfenapyr, dicofol e pyridaben. N. californicus mostrou-se tolerante a diversos agrotóxicos, o que viabiliza sua utilização, juntamente com produtos químicos pertencentes a grupamentos distintos e de diferentes mecanismos de ação, o que atende a um manejo adequado de controle dos principais ácaros fitófagos da cultura dos citros.This work was carried out to determine the residual toxicity of the main pesticides used in citrus, on Neoseiulus californicus (McGregor under laboratory conditions. For this, it was used the residual contact bioassay. Citrus leaves of the variety "Pêra" were sprayed in a Potter tower. The residual action was evaluated at 2 hours and 1; 3; 5; 7; 10; 14 e 21 days after treatment. Ten adult females of N. californicus were transferred to each ring, together with an enough amount of Tetranychus urticae nymphs and adults to feed the predator. Mortality evaluations were performed at 72 hours after treatment. Bioassays indicate that the pesticides: acrinathrin, deltamethrin, dinocap, sulphur, fenpropathrin, fenbutatin oxide and propargite were innocuous to N. californicus. On the other hand, abamectin, azocyclotin e cyhexatin caused mortalities of 29.8; 32.0 e 34.1%, respectively, two hours after transference. Dicofol, pyridaben and chlorfenapyr were extremely toxic to the predator mite, causing 100% of mortality two hours after the application. This way, to this population of N. californicus, the releases can be performed safely 3 days after the application, except for cyhexatin (5 days, dicofol and pyridaben (14 days and chlorfenapyr (21 days, without risk of significant adult mortality rates due to the application of pesticides.

  7. Seletividade de alguns agrotóxicos em uso na citricultura ao ácaro predador Neoseiulus californicus (McGregor) (Acari: Phytoseiidae) Residual toxicity of the main pesticides recommended in citrus orchards on predaceous mite Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae)


    Marcos Zatti da Silva; Carlos Amadeu Leite de Oliveira


    Objetivou-se avaliar o efeito dos principais agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor), em condições de laboratório, por tratar-se de um fitoseídeo com grande potencialidade para ser utilizado no controle dos ácaros fitófagos na cultura. O método de bioensaio adotado foi o de contato direto e residual. Folhas de citros da variedade Pêra, contendo 25 fêmeas adultas de N. californicus procedentes de uma criação-estoque, foram pulverizadas em torre de Potter. Aval...

  8. Controle biológico do ácaro rajado com ácaros predadores fitoseídeos (Acari: Tetranychidae, Phytoseiidae) em culturas de pepino e morango Biological control of the two-spotted spider mite (Acari: Tetranychidae, Phytoseiidae) in cucumber and strawberry crops


    Watanabe, M. A.; G.J. de Moraes; I. Gastaldo Jr.; Nicolella, G


    O ácaro rajado, Tetranychus urticae Koch, é considerado uma das principais pragas de hortaliças e várias outras culturas no Brasil, em áreas onde um considerável volume de acaricidas é anualmente empregado no seu controle. O objetivo deste trabalho foi testar a viabilidade técnica do emprego dos fitoseídeos Amblyseius idaeus (Denmark & Muma) e Phytoseudus macropilis (Banks), comum ente encontrados no Brasil, no controle de T. urticae em pepino e morangueiro em Jaguaríúna,SP. Utilizou-se o del...

  9. Redescription, synonymy, and new records of Vexillata noviberiae (Dikmans, 1935) (Nematoda: Trichostrongylina), a parasite of rabbits Sylvilagus spp. (Leporidae) in the United States. (United States)

    Digiani, María Celina; Kinsella, John M; Kass, Thomas B; Durette-Desset, Marie-Claude


    Vexillata noviberiae (Dikmans, 1935) (Trichostrongylina: Heligmosomoidea), originally described as a parasite of Sylvilagus floridanus from Louisiana, is redescribed from material collected from Sylvilagus palustris in Florida and from S. floridanus in Kansas. New morphometric and morphological data are provided. Stunkardionema halla Arnold, 1941, described from S. floridanus from Kansas and New York, is proposed as a junior synonym of V. noviberiae. These findings confirm the occurrence of V. noviberiae as a parasite of rabbits and its wide distribution range in North America. PMID:17918368

  10. ClEST cluster :Cl_singleton0472 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_singleton0472 oxidative stress -induced growth inhibitor 1 Cimex lectularius nuclear gene 476 ... CCGATTACCACAAGATATGGCAGATGATGA fb22084 1 Oxidative stress -induced growth inhibitor 1 [Camponotus floridanus] ...

  11. Attack behavior of Podisus rostralis (Heteroptera: Pentatomidade adults on caterpillars of Bombyx mori (Lepidoptera: Bombycidae

    Directory of Open Access Journals (Sweden)

    Walkymário Paulo Lemos


    Full Text Available Attack behavior of the predator Podisus rostralis (Stäl (Heteroptera: Pentatomidae adults on fourth instar Bombyx mori L. (Lepidoptera: Bombycidae caterpillars was studied in laboratory conditions. Ten 24 hours old adults of this predator were observed during two hours with the following attack behavior: (1 Predator: prey finding; prey observation; touching prey with antenna; attack behavior; prey paralysis; predator retreat after attack; attack cessation; successive attacks; and (2 Prey: defense. The predator P. rostralis found its prey before attacking and it approached it with slow circular movements. The attack was usually made in the posterior part of the prey to reduce defense reaction. Larger size of prey in relation to the predator resulted difficult prey paralysis but it occurred in less than two hours.Estudou-se, em laboratório, o comportamento de ataque de adultos do predador Podisus rostralis (Stäl (Heteroptera: Pentatomidae tendo como presa lagartas de quarto estádio de Bombyx mori L. (Lepidoptera: Bombycidae. Dez adultos do predador, com 24 horas de idade, foram observados durante duas horas acompanhando-se os seguintes comportamentos de ataque: (1 Predador: localização da presa; observação da presa; toque das presas com as antenas; comportamento de ataque; paralisação da presa; fuga do predador após ataque; finalização do ataque; ataques sucessivos; e (2 Presa: defesa. O predador P. rostralis localizou sua presa antes do ataque, aproximando-se dela através de lentos movimentos circulares. O ataque é, usualmente, realizado na parte posterior da presa para reduzir reação de defesa. O maior tamanho da presa em relação ao predador pode dificultar a paralisação, porém o predador consegue paralisá-la em menos de duas horas.

  12. Selección del lugar de nidificación por el Alimoche (Neophron percnopterus en Navarra.

    Directory of Open Access Journals (Sweden)



    los rigores climáticos y a los mamíferos predadores. Se seleccionan activamente roquedos y emplazamientos de nidos orientados hacia el sur, evitando la incidencia de los vientos húmedos y fríos que provienen del norte y noroeste.

  13. Varroose


    Pires, Sância


    A abelha melífera ocidental, como todos os seres vivos, em todas as fases do seu desenvolvimento, está sujeita ao ataque de vários inimigos (predadores, parasitas e agentes patogénicos vários) que agem, directa ou indirectamente, perturbando a vida da colónia de várias formas.

  14. Sarcocystis leporum in cottontail rabbits and its transmission to carnivores. (United States)

    Fayer, R; Kradel, D


    Muscle from Sarcocystis-infected cottontail rabbits (Sylvilagus floridanus) was fed to coccidia-free cats (Felis domestica) and dogs (Canis familiaris). Only cats became infected and shed sporocysts in their feces. The prepatent period ranged from 10 to 25 days and the patent period from 3 to 46 days. Sporocysts were fully sporulated when shed. They contained 4 sporozoites and a coarse granular residuum and averaged 9.4 by 13.6 micron (N=55). Doses of 200-75,000 sporocysts were orally administered to 5 domestic rabbits (Oryctolagus cuniculus). Domestic rabbits did not become infected, suggesting a strict host specificity for the intermediate host S. floridanus. PMID:405509

  15. A Century of Shope Papillomavirus in Museum Rabbit Specimens


    Clara Escudero Duch; Williams, Richard A. J.; Timm, Robert M.; Javier Perez-Tris; Laura Benitez


    Sylvilagus floridanus Papillomavirus (SfPV) causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus) from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, an...

  16. Transmission of Sarcocystis leporum from a cottontail rabbit to domestic cats. (United States)

    Crum, J M; Prestwood, A K


    Muscle tissue containing grossly visible cysts of Sarcocystis leporum from a cottontail rabbit (Sylvilagus floridanus) was fed to laboratory cats. Sporocysts averaging 13.2 x 9.7 micron were detected in the feces 14 days post-infection and were found until 69 days post-infection. PMID:405510

  17. ClEST cluster :Cl_contig0419 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_contig0419 vacuolar atp synthase ... subunit e ... Cime x le ctularius nucle ar ge ne ... 450 GGGCACTCGCAGTTA ... ACC fs20066 fw20016 2 Vacuolar proton pump subunit E ... [Camponotus floridanus] E FN63114 2.4E -37 GO:004277 ...

  18. Zoophytophagy in predatory Hemiptera

    Directory of Open Access Journals (Sweden)

    Jorge Braz Torres


    Full Text Available Predaceous hemipteran feeding on different trophic levels have raised questions about their ecology and role in biological control. Therefore, specific adaptations allowing them to simultaneously use plants and animals as sources for their nutritional requirements are important. Enzymatic variability in predatory hemipterans has been suggested as the basic adaptation for convergent or divergent to omnivory. Thus, the salivary enzymatic complexes of predatory hemipterans have been furnished a partial understanding of the mechanisms permitting switching between plant and animal food sources. In this study, a discriminatory analysis was performed to attribute trophic habits to each insect investigated based on the presence and absence of salivary enzyme combinations. Although peptidase is found in all tested predatory hemipterans' salivary glands, it is not a distinguishing enzyme because it has been found in phytophagous species as well. However, the presence of peptidase and amylase activity in hemipteran salivary glands is considered to be an explanation for these insects' ability to switch their diet, predators feeding on plants (amylase and herbivores taking prey (peptidase.Percevejos predadores alimentando em diferentes níveis tróficos tem despertado o interesse para o entendimento da ecologia e papéis exercido no controle biológico por esses predadores. Os parâmetros que governam o comportamento alimentar onívoro desses predadores tem sido auxiliado pelos estudos sobre enzimas de glândula salivares. A variabilidade de enzimas em percevejos predadores tem sido sugerido como adaptação básica para a convergência ou divergência para a onivoria. Assim, enzimas salivares de percevejos predadores tem fornecido entendimento, ao menos parcial, da alternância de alimentação entre plantas e animais. Neste estudo, foi utilizado a presença de enzimas como variáveis canônicas para atribuir a cada espécie estudada predominância do

  19. Predation risk versus pesticide exposure: effects of fear and loathing on aquatic invertebrates


    Pestana, João Luís Teixeira


    Os organismos aquáticos apresentam respostas plásticas à presença de predadores que são induzidas por pistas químicas presentes na água. Estas respostas além de minimizar os efeitos de predação, têm também custos associados que podem incluir alterações na tolerância às variações ambientais tais como contaminação por pesticidas. Os efeitos dos pesticidas em sistemas naturais resultam assim da toxicidade mas também do efeito nas interacções predador-presa. Apesar de extremamente relevante...

  20. Seletividade fisiológica de inseticidas aos inimigos naturais de Plutella xylostella (L.) (Lepidoptera: Plutellidae) em brássicas Insecticide physiological selectivity to natural enemies of Plutella xylostella (L.) (Lepidoptera: Plutellidae) in Brassicae


    Leandro Bacci; Marcelo Coutinho Picanço; Ézio Marques da Silva; Júlio Cláudio Martins; Mateus Chediak; Maria Elisa Sena


    A conservação de inimigos naturais é um componente fundamental no manejo integrado de pragas. Neste trabalho, estudou-se a seletividade de sete inseticidas usados no manejo de Plutella xylostella (L.) (Lepidoptera: Plutellidae) ao parasitóide Oomyzus sokolowskii (Kurdjumov) (Hymenoptera: Eulophidae) e aos predadores Discodon sp. (Coleoptera: Cantharidae) e Lasiochilus sp. (Hemiptera: Anthocoridae). Os organofosforados metamidofós e paratiom metílico e o carbamato carbaril foram altamente tóxi...

  1. Fatores que afetam artrópodes associados a cinco acessos de ginseng-brasileiro (Pfaffia glomerata) em Montes Claros, Estado de Minas Gerais = Factors affecting arthropods associated with five accessions of Brazilian ginseng (Pfaffia glomerata) in Montes Claros, Brazil


    Germano Leão Demolin Leite; Mayra Pimenta; Péricles Leonardo Fernandes; Ronnie Von Santos Veloso; Ernane Ronnie Martins


    O objetivo deste trabalho foi identificar artrópodes associados a cinco acessos ('NDS', 'COVB', 'NAT', 'ROST' e 'GSD1') de Pfaffia glomerata, bem como o efeito de clima, dossel, face foliar, tricomas e inimigos naturais sobre a entomofauna. Dos artrópodes observados, Aphis gossypii (Hemiptera: Aphididae), Diabrotica speciosa (Coleoptera: Chrysomelidae) e Tetranychus ludeni (Acari: Tetranychidae) apresentaram maior densidade populacional. Dos inimigos naturais observados, ácaros predadores est...

  2. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species. (United States)

    Ferreira, Ana M; Marques, Andreia T; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Araújo, Susana S; Almeida, André M


    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of O. cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in R. diazi and S. floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification. PMID:27092177

  3. Identification of a bitter-taste receptor gene repertoire in different Lagomorphs species

    Directory of Open Access Journals (Sweden)

    Ana M. Ferreira


    Full Text Available The repertoires of bitter taste receptor (T2R gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, Lepus europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi and Sylvilagus floridanus, using Oryctolagus cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of Oryctolagus cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in Romerolagus diazi and Sylvilagus floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification.

  4. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species (United States)

    Ferreira, Ana M.; Marques, Andreia T.; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Araújo, Susana S.; Almeida, André M.


    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of O. cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in R. diazi and S. floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification. PMID:27092177

  5. Hematologic comparisons of shot and live trapped cottontail rabbits. (United States)

    Jacobson, H A; Kirkpatrick, R L; Burkhart, H E; Davis, J W


    Comparisons were made between hematologic measurements of shot and box-trapped cottontail rabbits (Sylvilagus floridanus). Trapped rabbits had significantly (P less than 0.001) higher serum corticoid levels and segmented neutrophil percentages and significantly (P less than 0.001) lower lymphocyte percentages than did shot rabbits. Trapped rabbits also had significantly (P less than 0.05) higher packed cell volumes and blood urea nitrogen values than did shot rabbits. PMID:633520

  6. Density and habitat requirements of sympatric hares and cottontails in northern Italy


    Anna Vidus Rosin; Alessandro Montagna; Alberto Meriggi; Sara Serrano Perez


    Abstract From 2005 to 2009, densities and habitat selection by the European hare (Lepus europaeus) and Eastern cottontail (Sylvilagus floridanus) were assessed during feeding activity in an intensively cultivated area in northern Italy. Hare average density (74 ind./km2) was comparable to the highest values reported for European farming areas. Preand post-breeding density fluctuated widely across the...

  7. [Presence in France of a selvatic Xenopsylla: X. cunicularis Smit, 1957 (Siphonaptera, Pulicidae), a parasite of wild rabbits]. (United States)

    Beaucournu, J C; Launay, H


    The authors point out, for the first time in France, a selvatic Xenopsylla: X. cunicularis Smit, 1957, parasite on the European rabbit, well-known in Morocco and Spain until today. The paleogeographical, ecological, and epidemiological interest of this parasite is laid stress on. The other fleas linked to the European rabbit are evoked, and the acclimatization of Euphoplopsyllus glacialis affinis (Baker, 1904), in France and Italy, introduced with its host Sylvilagus? floridanus is related. PMID:580913

  8. Genome structure of cottontail rabbit herpesvirus.


    Cebrian, J; Berthelot, N; Laithier, M


    The genome structure of a herpesvirus isolated from primary cultures of kidney cells from the cottontail rabbit Sylvilagus floridanus was elucidated by using electron microscopy and restriction enzyme analysis. The genome, which was about 150 kilobase pairs long and which had an average G + C composition of 45%, consisted of two regions with unique base sequences (54 and 47 kilobase pairs) enclosed by reiterations of a 925-base-pair sequence with a variable copy number. The internal repeats w...

  9. Cortisol and aldosterone comparisons of cottontail rabbits collected by shooting, trapping, and falconry. (United States)

    Hamilton, G D; Weeks, H P


    Cortisol and aldosterone levels were measured in plasma of eastern cottontail rabbits (Sylvilagus floridanus) collected by three different methods, i.e., shooting, live-trapping and falconry. Cortisol levels ranged from near 0 to 27.5 micrograms/100 ml and aldosterone from near 0 to 220 ng/100 ml. Shot animals had significantly lower cortisol concentrations than those taken by either of the other methods. Trapped cottontails also had significantly lower aldosterone levels. PMID:3981742

  10. Circular Herpesvirus sylvilagus DNA in spleen cells of experimentally infected cottontail rabbits.


    Medveczky, P; Kramp, W J; Sullivan, J L


    Cottontail rabbits (Sylvilagus floridanus) were infected with Herpesvirus sylvilagus, and spleen cells were analyzed for the presence of virus-specific, covalently closed circular, and linear DNA molecules by a simple electrophoretic technique, followed by transfer to nitrocellulose filters and hybridization with cloned viral DNA (Gardella et al., J. Virol. 50:248-254, 1984). Approximately 0.2 copies per cell of circular DNA and 0.2 copies per cell of linear DNA were detected by hybridization...

  11. Identification of a bitter-taste receptor gene repertoire in different Lagomorphs species


    Ana M Ferreira; Marques, Andreia T.; Luca eFontanesi; Carl-Gustaf eThulin; Elvira eSales-Baptista; Susana S. Araújo; Almeida, André M.


    The repertoires of bitter taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, Lepus europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi and Sylvilagus floridanus, using Oryctolagus cuniculus cuniculus as control species for PCR and D...

  12. Modelling the habitat requirements of invasive Eastern Cottontail () introduced to Italy


    Bertolino, Sandro; Ingegno, Barbara; Girardello, Marco


    Abstract We analysed the spatial distribution of Eastern Cottontail (Sylvilagus floridanus) and its relationship with the habitat attributes of the agro-ecosystems in north-western Italy. We used generalised linear models to analyse the relationship between the occurrence of the cottontail and a series of landscape-level variables. Hierarchical partitioning was used to estimate the independent contribution of these variables. Our analysis showed that cottontail is typically a lowla...



    Magnarelli, Louis A.; Norris, Steven J; Fikrig, Erol


    Archived serum samples, from 95 eastern cottontail rabbits (Sylvilagus floridanus) captured in New York, New York, USA and Millbrook, New York, USA, during 1985–86, were analyzed in solid-phase enzyme-linked immunosorbent assays (ELISA) for total and class-specific immunoglobulin (Ig) M antibodies to whole-cell or recombinant antigens of Borrelia burgdorferi sensu stricto. Using a polyvalent conjugate, rabbit sera contained antibodies to whole-cell and recombinant antigens (protein [p]35, p37...

  14. Herpesvirus sylvilagus infects both B and T lymphocytes in vivo.


    Kramp, W J; Medveczky, P; Mulder, C; Hinze, H C; Sullivan, J L


    Herpesvirus sylvilagus infection of cottontail rabbits (Sylvilagus floridanus) was studied as a model of herpesvirus-induced lymphoproliferative disorders. Leukocytosis, splenomegaly, proliferation of T cells and virus production by lymphocytes characterized this infectious mononucleosis-like disease. Approximately two copies of circular herpesvirus sylvilagus genomes per cell were detected in spleen cells at 2 weeks postinfection, and circular genomes could still be observed after 4 months. ...

  15. Occurrence of Escherichia coli in Wild Cottontail Rabbits. (United States)

    Kozlowski, R; Glantz, P J; Anthony, R G


    Free-ranging cottontail rabbits (Sylvilagus floridanus) from two areas in central Pennsylvania were sampled over a 4-year period. Large numbers of coliforms were isolated from the intestinal tracts of these animals; in 136 of the 141 rabbits sampled, Escherichia coli was found to be a major component of the alimentary flora. Four serogroups (O7, O77, O73, and O103) were predominant among the isolates and were considered resistant coliflora of this species of cottontail rabbit. PMID:16345208

  16. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species


    Ana M Ferreira; Marques, Andreia T.; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Susana S. Araújo; Almeida, André M.


    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequenci...

  17. Pathogenesis of Herpesvirus sylvilagus infection in cottontail rabbits.


    Hesselton, R. M.; Yang, W.C.; Medveczky, P; Sullivan, J L


    Experimental infection with Herpesvirus sylvilagus produces clinical and histopathologic changes in its natural host, the cottontail rabbit (Sylvilagus floridanus), similar to those observed in humans acutely infected with Epstein-Barr virus (EBV). Twenty-seven seronegative cottontail rabbits were infected with Herpesvirus sylvilagus and all developed antibodies within 10 days. Neutralizing antibody was detected as early as 7 days after infection. Virus was isolated from blood mononuclear cel...

  18. First Isolation and Cultivation of Borrelia burgdorferi Sensu Lato from Missouri


    Oliver, J H; Kollars, T. M.; Chandler, F W; James, A. M.; Masters, E. J.; Lane, R S; Huey, L. O.


    Five Borrelia burgdorferi sensu lato isolates from Missouri are described. This represents the first report and characterization of such isolates from that state. The isolates were obtained from either Ixodes dentatus or Amblyomma americanum ticks that had been feeding on cottontail rabbits (Sylvilagus floridanus) from a farm in Bollinger County, Mo., where a human case of Lyme disease had been reported. All isolates were screened immunologically by indirect immunofluorescence by using monocl...

  19. Serological prevalence of tularemia in cottontail rabbits of southern Illinois. (United States)

    Lepitzki, D A; Woolf, A; Cooper, M


    Sera of cottontail rabbits (Sylvilagus floridanus) collected in southern Illinois in 1983 and 1984 were screened for the presence of antibodies against Francisella tularensis by rapid slide agglutination and enzyme linked immunosorbent assay techniques; 6% of 118 and 16% of 119 samples were positive by these methods, respectively. Rabbits gained, lost and maintained titers over at least an 8 mo period. Francisella tularensis tularensis was isolated from one serologically negative, clinically healthy rabbit. PMID:2338733

  20. Associations of passerine birds, rabbits, and ticks with Borrelia miyamotoi and Borrelia andersonii in Michigan, U.S.A.


    Hamer Sarah A; Hickling Graham J; Keith Rich; Sidge Jennifer L; Walker Edward D; Tsao Jean I


    Abstract Background Wild birds contribute to maintenance and dissemination of vectors and microbes, including those that impact human, domestic animal, and wildlife health. Here we elucidate roles of wild passerine birds, eastern cottontail rabbits (Sylvilagus floridanus), and Ixodes dentatus ticks in enzootic cycles of two spirochetes, Borrelia miyamotoi and B. andersonii in a region of Michigan where the zoonotic pathogen B. burgdorferi co-circulates. Methods Over a four-year period, wild b...

  1. Discovery of Defense- and Neuropeptides in Social Ants by Genome-Mining


    Gruber, Christian W.; Markus Muttenthaler


    Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant), Camponotus floridanus (carpenter ant) and Harpegnathos saltator (basal genus). Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulato...

  2. Unprecedented loss of ammonia assimilation capability in a urease-encoding bacterial mutualist

    Directory of Open Access Journals (Sweden)

    Wernegreen Jennifer J


    Full Text Available Abstract Background Blochmannia are obligately intracellular bacterial mutualists of ants of the tribe Camponotini. Blochmannia perform key nutritional functions for the host, including synthesis of several essential amino acids. We used Illumina technology to sequence the genome of Blochmannia associated with Camponotus vafer. Results Although Blochmannia vafer retains many nutritional functions, it is missing glutamine synthetase (glnA, a component of the nitrogen recycling pathway encoded by the previously sequenced B. floridanus and B. pennsylvanicus. With the exception of Ureaplasma, B. vafer is the only sequenced bacterium to date that encodes urease but lacks the ability to assimilate ammonia into glutamine or glutamate. Loss of glnA occurred in a deletion hotspot near the putative replication origin. Overall, compared to the likely gene set of their common ancestor, 31 genes are missing or eroded in B. vafer, compared to 28 in B. floridanus and four in B. pennsylvanicus. Three genes (queA, visC and yggS show convergent loss or erosion, suggesting relaxed selection for their functions. Eight B. vafer genes contain frameshifts in homopolymeric tracts that may be corrected by transcriptional slippage. Two of these encode DNA replication proteins: dnaX, which we infer is also frameshifted in B. floridanus, and dnaG. Conclusions Comparing the B. vafer genome with B. pennsylvanicus and B. floridanus refines the core genes shared within the mutualist group, thereby clarifying functions required across ant host species. This third genome also allows us to track gene loss and erosion in a phylogenetic context to more fully understand processes of genome reduction.

  3. Dicty_cDB: Contig-U09392-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nititkpirpietrvpiklttq pqstnpktvpptttttteatttatkpipnktpqpintfkpsdkgasledscinaanqmsn isgneqlgtigkeleayanaikigdkkqi...iv*miiimikrreny*riyklklnhqfmkf*in*i qlilysnlkmqlnnikql*ln*miqlmfqq*pmiiqnklmnifqnyqiynqii*yhy*nn kv*mkkn...ame B: vkn**lvnh*kklkl*hln*llhqiiv*miiimikrreny*riyklklnhqfmkf*in*i qlilysnlkmqlnnikql*ln*miqlmfqq*pmiiqnklmnifqnyqiynqi...00_FPR375... 36 8e-05 22 ( AP009351 ) Staphylococcus aureus subsp. aureus str. Newman....008 12 ( BX248583 ) Blochmannia floridanus complete genome. 38 0.009 20 ( AE014841 ) Plasmodium falciparum

  4. Dicty_cDB: CHN406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pealtninsekniklfsesnilspvelesrqeilfeiynks ikieanslydlvstlvlpacfahqkniaesvnsimpfiqsqksfsqpnhqyshlsevves vnllieanq...hsikslkih*fnmfvlfsmvmvi vvigknspnlev*qiyhrlqrl*qiltlkrilnsflkvifshqlnwnhvkrfslkfiinq lkskqtlymi*fqlwyfqlvllikrillnl*tl*chsfkvknlsvnqi..., *** SEQUENCING IN PROGRESS ***, 10 unordered pieces. 40 0.29 7 BX248584 |BX248584.1 Blochmannia floridanus...kllalikqtkdfnsehslatflnqsvipqmnevrkfsdhlexivedkflas sk Frame C: xnpnrfs**thcffsifllltylfffkkkkkkkkkkcqiexenllnilivenqlkqi...NA Score E Sequences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 ma

  5. Arrangement of repetitive sequences in the genome of herpesvirus Sylvilagus.


    Medveczky, M M; Geck, P; Clarke, C; Byrnes, J; Sullivan, J L; Medveczky, P G


    Herpesvirus sylvilagus is a lymphotropic (type gamma) herpesvirus of cottontail rabbits (Sylvilagus floridanus). Analysis of virion DNA of herpesvirus sylvilagus has revealed that the genome consists of one stretch of about 120 kilobase pairs of internal, unique DNA flanked by a variable number of 553-base-pair tandem repeats. The G + C content of the repetitive DNA is extremely high (83%), as determined by sequencing. The organization of the herpesvirus sylvilagus genome is, therefore, simil...

  6. Neuronal representation and processing of chemosensory communication signals in the ant brain


    Zube, Christina


    Ants heavily rely on olfaction for communication and orientation and ant societies are characterized by caste- and sex-specific division of labor. Olfaction plays a key role in mediating caste-specific behaviours. I investigated whether caste- and sex-specific differences in odor driven behavior are reflected in specific differences and/or adaptations in the ant olfactory system. In particular, I asked the question whether in the carpenter ant, Camponotus floridanus, the olfactory pathway exh...

  7. Clinal variation of some mammals during the Holocene in Missouri (United States)

    Purdue, James R.


    Eastern cottontail ( Sylvilagus floridanus), fox squirrel ( Sciurus niger), and gray squirrel ( Sciurus carolinensis) were examined for clinal variation during the Holocene. Modern samples of all three species displayed strong east-west patterns along the western edge of the eastern deciduous forest: S. floridanus and S. niger decrease and S. carolinensis increases in size. Archeological samples of S. carolinensis from Rodgers Shelter (23BE125), Benton County, Missouri, and Graham Cave (23MT2), Montgomery County, Missouri, indicated an increase in size from early to middle Holocene. Sylvilagus floridanus from Rodgers Shelter decreased in size from early to middle Holocene and then increased during the late Holocene to modern proportions. A literature survey reveals that clinal variation is a common phenomenon among modern homeotherms. In introduced species, clinal variation has developed after relatively few generations, indicating rapid adaptations to environmental conditions; often winter climatic variables are implicated. Morphological variation in the study species during the Holocene is interpreted as a response to changing climates. Studies of morphological clines may lead to another valuable data source for reconstructing past ecologies.

  8. Behavioural responses of captive-born greater rheas Rhea americana Linnaeus (Rheiformes, Rheidae submitted to antipredator training Respostas comportamentais de emas cativas Rhea americana Linnaeus (Rheiformes, Rheidae submetidas a treinamentoanti-predação

    Directory of Open Access Journals (Sweden)

    Cristiano S. de Azevedo


    Full Text Available Human activities have been diminishing greater rhea Rhea americana (Linnaeus, 1758 populations throughout their natural distribution. The reintroductions of captive-born greater rheas have been tried but without success; since the individuals reintroduced were killed by predators. Captive-born animals that have been isolated from predators for many generations can lose their predator recognition abilities. To enhance the survival rates of the reintroduced animals, researchers are now using antipredator training techniques. We studied the response of 15 zoo-borne greater rheas to antipredator training. The animals were divided into three groups: two test groups and one control group. We ran 15 antipredator tests and four control testes with each group. Antipredator tests consisted of pairing a taxidermized predator model or a real predator (domestic dog with a simulation of a capture procedure. Control tests consisted of presenting the predator model (jaguar to the birds, after training but not associating it with an aversive event and recording behavioural responses. All tests were video-recorded and analysed a posteriori. Results showed that the trained rheas responded appropriately to the predators, becoming more vigilant and that there was considerable individual differences in response to antipredator training. The results demonstrated that antipredator training is effective and therefore an invaluable tool for reintroduction projects involving greater rheas. Furthermore, the methods employed in this research project should be applicable to other species of flightless birds.As atividades humanas têm diminuído as populações de emas Rhea americana (Linnaeus, 1758 por toda sua área de distribuição. Reintroduções de emas nascidas em cativeiro têm sido tentadas, mas sem sucesso, uma vez que os indivíduos reintroduzidos são mortos por predadores. Animais nascidos em cativeiro que foram isolados de seus predadores por várias gera

  9. Fatores de mortalidade na fase de ovo de Tuta absoluta em sistemas de produção orgânica e convencional de tomate.


    Maria Alice de Medeiros; Edison Ryoiti Sujii; Helena Castanheira de Morais


    A traça-do-tomateiro Tuta absoluta (Meyrick) (Lep.: Gelechiidae) está sujeita a fatores de mortalidade bióticos como predadores e parasitoides e fatores abióticos como água da irrigação e da chuva que influenciam sua dinâmica populacional. O objetivo deste trabalho foi quantificar a importância desses fatores na sobrevivência de ovos da traça-do-tomateiro. Os experimentos foram desenvolvidos na Embrapa Hortaliças, de 1/8/2004 a 7/11/2005, em plantio de tomate e tomate consorciado em sistema o...

  10. Papel de la codorniz en la agroecología de malas hierbas (II). Influencia de la digestión en la viabilidad de las semillas


    Guerrero Herrero, Lucía; López Navarro, Pablo; González Redondo, Pedro; Urbano Fuentes-Guerra, José María


    El papel de las aves granívoras en la agroecología de las malas hierbas es poco conocido. La codorniz es un ave granívora migratoria frecuente en la campiña española. El objetivo de este trabajo ha sido conocer el potencial predador y dispersor de la codorniz sobre una serie de malas hierbas frecuentes y problemáticas en la agricultura mediterránea. Los resultados obtenidos han permitido demostrar que la codorniz es fundamentalmente predadora de semillas de malas hierbas, eliminando cerca del...

  11. Atividade de fungos sobre ovos, larvas e oocistos de parasitas de ungulados silvestres e do cão


    Cruz, Rita Magalhães da


    Dissertação de Mestrado Integrado em Medicina Veterinária Nas últimas décadas, surgiram novos problemas tais como o agravamento de resistências a anti-helmínticos e os consequentes efeitos adversos que o seu uso abusivo pode trazer para o ambiente e para os produtos alimentares. Recorrer a um método de controlo biológico dos parasitas com a utilização de fungos telúricos nematófagos surge como uma alternativa muito promissora. Neste trabalho, foi investigada a eficácia do fungo predador...

  12. Fitofagia de Podisus nigrispinus em algodoeiro e plantas daninhas Phytophagy by Podisus nigrispinus on cotton plants and weeds


    Walter Santos Evangelista Júnior; Manoel Guedes Correa Gondim Junior; Jorge Braz Torres; Edmilson Jacinto Marques


    O objetivo deste trabalho foi avaliar o efeito de seis plantas daninhas e do algodoeiro no desenvolvimento, reprodução e sobrevivência do percevejo predador Podisus nigrispinus (Dallas) (Heteroptera: Pentatomidae) sob escassez parcial de presas, alimentação em intervalos de três dias, e ausência total de presas. Com escassez parcial de presas, o desenvolvimento ninfal foi maior em Ricinus communis e menor em Bidens pilosa. Viabilidade dos ínstares, peso de fêmeas, período de pré-oviposição e ...

  13. Seletividade de atrazine e nicosulfuron a Podisus nigrispinus (Heteroptera: Pentatomidae) Selectivity of atrazin and nicosulfurom to Podisus nigrispinus (Heteroptera: Pentatomidae)


    C.W.G. Menezes; J.B. Santos; S.L. Assis Júnior; A.J. Fonseca; A.C. França; M. A. Soares; A.F Fernandes


    O milho tem sido cultivado em duas safras anuais no Brasil e consumido por humanos e animais. O uso de herbicidas no controle de plantas daninhas nessa cultura pode comprometer o ambiente em função dos efeitos sobre organismos não alvos. O objetivo deste trabalho foi avaliar a seletividade de atrazine e nicosulfuron sobre o predador Podisus nigrispinus. Os tratamentos constaram da aplicação de atrazine, nicosulfuron e da mistura destes, em doses equivalentes à comercial, mais um tratamento co...

  14. Victimización y nuevas tecnologías : un análisis transcultural de los riesgos de vivir en la era digital


    Ferreira, Fátima Abreu; Martins, Paula Cristina; Gonçalves, Rui Abrunhosa


    Introducción: En los últimos años las nuevas tecnologías se convirtieron en parte de la vida cuotidiana de los jóvenes y constituyen un valioso recurso para su desarrollo. El actual uso intensivo de las nuevas tecnologías y el anonimato que ellos ofrecen han creado un tema nuevo de interés para la protección de los niños, ya que los expone a una multitud de riesgos: violencia, bullying, predadores sexuales, entre otros. La falta de supervisión de estas actividades, la escasa legislación exist...

  15. Condições atuais da esquistossomose no "Dique do Tororó" em Salvador, Bahia

    Directory of Open Access Journals (Sweden)

    Ruth B. Amorim


    Full Text Available Os Autores apresentam os resultados de observações realizadas entre os anos de 1971 a 1974 sobre a incidência humana da esquistosomose no Dique do Tororó, em Salvador, Bahia, após alí terem sido realizadas melhorias pela engenhària sanitária e medidas de combate biológico ao caramujo vetor pelo uso de peixes predadores. Comparando com os resultados obtidos por outros Autores em 1960, concluem que o Dique do Tororó não mais representa uma importante fonte de propagação da esquistosomose.

  16. Parasitofauna del zorro rojo (Vulpes vulpes) en la Comunidad Valenciana


    Sanchis Monsonís, Gloria


    El presente estudio sobre la parasitofauna del zorro rojo (Vulpes vulpes) se ha realizado en la Comunidad Valenciana, dentro del Programa de Vigilancia Epidemiológica sobre especies cinegéticas y salvajes. Entre mayo de 2006 y noviembre de 2013 se realizaron las necropsias de 286 zorros obtenidos de capturas autorizadas para el control de predadores, de atropellos o recogidos enfermos. Tras el análisis de las vísceras torácicas y abdominales, así como el examen de muestras de musculatura esqu...

  17. Lesiones post mortales por fauna cadavérica: La acción de las hormigas sobre el cadáver Post-mortal injuries by cadaveric fauna: The action of the ants on human corpses


    P.M. Garamendi; M. López-Alcaraz; A. Mazón; Rodríguez, J.


    Los animales pueden actuar como predadores de los restos humanos y las lesiones postmortales que infligen en los cadáveres pueden dar lugar a errores de interpretación de los hallazgos en las autopsias forenses. Entre la fauna cadavérica, las hormigas constituyen un caso excepcional al ser los únicos insectos que pueden iniciar su actividad predadora antes de instaurarse la putrefacción. Las hormigas suelen producir lesiones que por su asiento y morfología resultan típicas. Se presenta un cas...



    Dionísio Link; Ervandil Corrêa Costa


    RESUMO Aspectos da biologia e frequência de infestação de Diploschema rotundicolle (Serville, 1834) foram estudados em cinamomo e plantas cítricas, em Santa Maria - RS, durante os anos de 1989 e 1990. Há preferência para oviposição em citros. O ciclo evolutivo é maior em citros que em cinamomo. Emergem menos adultos em citros que em cinamomo. Há maior incidência de predadores nas galerias larvais, nas plantas cítricas.





    Os nematoides são organismos amplamente distribuídos nos ecossistemas terrestres e aquáticos, possuindo abundante diversidade de espécies parasitas de animais, de plantas, ou simplesmente compondo a biota com consumidores de bactérias e nutrientes no meio onde se encontram. Algumas espécies de nematoides de “vida livre” que não são predadores nem parasitas podem ser facilmente mantidos ou cultivados em laboratório, possibilitando seu uso e manipulação em pesquisa. Comumente, os en...

  20. Fatores de mortalidade na fase de ovo de Tuta absoluta em sistemas de produção orgânica e convencional de tomate

    Directory of Open Access Journals (Sweden)

    Maria Alice de Medeiros


    Full Text Available A traça-do-tomateiro Tuta absoluta (Meyrick (Lep.: Gelechiidae está sujeita a fatores de mortalidade bióticos como predadores e parasitoides e fatores abióticos como água da irrigação e da chuva que influenciam sua dinâmica populacional. O objetivo deste trabalho foi quantificar a importância desses fatores na sobrevivência de ovos da traça-do-tomateiro. Os experimentos foram desenvolvidos na Embrapa Hortaliças, de 1/8/2004 a 7/11/2005, em plantio de tomate e tomate consorciado em sistema orgânico e tomate em sistema convencional. As avaliações consistiram em: 1 coleta de ovos no campo em diferentes épocas do ciclo da cultura e sua incubação em laboratório até a emergência do parasitoide ou eclosão da lagarta; 2 exposição de ovos sentinelas no campo por 72 horas; 3 ovos marcados e acompanhados a cada 24 horas até eclosão das lagartas em campo. Ovos coletados no campo e incubados em laboratório mostraram que a mortalidade por Trichogramma sp. foi de 32%. A mortalidade dos ovos que permaneceram no campo (metodologia 2 e 3, evidenciaram que o parasitismo por Trichogramma sp. foi de 12% e que os predadores e o efeito mecânico da água produziram 36% de mortalidade dos ovos. Essa diferença revela que a permanência dos ovos no campo os expõe à competição com predadores e a mortalidade causada pelo efeito mecânico da água reduzindo o recrutamento de Trichogramma sp. Parasitoides de ovos, predadores generalistas associados à ação da água acarretaram maior mortalidade de T. absoluta em sistemas de produção orgânica de tomate.

  1. Efeito do manejo de plantas daninhas sobre Neoseiulus californicus (Acari:Phytoseiidae) em pomar de macieira Effect of weed management on Neoseiulus californicus (Acari:Phytoseiidae) in apple orchard


    Lino Bittencourt Monteiro; Luiz Belli; Alexander Souza; André Luiz Werner


    Avaliou-se a influência do manejo de plantas daninhas sobre o deslocamento de ácaros tetraniquídeos (Panonychus ulmi e Tetranychus urticae) e do ácaro predador Neoseiulus californicus em um pomar de macieira 'Gala', onde foi implantado o controle biológico do ácaro vermelho, P. ulmi, por meio de liberações massais de N. californicus. As parcelas tiveram as plantas daninhas manejadas de três formas: sem manejo, com roçadas manuais e com herbicidas. As populações de ácaros foram avaliadas sobre...

  2. Respuestas fenotípicas en larvas de anuros a situaciones cambiantes en los factores bióticos y abióticos


    Gómez, Valeria Isabel


    Las respuestas fenotípicas son, comúnmente, respuestas adaptativas de los organismos que por lo general se mantienen por selección natural. Por lo tanto, el conocimiento de la estructura de una población exige saber cómo influyen los diferentes factores bióticos y abióticos -grado de cambio ambiental, presencia de predadores y competidores- sobre los organismos, teniendo en cuenta sus ciclos de vida y las estrategias evolutivas involucradas. Las larvas de anfibios son organismos muy intere...

  3. Las arañas en agroecosistemas: bioindicadores terrestres de calidad ambiental


    Miguel Simó; Álvaro Laborda; Carolina Jorge; Manuel Castro


    Las arañas son predadores generalistas en ecosistemas terrestres, ampliamente utilizadas en estudios de biodiversidad. En el último siglo, el paisaje de Uruguay se transformó en un mosaico de áreas formadas por ambientes naturales y agroecosistemas. ¿Qué nivel de cambio se espera hallar en la comunidad de arañas si las áreas de estudio están próximas? ¿Qué porcentaje de especies nativas serán reemplazadas con la plantación? ¿Cómo afecta esto a la biodiversidad local? Se realizó un estudio en ...

  4. Evaluación de la actividad entomopatogénica de hongos obtenidos del Páramo de Guerrero (Finca Puente de Tierra) Zipaquirá, Colombia


    Sánchez Nieves Jimena; Ascencio Ramírez Andrea Marcela


    El estudio y conservación de enemigos naturales en agroecosistemas conlleva a largo plazo a la regulación de
    insectos plaga, proporcionando un ambiente apropiado para incrementar la abundancia y eficacia de predadores
    y parásitos. El control biológico constituye una estrategia efectiva dentro de programas de manejo integrado de plagas y enfermedades (MIPE), garantizando control a bajo costo y con un mínimo o inexistente impacto ambiental. El objetivo del presente estudio...

  5. Phylogenetic and transcriptomic analysis of chemosensory receptors in a pair of divergent ant species reveals sex-specific signatures of odor coding.

    Directory of Open Access Journals (Sweden)

    Xiaofan Zhou

    Full Text Available Ants are a highly successful family of insects that thrive in a variety of habitats across the world. Perhaps their best-known features are complex social organization and strict division of labor, separating reproduction from the day-to-day maintenance and care of the colony, as well as strict discrimination against foreign individuals. Since these social characteristics in ants are thought to be mediated by semiochemicals, a thorough analysis of these signals, and the receptors that detect them, is critical in revealing mechanisms that lead to stereotypic behaviors. To address these questions, we have defined and characterized the major chemoreceptor families in a pair of behaviorally and evolutionarily distinct ant species, Camponotus floridanus and Harpegnathos saltator. Through comprehensive re-annotation, we show that these ant species harbor some of the largest yet known repertoires of odorant receptors (Ors among insects, as well as a more modest number of gustatory receptors (Grs and variant ionotropic glutamate receptors (Irs. Our phylogenetic analyses further demonstrate remarkably rapid gains and losses of ant Ors, while Grs and Irs have also experienced birth-and-death evolution to different degrees. In addition, comparisons of antennal transcriptomes between sexes identify many chemoreceptors that are differentially expressed between males and females and between species. We have also revealed an agonist for a worker-enriched OR from C. floridanus, representing the first case of a heterologously characterized ant tuning Or. Collectively, our analysis reveals a large number of ant chemoreceptors exhibiting patterns of differential expression and evolution consistent with sex/species-specific functions. These differentially expressed genes are likely associated with sex-based differences, as well as the radically different social lifestyles observed between C. floridanus and H. saltator, and thus are targets for further functional

  6. Períodos de ausência de presas e estabilidade do controle biológico do ácaro-rajado Periods of prey absence and stability of the spider mite biological control

    Directory of Open Access Journals (Sweden)

    Hamilton Oliveira


    Full Text Available O objetivo deste trabalho foi avaliar os parâmetros biológicos do ácaro predador Phytoseiulus macropilis na ausência de alimento por períodos de um a seis dias. Foram avaliados: o número de ovos por fêmea ao dia; o número total de ovos; a longevidade de fêmeas; e a razão sexual dos descendentes. Fêmeas que ficaram por mais de três dias sem alimento apresentaram queda em todas variáveis biológicas avaliadas. O predador P. macropilis somente se estabelecerá em campo se as manchas ocupadas pelo ácaro-rajado não estiverem muito distantes umas das outras.The objective of this work was to access the biological parameters of the predator mite Phytoseiulus macropilis in the food absence for periods of one or more days. Data evaluated were: egg number per female per day; total number of eggs; longevity of females; and the offspring sex rate. Female in starvation for three or more days showed decrease in all biological variables. P. macropilis only will settle in the field if patch populations occupied by spider mite are not very distant from each other.

  7. A new species of Symbra (Hymenoptera, Eurytomidae, Heimbrinae from dry forest in Brazil and new occurrence records for other Heimbrinae Uma nova espécie de Symbra (Hymenoptera, Eurytomidae, Heimbrinae de uma área de Caatinga e novos registros de ocorrência de outros Heimbrinae

    Directory of Open Access Journals (Sweden)

    Daniell Rodrigo Rodrigues Fernandes


    Full Text Available The geographic ranges of Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 and H. parallela Stage & Snelling, 1986 are extended based on study of material deposited in the entomological collections of the Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brazil of the Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brazil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae is described, illustrated and compared with S. cordobensis Stage & Snelling, 1986, the single species previously known for this genus. A key to the genera of Heimbrinae and to the species of Symbra is provided.Os limites geográficos de Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 e H. parallela Stage & Snelling, 1986 são estendidos com base no material examinado das coleções entomológicas do Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brasil e do Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brasil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae é descrita, ilustrada e comparada com a única espécie conhecida desse gênero, S. cordobensis Stage & Snelling, 1986. Uma chave para os gêneros de Heimbrinae e para as espécies de Symbra é fornecida.


    Directory of Open Access Journals (Sweden)



    Full Text Available Besouros predadores da família Histeridae foram coletados através do uso de armadilhas "pitfall" iscadas com massa fecal fresca de bovinos instaladas em área de pastagem em Piracicaba, SP. Coletaram-se durante o período de 15 de abril de 1995 a 17 de fevereiro de 1996, quatro espécies identificadas como Hister punctifer, Phelister panamensis, P. haemorrhous e P. rufinotus. A espécie P. panamensis é um importante predador de ovos e larvas de Haematobia irritans e representou 72,93% do total de insetos coletados.Histeridae beetles were collected using pitfall traps baited with cattle manure, placed in a pasture area in Piracicaba, SP, Brazil. The following species were collected from April 15th 1995 to February 17th 1996.: Hister punctifer, Phelister panamensis, P. haemorrhous and P. rufinotus. The species P. panamensis, an important predator of the horn fly, Haematobia irritans, represented 72,93% of all insects collected.

  9. Food habits of bobcats in eastern Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Story, J.D.; Galbraith, W.J.; Kitchings, J.T.


    Food habits of bobcats (Lynx rufus) in eastern Tennessee were determined from analyzing 176 cat samples collected on the Oak Ridge National Environmental Research Park. Remains of cottontail rabbits (Sylvilagus floridanus) were the most frequently occurring food item. White-tail deer (Odocoileus virginianus) and pine vole (Microtus pinetorum) remains also were found frequently in samples. Data obtained from this study indicated that food preferences for bobcats in eastern Tennessee are similar to those in other southeastern states where the habitat is similar to the Oak Ridge area and somewhat different from those with significantly different habitat.

  10. Parasites of cottontail rabbits of southern Illinois. (United States)

    Lepitzki, D A; Woolf, A; Bunn, B M


    Fifteen species of parasites including Haemaphysalis leporispalustris, Ixodes dentatus, Amblyomma americanum, Cediopsylla simplex, Odontopsyllus multispinosus, Cuterebra sp., Obeliscoides cuniculi, Trichostrongylus calcaratus, Trichostrongylus affinis, Longistriata noviberiae, Dermatoxys veligera, Trichuris sp., Mosgovoyia sp., Taenia pisiformis, and Hasstilesia tricolor as well as coccidia oocysts were collected from 96 cottontail rabbits (Sylvilagus floridanus) confined to a pen in southern Illinois in 1983 and 1984. The diversity of parasites and the intensities of infections were similar to published reports on free-ranging populations. Most variations in parasite abundances were attributable to season. Few lesions were seen in association with parasitism. PMID:1491303

  11. Epizootiology of an outbreak of cerebrospinal nematodiasis in cottontail rabbits and woodchucks. (United States)

    Jacobson, H A; Scanlon, P F; Nettles, V F; Davidson, W R


    An epizootic of cerebrospinal nematodiasis in cottontail rabbits (Sylvilagus floridanus) and woodchucks (Marmota monax) caused by Baylisascaris procyonis larvae followed the establishment of an ascarid-infected raccoon (Procyon lotor) population in a woodlot. Five of seven raccoons examined from the woodlot harbored ascarids, with one heavily infected animal shedding approximately 27,500 eggs per gram of feces. A laboratory-reared cottontail rabbit developed neurologic disease due to larval migration 80 days after infection with B. procyonis eggs from the raccoons. PMID:16498877

  12. Arrangement of repetitive sequences in the genome of herpesvirus Sylvilagus. (United States)

    Medveczky, M M; Geck, P; Clarke, C; Byrnes, J; Sullivan, J L; Medveczky, P G


    Herpesvirus sylvilagus is a lymphotropic (type gamma) herpesvirus of cottontail rabbits (Sylvilagus floridanus). Analysis of virion DNA of herpesvirus sylvilagus has revealed that the genome consists of one stretch of about 120 kilobase pairs of internal, unique DNA flanked by a variable number of 553-base-pair tandem repeats. The G + C content of the repetitive DNA is extremely high (83%), as determined by sequencing. The organization of the herpesvirus sylvilagus genome is, therefore, similar to that of the primate lymphotropic viruses herpesvirus saimiri and herpesvirus ateles. PMID:2911114

  13. Serum antibody prevalence for Herpesvirus sylvilagus, Bacillus piliformis and California serogroup arboviruses in cottontail rabbits from Pennsylvania. (United States)

    Dressler, R L; Ganaway, J R; Storm, G L; Tzilkowski, W M


    A serologic survey of 60 eastern cottontail rabbits (Sylvilagus floridanus) from three counties in Pennsylvania was conducted in March 1983. Serum antibody prevalences for Herpesvirus sylvilagus and La Crosse virus (California serogroup) were less than 4%. There was no evidence of previous exposure to either Jamestown Canyon or snowshoe hare viruses (California serogroup). Antibody to trivittatus virus (California serogroup) was found in 60% of the 20 cottontails from York County. No cottontails had antibodies to Bacillus piliformis, the etiologic agent of Tyzzer's disease. PMID:3373643

  14. Genetic differentiation among cottontails from isolated playa basins. (United States)

    Van den Bussche, R A; Hamilton, M J; Chesser, R K; Scribner, K T


    Protein variation in 182 Sylvilagus floridanus from 19 playa basins in Castro Co., Texas was examined using starch-gel electrophoresis. Heterozygote deficiencies were noted for all populations. This heterozygote deficiency may be due to differential selection against heterozygous individuals over the winter months. Results of F-statistics indicated a significant degree of population differentiation at six loci. Nei's genetic distance between populations ranged from 0.20 to 0.388 and a significant association between genetic distance and linear geographic distance among playas was found. These results suggest that genetic exchange and long-distance dispersal may be hindered by expanses of unsuitable habitat. PMID:3504804

  15. Circular Herpesvirus sylvilagus DNA in spleen cells of experimentally infected cottontail rabbits. (United States)

    Medveczky, P; Kramp, W J; Sullivan, J L


    Cottontail rabbits (Sylvilagus floridanus) were infected with Herpesvirus sylvilagus, and spleen cells were analyzed for the presence of virus-specific, covalently closed circular, and linear DNA molecules by a simple electrophoretic technique, followed by transfer to nitrocellulose filters and hybridization with cloned viral DNA (Gardella et al., J. Virol. 50:248-254, 1984). Approximately 0.2 copies per cell of circular DNA and 0.2 copies per cell of linear DNA were detected by hybridization with a cloned viral DNA fragment. The size of the viral DNA was estimated at ca. 158 kilobase pairs. Restriction endonuclease patterns suggested structural similarities to cottontail herpesvirus DNA. PMID:6092696

  16. Descubrimiento de mamíferos fósiles de edad lujanense (pleistoceno tardío) en el "desierto" de la tatacoa (huila, colombia)


    Villaroel A., Carlos; Brieva B., Jorge; Cadena, Alberto


    Se da a conocer el descubrimiento de una pequeña cuenca sedimentaria con mamíferos fósiles, en el lugar denominado Los Hoyos, dentro del ámbito del "desierto" de La Tatacoa. Aunque los estudios taxonómicos de los fósiles no están aún completos, no cabe duda de que se trata, de dos formas afines a especies vivientes, identificadas como Sylvilagus aff. floridanus y Tayassu aff. tajacu , y una tercera forma, referida a la familia Gomphotheriidae. Con base en esta pequeña fauna, se data el yacimi...

  17. Hematology and serum chemistry of cottontail rabbits of southern Illinois. (United States)

    Lepitzki, D A; Woolf, A


    In 1983 and 1984 blood was collected from 79 cottontail rabbits (Sylvilagus floridanus) confined to an outdoor enclosure in southern Illinois to establish reference values for hematology and serum chemistry. Packed cell volume, sodium, potassium, chloride, glucose, calcium, carbon dioxide, blood urea nitrogen, creatinine, uric acid, cholesterol, albumin, bilirubin, alkaline phosphatase, aspartate transaminase, alanine aminotransaminase, total protein, albumin/globulin ratio, and osmolality were measured. Sex and age (adult versus juvenile) of rabbit as well as season (June to September versus October to May) and method of capture (trap versus shot) variously affected most hematology and serum chemistry variables. PMID:1758030

  18. Sarcocystis and related organisms in Australian Wildlife: IV. Studies on Sarcocystis cuniculi in European rabbits (Oryctolagus cuniculus). (United States)

    Munday, B L; Smith, D D; Frenkel, J K


    The role of the cat (Felis domestica) as a definitive host for Sarcocystis cuniculi of European rabbits (Oryctolagus cuniculus) was confirmed. It was shown that after dosing with sporocysts from cats, rabbits developed sarcocysts and these became infective for cats at not less than 93 days post-infection (p.i.). The earliest infection detected was at 142 days p.i. Infected muscle from an experimental rabbit did not transmit Sarcocystis when fed to other rabbits. Microscopically, sarcocysts in European rabbits (O. cuniculus) were morphologically indistinguishable from those in cottontail rabbits (Sylvilagus floridanus). PMID:6776293

  19. Dicty_cDB: CHP858 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lkskqtlymi*fql wyfqlvllikrillnl*tl*chsfkvknlsvnqiinilisxevvesvnllieanqkllal ikqtkdfnsehslatflnq...X248584 |BX248584.1 Blochmannia floridanus complete genome; segment 1/3. 32 0.021 10 BX842643 |BX842643.1 Mycoplasma...KRKKX--- ---hyvsfvkrxser*klvvdklhsikslkih*fnmfvlfsmvmvivvigknspnlev*q iyhrlqrl*qiltlkrilnsflkvifshqlnwnhvkrfslkfiinq...ESS ***, 10 unordered pieces. 40 0.10 5 AC007178 |AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 ma....0 %: nuclear 28.0 %: cytoplasmic 24.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: plasma membran

  20. Do captive-born greater rheas Rhea americana Linnaeus (Rheiformes, Rheidae remember antipredator training? Emas Rhea americana Linnaeus (Rheiformes, Rheidae se lembram do treinamento anti-predação?

    Directory of Open Access Journals (Sweden)

    Cristiano S. de Azevedo


    Full Text Available The antipredator training is a powerful tool now being used to help the reintroduced animals to recognise and escape from their predators. Testing the memory capacity of the animals after antipredator training is important to evaluate if the application of the training is worthwhile. A group of 15 captive-born greater rheas was studied at Belo Horizonte Zoo. Eight birds were antipredator trained and seven birds were not. After the end of the antipredator training sessions, we run four memory tests at 40, 55, 70 and 88 days after training was completed. The memory tests consisted of showing a predator model to the rheas and recording their behavioural responses. It was measured the capacity of antipredator information storage, the influence of the group size on the behaviour of the birds and the influence of the antipredator training on the elicitation of the correct behavioural responses of the birds when confronted by a predator. The results showed that the rheas retained predator recognition for almost three months, that the group size affected the responses of the birds (more defence behaviours expressed when tested alone and that the antipredator training is essential to elicit the adequate antipredatory responses, since untrained birds behaved in a tranquil manner when confronted by a predator model. We concluded that antipredator training is worthwhile for future reintroduction programs for greater rheas, since their memory capacity is considerable.O treinamento anti-predação é uma ferramenta poderosa usada atualmente para ajudar os animais reintroduzidos a reconhecer e escapar de seus predadores. Testar a capacidade de memória dos animais após o treinamento é importante para se avaliar a validade de sua aplicação. Um grupo de 15 emas nascidas em cativeiro foi estudado no zoológico de Belo Horizonte. Oito aves foram treinadas contra predadores e sete não. Após o término dos treinamentos, foram realizados quatro testes de mem

  1. Systematic position of some nearctic Heligmosomoidea (Nematoda: Trichostrongylina) from the U.S. National Parasite collection and their description. (United States)

    Durette-Desset, Marie-Claude; Digiani, Maria Celina


    The systematic position of some heligmosomoid nematodes from rodents, deposited in the U.S. National Parasite Collection (USNPC), is revised, mainly through the study of their synlophe, which in all cases was unknown or insufficiently described. The material was registered as different species of Longistriata Schulz, 1926, a genus whose representatives are only parasitic in Holarctic insectivores. Longistriata norvegica Dikmans, 1935, parasitic in Rattus sp. becomes a synonym of Hassalstrongylus aduncus (Chandler, 1932). Specimens registered as Longistriata dalrymplei Dikmans, 1935, from Ondatra zibethicus, are confirmed to belong to Carolinensis (Travassos, 1937). Specimens registered as Longistriata noviberiae Dikmans, 1935, parasitic in Sylvilagus floridanus alacer, were found to belong to Vexillata, and Vexillata noviberiae n. comb. is here proposed. This is the first record of a species of Vexillata in a lagomorph. Other specimens registered as Longistriata norvegica, parasitic in Geomys floridanus austrinus, were also found to be an undescribed species of Vexillata (Hall, 1916), which is named Vexillata chitwoodi n. sp. This is similar to Vexillata chabaudi Yoyotte-Vado, 1972, Vexillata petteri Durette-Desset, 1970, Vexillata scorzai Guerrero, 1984 and Vexillata tejerai Guerrero, 1984, all having the same number of cuticular ridges (4 dorsal, 5 ventral) and the division of the dorsal ray at its apex. The most related species is V. chabaudi, which is differentiated from the new species by rays 4 not curved distally, by thick rays 8, and by a dorsal ray enlarged at the level of the arising of rays 8. PMID:17089761

  2. Selección natural sobre a cor das flores de Gentiana lutea L.


    Veiga Blanco, Tania


    A variación floral dentro dunha de especie pode resultar da variación espacial nos axentes de selección. A cor floral podería variar pola selección dos animais que se alimentan das plantas. Os polinizadores poderían exercer selección natural sobre a cor, si a cor inflúe na eficacia do consumo. Outros axentes de selección, como os predadores de sementes, poderían seleccionar sobre a cor, si a cor indica recursos alimentarios (sementes) ou si a cor está relacionada con defensas químicas. Así, a...

  3. Hemiptera acuáticos asociados a los estuarios de la costa pacífica colombiana Aquatic Hemiptera associated to estuaries of the colombian pacific coast




    la mayoría de los hemípteros acuáticos son insectos predadores que habitan en agua dulce, estuarios y mar. Las familias que incluyen especies de hábitat salobres y estuarios son Gerridae y Veliidae. Con el fin de contribuir al conocimiento faunístico y ecológico de los hemípteros acuáticos asociados a los estuarios de la Costa Pacífica de Colombia y de la región del Chocó biogeográfico, se estudiaron seis estuarios del municipio de Tumaco: El Bajito, El Morro, Villa del Sol, Agua clara, Chilv...

  4. Categorização funcional trófica das comunidades de macroinvertebrados de dois reservatórios na região Centro-Oeste do Estado de São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v31i1.331 Functional feeding groups of benthics macroinvertebrates communities of two lentic systems in the central west region of São Paulo State - DOI: 10.4025/actascibiolsci.v31i1.331


    Jandira Liria Biscalquini Talamoni; Gustavo Mayer Pauleto; Fabio Laurindo da Silva; Sonia Silveira Ruiz


    A utilização do conceito de guilda pode ser útil para a categorização funcional trófica de comunidades, pois não há obrigatoriedade da identificação dos organismos em nível de espécie, nem de tratar cada espécie como uma entidade separada. O objetivo deste estudo foi analisar os grupos funcionais tróficos (coletores-catadores, coletores-filtradores, fragmentadores, predadores e raspadores) das comunidades de macroinvertebrados de dois reservatórios da região Centro-Oeste do Estado de São Paul...

  5. Monitorização do coelho-bravo na Reserva Natural da Serra da Malcata : 1998-2007


    Paula, Anabela Salvado


    O Coelho-bravo, Oryctolagus cuniculus, é uma espécie chave nos ecossistemas mediterrâneos ibéricos, desempenhando uma multiplicidade de papéis na dinâmica dos mesmos, dos quais de destaca o facto de ser principal “espécie presa” de um largo espectro de predadores, como por exemplo o Lince-ibérico e a Águia-imperial, e ser uma das principais espécies cinegéticas em Portugal. Na Reserva Natural da Serra da Malcata – RNSM, as suas populações têm sofrido um acentuado declínio, r...

  6. A new species of Symbra (Hymenoptera, Eurytomidae, Heimbrinae from dry forest in Brazil and new occurrence records for other Heimbrinae

    Directory of Open Access Journals (Sweden)

    Daniell Rodrigo Rodrigues Fernandes


    Full Text Available The geographic ranges of Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 and H. parallela Stage & Snelling, 1986 are extended based on study of material deposited in the entomological collections of the Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brazil of the Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brazil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae is described, illustrated and compared with S. cordobensis Stage & Snelling, 1986, the single species previously known for this genus. A key to the genera of Heimbrinae and to the species of Symbra is provided.

  7. Ecological Roles of Coleoptera Associated with Carcasses in Caatinga

    Directory of Open Access Journals (Sweden)

    Wellington Santos


    Resumo. O papel ecológico da coleopterofauna associada a carcaças de porcos em uma área de Caatinga foi examinado. Para captura desses insetos foram utilizadas armadilhas do tipo bandeja, pitfall e Shannon modificada, durante duas estações (seca e chuvosa. 4.851 coleópteros foram coletados, pertencentes a 19 famílias e 88 espécies. A categoria ecológica mais abundante foi predador/parasita (72,7%, seguida por onívoro (15,1%, necrófago (10,9% e incidental (1,3%. Futuros estudos sobre biologia das espécies predadoras/parasitas são necessários para se determinar sua possível utilidade forense na estimativa do intervalo pós-morte.

  8. Feeding of Pellona flavipinnis (Clupeiformes, Pristigasteridaein a Central Amazonian floodplain Dieta de Pellona flavipinnis (Clupeiformes, Pristigasteridae em planície alagada da Amazônia Central

    Directory of Open Access Journals (Sweden)

    Sandra S. Moreira-Hara


    Full Text Available The feeding habits of Pellona flavipinnis (Valenciennes, 1836 at Catalão, a floodplain area on the Brazilian Central Amazon was studied. Data was obtained during three hydrological cycles, between September 1999 and September 2003. Diet composition, daily and seasonal variation in the feeding activity and the relationship between predator's size and its prey were analyzed. Almost 80% of the food consumed has autochthonous origin and diet was composed basically by insects and fish. Juvenile fish predominated in the stomach contents of all size classes but there was no significant relationship between predator's size and its prey. Pellona flavipinnis may be considered a carnivorous species which feeds mainly on juvenile (young-of-the-year specimens of other fish. More intense feeding activity occurred at night and in the high water period.Os hábitos alimentares de Pellona flavipinnis (Valenciennes, 1836 de uma área de várzea na Amazônia Central, Catalão, foram estudados. Foram utilizados dados referentes a três ciclos hidrológicos, entre setembro de 1999 e setembro de 2003. Foram analisados a dieta, a atividade alimentar diária e sazonal e a relação entre o comprimento da presa e o do predador. Cerca de 80% dos alimentos consumidos eram de origem autóctone e a dieta composta basicamente de insetos e peixes. Peixes juvenis predominaram nos conteúdos estomacais de exemplares de todas as classes de tamanho, mas não houve relação significativa entre o tamanho do predador e o das presas consumidas. Pellona flavipinnis pode ser considerada uma espécie carnívora que se alimenta principalmente de indivíduos juvenis de outras espécies de peixes. A atividade alimentar foi maior durante a noite e no período da cheia.

  9. The almost invisible league: crypsis and association between minute fishes and shrimps as a possible defence against visually hunting predators

    Directory of Open Access Journals (Sweden)

    Lucélia Nobre Carvalho


    Full Text Available Camouflage is one of the most widespread defence modes used by substrate-dwelling animals, whereas transparency is generally found in open-water organisms. Both these defence types are regarded as effective against visually guided predators. We present here three assemblages of similarly-sized freshwater fish and shrimp species which apparently rely on camouflage and transparency to evade some of their potential predators. In one of the associations, there is a transition from cryptic colours and translucency to transparency of the component species according to the position each of them occupies in the habitat. The likeness between the fishes and the shrimps is here regarded as a type of protective association similar to numerical or social mimicry. Additionally, we suggest that the assemblage may contain Batesian-like mimicry components.Camuflagem é um dos tipos de defesa mais bem distribuídos entre os animais que vivem no substrato, sendo a transparência geralmente encontrada em organismos pelágicos. Ambos os tipos de defesa são considerados como eficientes contra predadores visualmente orientados. Apresentamos três conjuntos de espécies de peixes e camarões de tamanhos similares, que aparentemente dependem da camuflagem e transparência para escapar de potenciais predadores. Em uma das associações, há uma transição de coloração críptica ou translúcida para transparente, de acordo com a posição que cada espécie ocupa no habitat. A semelhança entre peixes e camarões é aqui considerada como um tipo de associação protetiva, similar a mimetismo numérico ou social. Além disso, sugerimos que o conjunto pode conter elementos similares ao mimetismo Batesiano.

  10. Dieta de Leopardus colocolo (Carnivora: Felidae en la Reserva Nacional de Junín, Junín, Perú

    Directory of Open Access Journals (Sweden)

    Ursula Fajardo


    Full Text Available Este estudio caracteriza la dieta de Leopardus colocolo en los alrededores del lago Junín, en el centro del Perú, a partir de los restos de las presas presentes en 43 heces. El origen de las heces del predador se determinó a partir del ADN mitocondrial de las células epiteliales intestinales adheridas a la superficie de las heces, utilizando como marcador la región de control. Los restos de las presas fueron identificados utilizando literatura especializada y la comparación con especímenes de colección, identificando un total of 14 ítems alimenticios pertenecientes a mamíferos de las familias Cricetidae (6, Chinchillidae (1 y Caviidae (1 y aves de las familias Anatidae (3 y Rallidae (2, y un grupo de aves no identificadas (1. Los roedores fueron el principal componente de la dieta de L. colocolo, en frecuencia y biomasa, seguido por las aves. Entre los ítems alimenticios consumidos, el roedor cricétido pequeño Calomys sp. fue el más frecuente; sin embargo, el mayor aporte de biomasa relativa fue proporcionado por el roedor mediano Cavia tschudii. La amplitud de nicho obtenida fue baja (Bsta= 0.17, indicando una dieta especializada. Nuestros resultados confirman que, como ocurre con la mayoría de felinos pequeños neotropicales, L. colocolo es un predador especializado en la captura de vertebrados, principalmente mamíferos pequeños. No se registró variación estacional en la dieta y el análisis de las clases de edad de los roedores cricétidos mostró que los adultos fueron los más consumidos. Se infiere que L. colocolo tiene un patrón de actividad diurno y nocturno.

  11. A non-digging zoobenthivorous fish attracts two opportunistic predatory fish associates

    Directory of Open Access Journals (Sweden)

    Cristina Sazima


    Full Text Available Following behaviour among reef fishes involves mostly a digging nuclear species while foraging, which attracts opportunistic followers preying on the exposed organisms. The flying gurnard Dactylopterus volitans preys on benthic animals, mostly crustaceans and small fishes, scratching and probing the bottom with the inner rays of its pectoral fins. We recorded the flying gurnard being followed by two opportunistic predators, the yellow jack Caranx bartholomaei and the coney Cephalopholis fulva at Fernando de Noronha, off northeast Brazil. Albeit not actually digging the substrate, the flying gurnard acts as a nuclear species by exploring algae tufts and by its wandering near the boulders and ledges, disturbing and flushing out hidden animals which thus become available to predation.Entre os peixes recifais, uma espécie fossadora nuclear em atividade de forrageamento pode atrair seguidores oportunistas que se alimentam de organismos expostos pela atividade do nuclear. O coió-voador Dactylopterus volitans alimenta-se de animais bentônicos, principalmente crustáceos e pequenos peixes, explorando o substrato com os primeiros raios externos de suas nadadeiras peitorais. Registramos o coió sendo seguido por dois predadores oportunistas, a guarajuba Caranx bartholomaei e a piraúna Cephalopholis fulva, em Fernando de Noronha, ao largo da costa Nordeste do Brasil. Apesar de não agir como uma espécie fossadora do substrato, o coió atua como uma espécie nuclear por explorar os tufos de algas e também pela sua passagem próxima às rochas e lajes, espantando e desentocando animais escondidos que, assim, tornam-se vulneráveis aos predadores.

  12. Nutritional upgrading for omnivorous carpenter ants by the endosymbiont Blochmannia

    Directory of Open Access Journals (Sweden)

    Mueller Martin J


    Full Text Available Abstract Background Carpenter ants (genus Camponotus are considered to be omnivores. Nonetheless, the genome sequence of Blochmannia floridanus, the obligate intracellular endosymbiont of Camponotus floridanus, suggests a function in nutritional upgrading of host resources by the bacterium. Thus, the strongly reduced genome of the endosymbiont retains genes for all subunits of a functional urease, as well as those for biosynthetic pathways for all but one (arginine of the amino acids essential to the host. Results Nutritional upgrading by Blochmannia was tested in 90-day feeding experiments with brood-raising in worker-groups on chemically defined diets with and without essential amino acids and treated or not with antibiotics. Control groups were fed with cockroaches, honey water and Bhatkar agar. Worker-groups were provided with brood collected from the queenright mother-colonies (45 eggs and 45 first instar larvae each. Brood production did not differ significantly between groups of symbiotic workers on diets with and without essential amino acids. However, aposymbiotic worker groups raised significantly less brood on a diet lacking essential amino acids. Reduced brood production by aposymbiotic workers was compensated when those groups were provided with essential amino acids in their diet. Decrease of endosymbionts due to treatment with antibiotic was monitored by qRT-PCR and FISH after the 90-day experimental period. Urease function was confirmed by feeding experiments using 15N-labelled urea. GC-MS analysis of 15N-enrichment of free amino acids in workers revealed significant labelling of the non-essential amino acids alanine, glycine, aspartic acid, and glutamic acid, as well as of the essential amino acids methionine and phenylalanine. Conclusion Our results show that endosymbiotic Blochmannia nutritionally upgrade the diet of C. floridanus hosts to provide essential amino acids, and that it may also play a role in nitrogen recycling

  13. Comparative infectivity of Babesia divergens and a zoonotic Babesia divergens-like parasite in cattle. (United States)

    Holman, Patricia J; Spencer, Angela M; Telford, Sam R; Goethert, Heidi K; Allen, Andrew J; Knowles, Donald P; Goff, Will L


    Babesia divergens-like parasites identified in human babesiosis cases in Missouri and Kentucky and in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, share identical small subunit ribosomal RNA gene sequences. This sequence is 99.8% identical to that of Babesia divergens, suggesting that the U.S. parasite may be B. divergens, a causative agent of human and bovine babesiosis in Europe. Holstein-Friesian calves were inoculated with cultured Nantucket Island Babesia sp. (NR831) and B. divergens parasites and monitored by clinical signs, Giemsa-stained blood films, PCR, and culture. The NR831 recipients did not exhibit clinical signs of infection and remained negative for all assays. The B. divergens recipients developed clinical infections and became positive by all assays. NR831 recipients were fully susceptible upon challenge inoculation with B. divergens. This study confirms that the Nantucket Island Babesia sp. is not conspecific with B. divergens based on host specificity for cattle. PMID:16282295

  14. Herpesvirus sylvilagus infects both B and T lymphocytes in vivo. (United States)

    Kramp, W J; Medveczky, P; Mulder, C; Hinze, H C; Sullivan, J L


    Herpesvirus sylvilagus infection of cottontail rabbits (Sylvilagus floridanus) was studied as a model of herpesvirus-induced lymphoproliferative disorders. Leukocytosis, splenomegaly, proliferation of T cells and virus production by lymphocytes characterized this infectious mononucleosis-like disease. Approximately two copies of circular herpesvirus sylvilagus genomes per cell were detected in spleen cells at 2 weeks postinfection, and circular genomes could still be observed after 4 months. Circular viral genomes were found in both B and T lymphocytes. Small amounts of linear viral DNA (0.1 to 0.3 copies per cell) were also detected in both B and T cells. These results indicated that the virus did not replicate in the majority of lymphocytes in vivo. Herpesvirus sylvilagus infection in cottontail rabbits could be useful as a model for studying the complex virus-host relationships of lymphotropic herpesviruses and perhaps as an animal model for Epstein-Barr virus infection in humans. PMID:2993667

  15. First report of Obeliscoides cuniculi in European brown hare (Lepus europaeus). (United States)

    Tizzani, Paolo; Menzano, Arianna; Catalano, Stefano; Rossi, Luca; Meneguz, Pier Giuseppe


    Obeliscoides cuniculi is a New World nematode parasite of the Trichostrongilidae family infecting the gastric tract of different domestic and wild Lagomorph species. This parasite is reported for the first time from a European brown hare (Lepus europaeus). The nematodes isolated from the gastro-intestinal tract were identified using the primary characteristics used to differentiate the species of this genus as adults morphology (length and thickness) and other characteristics of spicules, cervical papillae, cuticular ridges and striations. In the Italian study area, the European brown hare lives in sympatry with the eastern cottontail (Sylvilagus floridanus), species in which the nematode was previously isolated; therefore, the possibility of a cross-infestation must be considered. PMID:21484345

  16. Herpesvirus sylvilagus in cottontail rabbits: attempted laboratory transmission by two insect species. (United States)

    Spieker, J O; Yuill, T M


    The vector potential of the rabbit flea (Cediopsylla simplex) and a mosquito (Aedes triseriatus) was investigated for Herpesvirus sylvilagus transmission among cottontail rabbits (Sylvilagus floridanus). Twelve groups of 12-50 fleas were fed on three viremic cottontails for 2-21 days before transfer to 12 susceptible rabbits. Standard interrupted feeding trials employed five groups of 6-12 mosquitoes, two viremic donor cottontails anf five healthy recipients. No evidence of virus was detected from recipients' blood nor did they develop specific antibody. Virus acquisition and persistence in the insects was evaluated by attempting to recover the virus from 19 pools of mosquitoes engorged on viremic blood and 36 pools of engorged fleas or those living on viremic hosts for 1-21 days. Results were negative. PMID:190425

  17. Metazoan parasites of the eastern cottontail rabbit in western Kentucky. (United States)

    Strohlein, D A; Christensen, B M


    Forty-five eastern cottontail rabbits (Sylvilagus floridanus Allen), collected over a 15 mo period from two areas of western Kentucky, were examined for disease conditions, helminth and arthropod parasites. A single lymphosarcoma, two cutaneous papillomas and the following parasites were identified: Hasstilesia tricolor, Taenia pisiformis, Cittotaenia variabilis, Raillietina stilesiella, Obeliscoides cuniculi, Trichuris leporis, Longistriata noviberiae, Trichostrongylus calcaratus, Dermatoxys veligera, Odontopsyllus multispinosus, Cediopsylla simplex, Haemaphysalis leporispalustris, Ixodes dentatus, Amblyomma americanum, and Dermacentor variabilis. Simpson's Indices indicated that parasite communities were fairly diverse, with some degree of dominance exhibited by O. cuniculi, T. pisiformis and H. leporispalustris. The parasite faunas of rabbits from the two areas were similar. Hasstilesia tricolor was associated with the absence of kidney fat. PMID:6842731

  18. A homologue of the rabbit kappa-chain allotype b9 ON IgG from a cottontail rabbit. (United States)

    Tosi, S L; Mage, R G; Tosi, R M


    Eight out of 12 anti-b9 antisera tested strongly bound 125IgG of only one of four individual cottontail rabbits (Sylvilagus floridanus). In addition to this apparent polymorphism of a b9 homologue in cottontail rabbits, a polymorphism defined by some anti-b5 antisera was found. Three of 15 anti-b5 antisera reacted with IgG from only two of the four cottontail rabbits. Reactions with anti-b4 and anti-b6 were similar to those with hare IgG. Most anti-b4 and anti-b6 antisera bound the IgG from each animal. The cottontails we tested also resembled the hare with respect to their weak reactivity with some anti-a2 antisera (Vh allotype) and strong reactivity with anti-15 (an allotype localized in the Fc portion of rabbit gamma-chains). PMID:820806

  19. Genome structure of cottontail rabbit herpesvirus. (United States)

    Cebrian, J; Berthelot, N; Laithier, M


    The genome structure of a herpesvirus isolated from primary cultures of kidney cells from the cottontail rabbit Sylvilagus floridanus was elucidated by using electron microscopy and restriction enzyme analysis. The genome, which was about 150 kilobase pairs long and which had an average G + C composition of 45%, consisted of two regions with unique base sequences (54 and 47 kilobase pairs) enclosed by reiterations of a 925-base-pair sequence with a variable copy number. The internal repeats were in opposite polarity with respect to the terminal repeats, and both unique regions underwent inversion. The nucleotide sequence of the repeat unit was determined, and virion DNA termini were precisely localized within this sequence. Elements showing homology with the cleavage-packaging signals common to other herpesviruses were detected. The data indicate that this virus is different from the previously described herpesvirus sylvilagus. PMID:2911115

  20. Aversive responses of white-tailed deer,Odocoileus virginianus, to predator urines. (United States)

    Swihart, R K; Pignatello, J J; Mattina, M J


    We tested whether predator odors could reduce winter browsing of woody plants by white-tailed deer (Odocoileus virginianus). Urine from bobcats (Lyra rufus) and coyotes (Canis latrans) significantly reduced browsing of Japanese yews (Taxus cuspidata), and repellency was enhanced when urine was reapplied weekly as a topical spray. Urine of cottontail rabbits (Sylvilagus floridanus) and humans did not reduce damage, suggesting that deer do not respond aversively to odors of nonpredatory mammals or occasional predators with which they lack a long evolutionary association. Bobcat and coyote urine were more effective in tests conducted with eastern hemlock (Tsuga canadensis), which is less palatable to white-tailed deer than Japanese yew. A dichloromethane extract of bobcat urine was as effective as unextracted urine in reducing damage to hemlocks. Testing of the organic components of bobcat urine, particularly the volatile components, may enable identification of the compounds responsible for the repellency we observed. PMID:24258921

  1. Ascorbic acid and L-gulonolactone oxidase in lagomorphs. (United States)

    Jenness, R; Birney, E C; Ayaz, K L


    1. The activity of L-gulonolactone oxidase (EC in the liver of eastern cottontail rabbits (Sylvilagus floridanus) is about 10-fold greater in winter than in summer. 2. L-gulonolactone oxidase activity is low and tissue ascorbate high during all seasons in snowshoe hares (Lepus americanus). 3. Liver contents of ascorbate fall to low levels in L. americanus fed on rabbit chow in the laboratory. 4. The activity of L-gulonolactone oxidase in liver of Sylvilagus and Oryctolagus is depressed by feeding high levels of L-ascorbic acid. 5. The New Zealand White breed of domestic rabbit (Oryctolagus cuniculus) has considerably higher levels of L-gulonolactone oxidase and liver ascorbate than does the Dutch breed. 6. In a wild population of Oryctolagus sampled in Australia L-gulonolactone oxidase levels were intermediate between those of the two domestic breeds and more variable than either. PMID:318384

  2. Dicty_cDB: Contig-U09515-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3( AM086400 |pid:none) Staphylococcus simulans pSCFS4 pla... 41 0.074 ( Q00357 ) RecName: Full=Putative HC-toxin...07( AM238664 |pid:none) Streptomyces ambofaciens ATCC 2... 41 0.097 CP001019_129( CP001019 |pid:none) Bacillus cereus subsp. cytotoxi... 48 8e-04 BX248583_225( BX248583 |pid:none) Blochmannia floridanus co...U928167_421( CU928167 |pid:none) Kluyveromyces thermotolerans str... 46 0.002 ( P02980 ) RecName: Full=Tetracycline resistance prot...41( CU928180 |pid:none) Kluyveromyces thermotolerans str... 43 0.020 CP000323_195

  3. Avaliação da infestação e diversidade de Teredinidae (Mollusca - Bivalvia ao longo da costa do estado do Rio de Janeiro, Brasil Evaluation of the infestation and diversity of Teredinidae (Mollusca - Bivalvia along the coast of Rio de Janeiro State, Brazil

    Directory of Open Access Journals (Sweden)

    Andrea de O. R. Junqueira


    Full Text Available In order to evaluate the diversity and infestation level of Teredinidae wood-boring molluscs, ten satations were chosen along the coast of Rio de Janeiro State. Using five pine-wood panels in each station, it was possible to distinguish five areas according to species dominance. Ilha Grande Bay is characterized by the dominance of Lyrodus floridanus (Bartsch, 1922; Sepetiba Bay, by Bankia fimbriatula Moll & Roch, 1931, Tijuca Lagoon by Teredo navalis Linnaeus, 1758; Guanabara Bay by Notoredo knoxi (Bartsch, 1917 and Araruama Lagoon by Teredo furcifera Martens, 1894. Specific composition and dominance of these species were due mainly to abiotic factors such as salinity whereas infestation level was associated not only to salinity but also to other factors such as the quantity and quality of fouling, the presence of larval dispersion focus and the wood supply in each area.

  4. [Diversity and microstructure of quitons (Mollusca: Polyplacophora) from the Caribbean of Costa Rica]. (United States)

    García-Ríos, Cedar I; Alvarez-Ruiz, Migdalia


    Diversity and microstructure of quitons (Mollusca: Polyplacophora) from the Caribbean of Costa Rica. The polyplacophorans of the coral reef on the Caribbean coast of Costa Rica have been insufficiently studied. The examination of coral rubble accumulated in the shallow sublitoral waters on four collection stations in Provincia Limón revealed a higher diversity of chitons than was documented. From the country eight species were previously known: Ischnochiton erythronotus (C.B. Adams 1845); Ischnoplax pectinata (Sowerby 1840); Stenoplax boogii (Haddon 1886); S. purpurascens (C.B. Adams 1845); Acanthopleura granulata (Gmelin 1791); Chiton marmoratus Gmelin 1791; C. tuberculatus Linnaeus 1758 and Acanthochitona rhodea (Pilsbry 1893). This study added five more species that are reported here for the first time: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954 and Cryptoconchus floridanus (Dall 1889). PMID:21516641

  5. Cuticular Hydrocarbon Pheromones for Social Behavior and Their Coding in the Ant Antenna

    Directory of Open Access Journals (Sweden)

    Kavita R. Sharma


    Full Text Available The sophisticated organization of eusocial insect societies is largely based on the regulation of complex behaviors by hydrocarbon pheromones present on the cuticle. We used electrophysiology to investigate the detection of cuticular hydrocarbons (CHCs by female-specific olfactory sensilla basiconica on the antenna of Camponotus floridanus ants through the utilization of one of the largest family of odorant receptors characterized so far in insects. These sensilla, each of which contains multiple olfactory receptor neurons, are differentially sensitive to CHCs and allow them to be classified into three broad groups that collectively detect every hydrocarbon tested, including queen and worker-enriched CHCs. This broad-spectrum sensitivity is conserved in a related species, Camponotus laevigatus, allowing these ants to detect CHCs from both nestmates and non-nestmates. Behavioral assays demonstrate that these ants are excellent at discriminating CHCs detected by the antenna, including enantiomers of a candidate queen pheromone that regulates the reproductive division of labor.

  6. Plasma osmotic and electrolyte concentrations of largemouth bass from some acidic Florida lakes

    Energy Technology Data Exchange (ETDEWEB)

    Canfield, D.E. Jr.; Maceina, M.J.; Nordlie, F.G.; Shireman, J.V.


    Five acidic clear (pH 3.7-4.9), three acidic colored (pH 4.1-4.6), and three neutral (pH 6.9-7.3) north-central Florida lakes were surveyed in 1983 to determine plasma osmotic and electrolyte concentrations, growth, and coefficients of condition for largemouth bass Micropterus salmoides floridanus. Plasma osmotic concentrations averaged greater than 273 milliosmoles/kg in fish from acidic colored and circumneutral lakes, but averaged less than 269 milliosmoles/kg in four of the acidic clear lakes. Growth and coefficients of condition of largemouth bass > 305 mm total length in the acidic lakes were significantly lower than in the neutral lakes. Reductions in fish growth and condition, however, could be related to either acidic conditions or lake trophic status. 29 references, 3 tables.

  7. A review of Gongylonema spp. (Nematoda: Gongylonematidae) in North American rodents with description of a new species from the cotton rat, Sigmodon hispidus (Mammalia: Cricetidae). (United States)

    Kinsella, John M; Robles, Maria Del Rosario; Preisser, Whitney C


    Gongylonema archboldi n. sp. (Nematoda: Gongylonematidae) is described from tunnels in the gastric mucosa of the stomach of the cotton rat (Sigmodon hispidus) from Highlands County, Florida, U.S.A. Measurements are also given for specimens from cotton mice (Peromyscus gossypinus), oldfield mice (Peromyscus polionotus), Florida mice (Podomys floridanus), and golden mice (Ochrotomys nuttalli) from the same locality. Additional specimens were collected from the cotton rat and the rice rat (Oryzomys palustris) from Berry Island, San Patricio County, Texas. The new species is differentiated from congeners by a combination of the following characters: length of the left spicule, length and shape of the gubernaculum, distribution of cuticular bosses, length of esophagus, and distance of the vulva from the posterior end. The status of the genus Gongylonema in North American rodents is reviewed. PMID:27394819

  8. A Century of Shope Papillomavirus in Museum Rabbit Specimens. (United States)

    Escudero Duch, Clara; Williams, Richard A J; Timm, Robert M; Perez-Tris, Javier; Benitez, Laura


    Sylvilagus floridanus Papillomavirus (SfPV) causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus) from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, and whether SfPV occurs throughout the host range, or just in the Midwest. Secondary aims were to detect distinct strains, and evidence for strain spatio-temporal specificity. We found 20 of 1395 rabbits in the KU collection SfPV symptomatic. Three of 17 lagomorph species (S. nuttallii, and the two known hosts) were symptomatic, while Brachylagus, Lepus and eight additional Sylvilagus species were not. 13 symptomatic individuals were positive by molecular testing, including the first S. nuttallii detection. Prevalence of symptomatic individuals was significantly higher in Sylvilagus (1.8%) than Lepus. Half of these specimens came from Kansas, though new molecular detections were obtained from Jalisco-Mexico's first-and Nebraska, Nevada, New Mexico, and Texas, USA. We document the oldest lab-confirmed case (Kansas, 1915), pre-dating Shope's first case. SfPV amplification was possible from 63.2% of symptomatic museum specimens. Using multiple methodologies, rolling circle amplification and, multiple isothermal displacement amplification in addition to PCR, greatly improved detection rates. Short sequences were obtained from six individuals for two genes. L1 gene sequences were identical to all previously detected sequences; E7 gene sequences, were more variable, yielding five distinct SfPV1 strains that differing by less than 2% from strains circulating in the Midwest and Mexico, between 1915 and 2005. Our results do not clarify whether strains are host species specific, though

  9. Análise crítica dos sistemas neurais envolvidos nas respostas de medo inato Critical analysis of the neural systems organizing innate fear responses

    Directory of Open Access Journals (Sweden)

    Newton Sabino Canteras


    Full Text Available O nosso entendimento das bases neurofisiológicas da reação emocional do medo baseia-se em grande parte nos estudos que envolvem respostas condicionadas a estímulos fisicamente aversivos, como, por exemplo, o choque elétrico nas patas. Enquanto este paradigma parece ser útil para avaliarmos os sistemas neurais envolvidos na resposta do, assim chamado, medo condicionado (que tipicamente tem se limitado à observação da resposta de congelamento, este paradigma parece ter sérias limitações para investigarmos as bases neurais das respostas de medo em circunstancias naturais. Trabalhos recentes utilizando técnicas de lesões neurais bem como de mapeamento funcional em animais expostos a predadores naturais, ou somente ao odor destes predadores, revelam uma série de estruturas neurais como responsáveis pelas respostas de medo inato, bastante distintas daquelas previamente implicadas nas respostas de condicionamento aversivo. Como revisto no presente trabalho, entre estas estruturas temos distritos diferenciados da zona medial do hipotálamo; setores específicos da amídala e do sistema septo-hipocampal, envolvidos, respectivamente no processamento de pistas relacionadas à presença do predador e na análise contextual do ambiente; e setores da matéria cinzenta periaquedutal, já classicamente envolvidos na expressão de respostas de defesa. Estas informações podem ser potencialmente importantes para a análise e terapêutica de psicopatologias relacionadas aos distúrbios da reação emocional de medo.Unconditioned emotional responses elicited by exposure to a predator have served as the prototypical exemplar for analyses of the behavioral biology of fear-related emotionality. However, the primary research model for the study of fear has involved shock-based cue and context conditioning. While these shock-based models have provided a good understanding of neural systems regulating specific conditioned fear-related behaviors

  10. Fitoseídeos (Acari: Phytoseiidae associados a cafezais e fragmentos florestais vizinhos Phytoseiids (Acari: Phytoseiidae associated to coffee plantations and adjacent forest fragments

    Directory of Open Access Journals (Sweden)

    Ester Azevedo Silva


    Full Text Available Existem poucas informações sobre a fauna de ácaros predadores (Phytoseiidae em ambientes naturais brasileiros adjacentes a agroecossistemas cafeeiros (Coffea spp. ou sobre a influência que essa vegetação exerce como reservatório de ácaros predadores. Neste estudo, objetivou-se avaliar a diversidade destes organismos em cafeeiros e fragmentos florestais adjacentes. Coletaram-se amostras das espécies Calyptranthes clusiifolia (Miq. O. Berg (Myrtaceae, Esenbeckia febrifuga (A. St.-Hil. A. Juss. ex Mart. (Rutaceae, Metrodorea stipularis Mart. (Rutaceae e Allophylus semidentatus (Miq. Radlk. (Sapindaceae, em oito fragmentos florestais, de 5 a 51 ha, e cafezais adjacentes, nos meses de junho (final período chuvoso e outubro (final período seco nos anos 2004 e 2005, na região Sul do Estado de Minas Gerais. Ácaros foram extraídos das folhas, utilizando o método de lavagem e, em seguida, montados em lâminas de microscopia em meio de Hoyer, para identificação específica. No total foram identificados 2.348 fitoseídeos, sendo 2.090 nos fragmentos florestais e 258 espécimes nos cafezais adjacentes, pertencentes a 38 espécies. Servindo-se de análise faunística, a espécie Iphiseiodes zuluagai Denmark & Muma, 1972 apresentou os melhores índices no agroecossistema cafeeiro, sendo muito frequente e constante nas épocas estudadas. Nos fragmentos florestais Amblyseius herbicolus Chant, 1959, Iphiseiodes affs. neonobilis Denmark & Muma, 1978, Leonseius regularis DeLeon, 1965 e Euseius alatus DeLeon, 1966 foram dominantes, muito abundantes, muito frequentes e constantes nas épocas estudadas. Podemos concluir que a vegetação nativa abriga ácaros predadores, inimigos naturais de ácaros-praga, que ocorrem na cultura cafeeira, possibilitando o desenvolvimento de programas de manejo ecológico com áreas de vegetação natural e agroecossistemas cafeeiros adjacentes.There is little information about the fauna of predatory mites

  11. Alterations on piscivorous diet following change in abundance of prey after impoundment in a Neotropical river

    Directory of Open Access Journals (Sweden)

    Geuza Cantanhêde


    . pantaneiro consumiu 41 presas, enquanto que no período II foram registradas 14 presas, sendo que M. dichroura foi a presa mais consumida, passando a representar 95% da dieta, enquanto no período I representava apenas 15%. A relação entre o tamanho do predador e da presa foi positiva em ambos os períodos, porém significativamente diferente. No período II pequenos e grandes predadores consumiram principalmente pequenas presas (M. dichroura. Os resultados mostraram que A. pantaneiro consumiu, no período II, a presa mais abundante e disponível, alterando a composição de sua dieta, amplitude do nicho alimentar e tamanho da presa. Estas alterações provavelmente causaram um decréscimo nos custos energéticos associados à procura da presa, maximizando o ganho de energia do predador.

  12. Fitofagia de Podisus nigrispinus em algodoeiro e plantas daninhas Phytophagy by Podisus nigrispinus on cotton plants and weeds

    Directory of Open Access Journals (Sweden)

    Walter Santos Evangelista Júnior


    Full Text Available O objetivo deste trabalho foi avaliar o efeito de seis plantas daninhas e do algodoeiro no desenvolvimento, reprodução e sobrevivência do percevejo predador Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae sob escassez parcial de presas, alimentação em intervalos de três dias, e ausência total de presas. Com escassez parcial de presas, o desenvolvimento ninfal foi maior em Ricinus communis e menor em Bidens pilosa. Viabilidade dos ínstares, peso de fêmeas, período de pré-oviposição e fecundidade foram similares entre as plantas, porém o peso de machos e longevidade de fêmeas foram reduzidos em Desmodium tortuosum e R. communis, respectivamente. Com base nos parâmetros de tabela de vida foi estimada melhor performance do predador em Amaranthus hybridus, D. tortuosum e R. communis. Ninfas submetidas à escassez total de presas viveram mais em Ageratum conyzoides, B. pilosa, D. tortuosum e Euphorbia heterophylla; porém não viveram além do terceiro ínstar. A longevidade de fêmeas do predador foi favorecida pela presença de A. conyzoides em relação a Gossypium hirsutum, vivendo em média 15,7 e 29,8 dias, respectivamente. No entanto, a disponibilidade de plantas não foi suficiente para as fêmeas atingirem maturação sexual e produção de ovos, quando submetidas à escassez total de presas.This work evaluated the effect of six weeds and cotton plants on predatory stinkbug Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae development, reproduction and survival under partial prey scarcity, three days feeding intervals, and total absence of prey. Nymphal developmental periods under partial prey scarceness with three days of feeding intervals were higher on Ricinus communis and lower on Bidens pilosa. Partial prey scarcity did not affect nymphal viability, adult female weight and reproductive characteristics, but male weight and female longevity were reduced in Desmodium tortuosum and R. communis, respectively

  13. Impact and Selectivity of Insecticides to Predators and Parasitoids

    Directory of Open Access Journals (Sweden)

    Flávio Lemes Fernandes


    Full Text Available Problems with the use of insecticides has brought losses, such as, negative impact on natural enemies. When these beneficial insects reduce cause the eruption of pests and resurgence it’s more common. Thus principles of conservation these arthropods are extremely important in the biological natural control of pests, so that these enemies may present a high performance. Because of the negative impacts caused by insecticides on agriculture and their harmful effects on natural enemies, the objective of this article is to approach two important subjects, divided into three parts. Part I relates to the description of the main crop pests and their natural enemies; Part II involves the impact of insecticides on predators and parasitoids and Part III focuses on the selectivity of several groups of insecticides to natural enemies. Before spraying insecticides, it is necessary to choose a product that is efficient to pests and selective to natural enemies. So, it is indispensable to identify correctly the groups and species of natural enemies, since insecticides have an impact on their survival, growth, development, reproduction (sexual ratio, fecundity, longevity and fertility, and behavior (motility, orientation, feeding, oviposition and learning of insects. The mechanisms of toxicity and selectivity of insecticides are related to the properties of higher or lower solubility and molecular weight. Besides, characteristics of the cuticular composition of the integument of natural enemies are extremely important in the selectivity of a product or the tolerance of a certain predator or parasitoid to this molecules.Impacto e Seletividade de Inseticidas para Predadores e ParasitóidesResumo.Dentre os problemas advindos do uso de inseticidas, a destruição de inimigos naturais é fator importante. Estes insetos benéficos podem reduzir problemas de erupção de pragas secundárias, ressurgência de pragas e manter a praga abaixo do nível de dano econ

  14. Activity, habitat use, feeding behavior, and diet of four sympatric species of Serranidae (Actinopterygii: Perciformes in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Fernando Zaniolo Gibran


    serranídeos são predadores oportunistas que utilizam um total de nove táticas diferentes para capturar suas presas, alimentando-se principalmente de crustáceos durante o dia e crepúsculo, e permanecendo estacionários e inativos durante a noite. Um estudo ecomorfológico foi empregado para testar seu valor preditivo. Foi verificado que tal abordagem deve ser utilizada com cautela e sempre complementada com observações diretas no ambiente. Apesar de morfologicamente e comportamentalmente muito semelhantes, D. formosum e D. radiale mostraram divergências com relação ao tipo de substrato preferido pelos maiores indivíduos, que são exclusivamente predadores de espreita. Por outro lado, E. marginatus mostrou possuir hábitos de vida mais sedentários do que M. acutirostris, o mais versátil predador dentre as espécies estudadas. As espécies de Diplectrum estudadas, assim como E. marginatus, podem ser classificadas como serranídeos bentônicos, enquanto que M. acutirostris pode ser classificada como uma espécie nectobentônica.

  15. Diet of four annual killifishes: an intra and interspecific comparison

    Directory of Open Access Journals (Sweden)

    Gabriel Laufer


    Full Text Available We examined the diet of 4 annual fishes, Austrolebias viarius, Austrolebias cheradophilus, Austrolebias luteoflammulatus and Cynopoecilus melanotaenia inhabiting temporal ponds of southeastern Uruguay, by analysis of stomach contents. Fishes were captured from fifty ephemeral ponds of Castillos Lagoon basin, in the region of the Humedales del Este. We identified 13099 individual prey items extracted from 669 stomachs of the four captured species. In the studied system, annual killifishes represents the most abundant and conspicuous top predators. Killifishes are generalist key predators at the ephemeral ponds of the studied system, consuming mostly aquatic items. Zooplancton represented the bulk of the diet in the four analyzed species, followed by eggs, algae and diatoms. Insects are the next group in prey number, as follows: Diptera larvae (especially Chironomidae and Cullicidae, Ephemeroptera (especially Betidae, and coleopteran larvae (especially Dytiscidae. Acari are also important prey in number. The four fish species differ in diet composition and in diet richness. A general pattern of differences in diet richness among killifish species and demographic groups could be related to variations in body sizes. As top predators annual killifishes are an important component of the temporal pond ecosystems. Understanding the natural history of this species and their communities is necessary in order to conserve them.Nós examinamos a dieta de 4 peixes anuais, Austrolebias viarius, Austrolebias cheradophilus, Austrolebias luteoflammulatus e Cynopoecilus melanotaenia, que habitam poças temporárias do sudeste do Uruguai, através da análise de conteúdo estomacal. Os peixes foram capturados em cinco poças temporárias da bacia da lagoa Castillos, na região de Humedales del Este. Nós identificamos 13099 itens de presas estraídos de 669 estômagos das quatro espécies. No sistema estudado, peixes anuais representam os predadores de topo mais

  16. Pragas e inimigos naturais na soja e no milho cultivados em sistemas diversificados Pests and their natural enemies on soybean and corn grown in diversified systems

    Directory of Open Access Journals (Sweden)

    Francisco Jorge Cividanes


    Full Text Available A consorciação de culturas e o plantio direto podem influenciar a dinâmica populacional de insetos, aumentando ou diminuindo a densidade populacional de pragas e de inimigos naturais. Deste modo, avaliaram-se os efeitos de sistemas de plantio direto e da consorciação soja [Glycine max (L. Merrill] e milho (Zea mays L. sobre as populações de insetos-pragas e inimigos naturais. Os tratamentos constituíram um fatorial 3x2 (monocultura de soja, monocultura de milho, consorciação soja-milho em plantio direto e plantio convencional. Os insetos foram amostrados pelo método do pano, rede entomológica e procura visual. No milho, a ocorrência de insetos-pragas da parte aérea e insetos predadores não foi influenciada pelo manejo do solo. Lagartas de Helicoverpa zea ocorreram em maior número (5,1 no milho em consorciação. Na soja, adultos de Anticarsia gemmatalis e do predador Cycloneda sanguinea foram mais abundantes em plantio direto, respectivamente, 0,4 e 2,4 insetos. Observou-se maior número do sirfídeo Toxomerus sp. em plantio convencional (1,3. Nas condições de consorciação, verificou-se baixo número de Diabrotica gracilenta (11,5 na soja, enquanto que Maecolaspis sp. (5,0 e Megascelis sp. (17,0 e os predadores C. sanguinea (2,3, Doru sp. (0,8, Geocoris sp. (1,5 e Toxomerus sp. (1,4 ocorreram em alta densidade.Intercropping and no-tillage systems can affect the population dynamics of insects, increasing or decreasing the population density of pests and natural enemies. The objective of this study was to evaluate the effects of no-tillage and strip intercropping of soybean [Glycine max (L. Merrill] and corn (Zea mays L. on the abundance of insect pests and their natural enemies. Plots were arranged in a randomized complete block design in a 3 x 2 factorial experiment (soybean monoculture, corn monoculture, strip intercropping of soybean-corn under no-tillage and conventional tillage. Insects were sampled using sweep net

  17. Variação espaço-temporal na distribuição e abundância de Moenkhausia sanctaefilomenae (Characiformes: Characidae em lagoas da planície de inundação do rio Cuiabá, Pantanal, Brasil=Spatial-temporal variation of the distribution and abundance of Moenkhausia sanctaefilomenae at lagoons of the Cuiaba river floodplain, Pantanal, Brazil

    Directory of Open Access Journals (Sweden)

    Jerry Penha


    Full Text Available Identificar os fatores bióticos e abióticos que determinam a variação na distribuição e abundância das populações, tornou-se nos últimos anos um grande desafio para os ecologistas. Assim neste estudo foram avaliados o efeito das variáveis abióticas e a abundância de predadores sobre a abundância de Moenkhausia sanctaefilomenae, a variação no comprimento médio dos indivíduos entre lagoas e períodos e o efeito das variáveis abióticas e da abundância de predadores sobre a estrutura em comprimento. Foram amostradas 16 lagoas da planície de inundação do rio Cuiabá, no período de junho (vazante, setembro (seca e dezembro (enchente de 2005 e março (cheia de 2006. Para M. sanctaefilomenae, a distribuição é mais ampla e a abundância é maior no final da vazante, início da seca, reduzindo-se gradualmente ao longo dos períodos de seca, enchente e cheia. Adicionalmente, o período afeta a estrutura em tamanho das populações, que são espacialmente homogêneas. Indivíduos menores foram capturados no final do período de vazante e os maiores ao início da enchente. Durante o final da vazante/início da seca, a variação espacial na abundância da população foi relacionada positivamente com o pH, o oxigênio dissolvido e cobertura de macrófitas e área da lagoa, mas, não com a abundância local de predadores na zona litorânea das lagoas.Identifying the biotic and abiotic factors that determine the variation in the distribution and abundance of populations has become a great challenge for the field of ecology in recent years. Thus, in this study we evaluated the effect of abiotic variables and the abundance of predators on the abundance of Moenkhausia sanctaefilomenae, the variation in the average length of the individuals between lakes and periods, and the effect of the abiotic variables and abundance of predators on the structure in length of that species. Sixteen lakes of the Cuiabá river flood plain were sampled

  18. Impact and Selectivity of Insecticides to Predators and Parasitoids

    Directory of Open Access Journals (Sweden)

    Flávio Fernandes


    Resumo.Dentre os problemas advindos do uso de inseticidas, a destruição de inimigos naturais é fator importante. Estes insetos benéficos podem reduzir problemas de erupção de pragas secundárias, ressurgência de pragas e manter a praga abaixo do nível de dano econômico. Dessa forma a conservação de inimigos naturais, para que os mesmos exerçam alta performance frente às pragas, é de extrema importância em controle biológico de pragas. Método de controle essencial utilizados nos programas de manejo integrado de pragas. Tendo em vista os impactos negativos dos inseticidas na agricultura e os seus efeitos adversos sobre os inimigos naturais, este artigo visa abordar dois assuntos importantes, que para isso é dividido em três partes. A parte I relacionada com o reconhecimento das principais pragas agrícolas e seus inimigos naturais; a parte II envolve o impacto dos inseticidas sobre os predadores e parasitóides e a parte III abordará sobre a seletividade dos diversos grupos de inseticidas aos inimigos naturais. Antes de se pulverizar inseticida é necessário a escolha de um produto que seja seletivo e eficiente, assim torna-se imprescindível identificar de forma correta os grupos e espécies de inimigos naturais. Uma vez que os inseticidas apresentam impacto sobre a sobrevivência, o crescimento e desenvolvimento, na reprodução (razão sexual, fecundidade, longevidade e fertilidade, no comportamento (mobilidade, orientação, alimentação, oviposição e aprendizado. Os mecanismos de toxicidade e seletividade dos inseticidas estão relacionados às propriedades de maior ou menor solubilidade e peso molecular. Além disso, características da composição cuticular do integumento dos inimigos naturais são de extrema importância na seletividade de um produto ou a tolerância de determinado predador ou parasitóide.

  19. Ecological aspects of a Cosmopolites sordidus (Germar (Coleoptera: Curculionidae population in São Miguel do Iguaçu, PR./ Aspectos ecológicos da população de Cosmopolites sordidus, (Germar (Coleoptera: Curculionidae em São Miguel do Iguaçu, PR

    Directory of Open Access Journals (Sweden)

    Cristiane Rohde


    Full Text Available The population dynamics of Cosmopolites sordidus (Germar was studied in banana crops (cultivar Nanicão at São Miguel do Iguaçu, PR, using roof-tile-like baits, between June/2003 and May/2004. Adults infected by entomopathogenic fungi were recorded, and predators were also found on the baits. A comparative bioassay was carried out between the Beauveria bassiana isolate obtained from the experiment area and from other regions in Brazil against C. sordidus adults. The population peaks of C. sordidus adults occurred in June and July, a period with mild temperatures and low precipitation. The population of C. sordidus larvae, however, was concentrated in December. The insect predators found in the area were insects of the following orders: Coleoptera (Carabidae, Dermaptera (Forficulidae, Hemiptera (Reduviidae, Hymenoptera (Formicidae, and spiders of the families Ctenidae, Clubionidae, and Lycosidae, with a population peak two months after the pest population peak. A low number of C. sordidus adults infected by B. bassiana was found, with an annual mean of 0.44%. In the laboratory, the B. bassiana isolates were pathogenic to the insects.Estudou-se a dinâmica populacional de Cosmopolites sordidus (Germar em cultivo de banana(cultivar Nanicão, em São Miguel do Iguaçu, PR, através de iscas do tipo telha, entre junho/2003 a maio/2004. Atribuiu-se conceito ao estado de conservação da isca, visando observar sua durabilidade e atratividade. Registraram-se adultos infectados por fungos entomopatogênicos, sendo também encontrados predadores nas iscas. Realizou-se um bioensaio com isolados de Beauveria bassiana da área experimental e de Centros de Pesquisa do Brasil, para avaliar a patogenicidade em C. sordidus. Verificou-se que os picos populacionais de adultos de C. sordidus ocorreram em junho e julho, período de temperaturas amenas e baixas precipitações, enquanto que as larvas foram mais abundantes em dezembro. Os insetos predadores

  20. Parasitismo natural em ovos crisopídeos Natural egg parasitism of chrysopids

    Directory of Open Access Journals (Sweden)

    Maria Alice de Medeiros


    Full Text Available Os predadores, em geral, apresentam hábitos generalistas e por isso podem ser usados em programas de controle biológico, em diferentes agroecossistemas. A sobrevivência dos predadores é afetada por diversos fatores, como, por exemplo, a presença de parasitóides. Este trabalho foi conduzido com os objetivos de identificar os parasitóides de crisopídeos, especialmente os parasitóides de ovos, e determinar o nível de parasitismo natural. As amostragens foram feitas na Embrapa Hortaliças, em campos de milho-doce, de setembro/1997 a fevereiro/1998. Os ovos de crisopídeos foram coletados semanalmente, sendo individualizados em cápsulas de gelatina até a emergência da larva e/ou do parasitóide. Foram coletados 800 ovos de crisopídeos, sendo que em 71% dos ovos, as larvas sobreviveram; 9% dos ovos foram considerados inviáveis e 20% foram parasitados por seis espécies de microhimenópteros. Destes, 57% foram parasitados por Telenomus sp. (Scelionidae, 32% por Trichogramma pretiosum (Trichogrammatidae, 6% por Oencyrtus chrysopae Crawford (Encyrtidae e 5% por Aprostocetus sp. (Eulophidae.Most predators, in general, have generalist habits and can be used as biological control agents in several crops. Predator survival is affected by several factors, such as occurrence of parasitoids. The main purpose of this research was to identify the parasitoids of chrysopids, especially egg parasitoids and their level of parasitism. The samples were taken in a sweet-corn field at Embrapa Hortaliças from September/1997 to February/1998. The chrysopids eggs were collected weekly and then individualized in gelatine capsules until larval or parasitoid emergency. A total of 800 eggs were collected. The predator emerged from 71% of the eggs, 9% were inviable eggs and the other 20% were parasitized by six species of microhymenopterans. Among these, 57% were parasitized by Telenomus sp. (Scelionidae, 32% were parasitized by Trichogramma pretiosum

  1. Comparação econômica entre controle biológico e químico para o manejo de ácaro-vermelho em macieira Economic comparison of biological and chemical control in the management of red spider mites in apple orchard

    Directory of Open Access Journals (Sweden)

    Lino Bittencourt Monteiro


    Full Text Available O ácaro-vermelho da macieira, Panonychus ulmi (Acari: Tetranychidae, é uma importante praga na cultura da macieira em Fraiburgo - SC, e o controle biológico aplicado foi implantado em meados dos anos 90. O objetivo deste trabalho foi demonstrar os benefícios econômicos da utilização do controle biológico no manejo do ácaro-vermelho. A avaliação foi realizada em dois pomares comerciais de macieiras. Em um deles, foi implantado o controle biológico aplicado de ácaros, baseado na liberação do ácaro predador Neoseiulus californicus (Acari: Phytoseiidae, seleção de inseticidas e manejo de ervas invasoras, e o outro pomar seguiu o manejo convencional de artrópodes, baseado na aplicação de produtos químicos para o controle de insetos, ácaros fitófagos e ervas invasoras. A análise econômica mostrou que os custos com mão-de-obra e máquinas foram semelhantes em ambos os pomares, entretanto os custos com acaricidas foram significativamente inferiores no pomar onde o manejo foi o controle biológico, demonstrando que, apesar da necessidade de investimentos em instalações para a criação do ácaro predador e custos de manutenção das mesmas, a estratégia biológica foi economicamente viável.Red spider mite, Panonychus ulmi (Acari: Tetranychidae is a significant pest in apple tree in Fraiburgo, Santa Catarina (SC and applied biological control was implemented in the mid-nineties. The objective of this study was to demonstrate the economic benefits of biological control in the management of red spider mite. The assessment was carried out in two commercial orchards, one of which was subjected to biological control of spider mite by releasing the predator Neoseiulus californicus, insecticide selection and weed management, and the other to conventional arthropod management, based on the application of chemicals to control insects, phytofagous mites and weed. Economic analysis showed that the costs for labor and machines were

  2. Influência de sistemas de produção sobre a ocorrência de inimigos naturais de afídeos em pomares de pessegueiros em Araucária-PR Influence of systems of production on the occurrence of natural enemies of aphids on orchards of peach trees in Araucaria-PR

    Directory of Open Access Journals (Sweden)

    Joselia Maria Schuber


    Full Text Available A pressão da sociedade tem forçado a adoção de sistemas de produção de frutas mais sustentáveis e de menor impacto ambiental. O objetivo deste trabalho foi verificar a influência dos sistemas de produção de Boas Práticas Agrícolas (BPA e Convencional (PC sobre a diversidade de inimigos naturais de afídeos presentes em seis pomares de pessegueiros no município de Araucária-PR, de julho de 2005 a setembro de 2006. O levantamento do número de inimigos naturais foi realizado por meio de cinco métodos de amostragens: visual em plantas de pessegueiros e em plantas invasoras; armadilhas Möericke; funil e adesivas. No sistema BPA, foram coletados mais espécimes de inimigos naturais (53%, em relação aos pomares PCs (46%, havendo a ocorrência, em ambos, de predadores das famílias Syrphidae, Coccinellidae e Chrysopidae e parasitóides da ordem Hymenoptera. Do total de inimigos naturais coletados, verificou-se a ocorrência de maior quantidade de predadores de afídeos.The pressure of the society has forced the adoption of more sustainable fruit production systems and with less environmental impact. The objective of this work was to verify the influence of production systems of Good Agricultural Practices (GAP and Conventional Production (CP, about the diversity of natural enemies of aphids present on six orchards of peach trees in the city of Araucaria, PR, from July 2005 to September 2006. The evaluation of the number of natural enemies of aphid's species was made by means of five sampling methods: visual in plants of peach trees; visual in invading plants; yellow water traps of Möericke type; funnel and adhesive traps. In the system GPA, more specimens of natural enemies had been collected (53% in relation to orchards CP (46%, having the occurrence, in both orchards, of predators of the Syrphidae, Coccinellidae and Chrysopidae family and parasitoids of Hymenoptera order. Concerning the total of collected natural enemies, it was

  3. Fatores que influenciam o ataque de mosca-branca em jiloeiro Factors affecting attack rate of the whitefly on Solanum gilo

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available Este trabalho objetivou determinar os efeitos de pluviosidade e temperatura, predadores e parasitóides, dossel e idade das plantas, tipos e densidades de tricomas foliares, compostos químicos foliares, níveis de N e de K foliares, sobre a intensidade de ataque de mosca-branca Bemisia tabaci (Hemiptera: Aleyrodidae em jiloeiro Solanum gilo var. 'Gigante Portuguesa'. As densidades de ninfas e de adultos de B. tabaci foram maiores nas folhas baixeiras do que nas apicais das plantas de jiloeiro. Com o aumento da temperatura do ar, observou-se incremento na densidade de adultos de B. tabaci nas folhas de jiloeiro.The objective of this study was to determine the effect of rainfall and temperature, predators and parasitoids, height within the canopy and plant age, chemical composition of leaves, levels of nitrogen and potassium in leaves and density of trichomes in leaves, on attack intensity of the whitefly Bemisia tabaci (Hemiptera: Aleyrodidae on Solanum gilo var. 'Portuguese giant'. Densities of nymphs and of adults of B. tabaci were higher on leaves of the lower part than on those of the apical parts of plants of S. gilo. The number of adults of B. tabaci on leaves of S. gilo increased with temperature.

  4. Toxicidade residual de alguns agrotóxicos recomendado na agricultura sobre Neoseiulus californicus (McGregor (Acari: Phytoseiidae Residual toxicity of some pesticides recommended for citrus orchards on the predaceous mite Neoseiulus californicus (McGregor (Acari: phytoseiidae

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available O objetivo do trabalho foi avaliar a toxicidade residual de alguns agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor em condições de laboratório. O método de bioensaio adotado foi o de contato residual. Folhas de citros da variedade Pêra, acondicionadas em arenas, foram pulverizadas em torre de Potter. A toxicidade residual dos produtos foi avaliada duas horas e 1; 3; 5; 7; 10; 14 e 21 dias após a aplicação. Em cada arena, foram transferidas dez fêmeas adultas de N. californicus, juntamente com uma quantidade suficiente de Tetranychus urticae, como fonte de alimento. As avaliações de mortalidade foram realizadas 72 horas após a transferência dos ácaros para as arenas. Os agrotóxicos acrinathrin, deltamethrin, dinocap, enxofre, fenpropathrin, óxido de fenbutatin e propargite não causaram mortalidades significativas em adultos de N. californicus. Foram registradas mortalidades de 29,8; 24,0 e 34,1% para ácaros N. californicus expostos a resíduos de duas horas de idade de abamectim, azocyclotin e cyhexatin, respectivamente. Dicofol, pyridaben e chlorfenapyr causaram 100% de mortalidade aos ácaros predadores expostos aos resíduos tóxicos dos acaricidas, com duas horas de idade. Abamectin provocou mortalidade significativa por um período inferior a um dia. Resíduos dos acaricidas azocyclotin, cyhexatin, dicofol, pyridaben e chlorfenapyr provocaram mortalidades significativas por períodos de 1; 1; 10; 10 e 21dias, respectivamente. Os resultados obtidos no presente experimento servem de subsídio para a escolha adequada dos agrotóxicos a serem utilizados em pomares de citros nos quais N. californicus esteja presente ou naqueles em que o predador venha a ser liberado. Esses resultados também servem para a escolha do momento mais favorável para a liberação dos ácaros predadores dessa espécie no campo, após a aplicação de agrotóxicos nos pomares. Estudos conduzidos em condições de campo ainda s

  5. Colonização de macroinvertebrados bentônicos em detritos foliares em um riacho de primeira ordem na Floresta Atlântica do nordeste brasileiro

    Directory of Open Access Journals (Sweden)

    Iris Gabrielly Arruda dos Santos


    Full Text Available O objetivo do estudo foi avaliar a colonização de macroinvertebrados bentônicos em detritos foliares de Inga ingoides (Leguminosae em experimentos de campo em um riacho de primeira ordem da Mata Atlântica do Estado de Pernambuco no nordeste do Brasil. Um total de 270 bolsas de folhiço, distribuídas em três trechos do riacho com características similares em relação à morfologia e parâmetros físicos e químicos da água foram submersas, entre fevereiro a julho de 2013 e retiradas após 7, 30, 60, 90 e 120 dias. Dois tratamentos foram utilizados: colonização e exclusão da macrofauna. O percentual de biomassa remanescente final (%R foi maior para bolsas de colonização do que para as de exclusão, evidenciando a efetiva participação dos macroinvertebrados no processo de decomposição. Os fragmentadores apresentaram menor participação no processo de decomposição foliar de I. ingoides, sendo Tripletides (Trichoptera: Leptoceridae, Polypedillum e Stenochironomus (Diptera, Chironomidae os táxons predominantes na macrofauna. Filtrador foi o grupo trófico funcional predominante (45,6%, seguido por predador (31,2%, coletor (11,8%, raspador (6,7% e fragmentador (4,8%.

  6. Categorização funcional trófica das comunidades de macroinvertebrados de dois reservatórios na região Centro-Oeste do Estado de São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v31i1.331 Functional feeding groups of benthics macroinvertebrates communities of two lentic systems in the central west region of São Paulo State - DOI: 10.4025/actascibiolsci.v31i1.331

    Directory of Open Access Journals (Sweden)

    Jandira Liria Biscalquini Talamoni


    Full Text Available A utilização do conceito de guilda pode ser útil para a categorização funcional trófica de comunidades, pois não há obrigatoriedade da identificação dos organismos em nível de espécie, nem de tratar cada espécie como uma entidade separada. O objetivo deste estudo foi analisar os grupos funcionais tróficos (coletores-catadores, coletores-filtradores, fragmentadores, predadores e raspadores das comunidades de macroinvertebrados de dois reservatórios da região Centro-Oeste do Estado de São Paulo, Brasil. As amostragens foram realizadas nos períodos chuvoso (março/abril - 2001 e de seca (julho/agosto - 2001 e os dados obtidos indicam que os coletores-catadores foram a guilda mais frequente. Este fato sugere grande importância da matéria orgânica como recurso alimentar na dieta dos macroinvertebrados analisados.The aim of this study was analyze the functional feeding groups (collectors, shredders, predators and grazer-scrapers of benthic macroinvertebrates communities in two lentic systems in the central west region of São Paulo State. The samples were realized in rainy (March/April - 2001 and dry (July/August - 2001 seasons. The results obtained contribute for the best knowledgement of benthic macroinvertebrate community on those two systems.

  7. Faunistic survey of sandstone caves from Altinópolis region, São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Douglas Zeppelini Filho


    Full Text Available The fauna of eight sandstone caves of the region of Altinópolis, (Serra Geral Arenitic Speleological province, São Paulo State, Southeastern Brazil was surveyed. Our results improve the previous faunistic knowledge of the region, recording 15 new occurrences for Brazilian caves and 26 for Brazilian sandstone caves. The fauna is characterized by a large number of detritivores/omnivores such as crickets and cockroaches, and several predators like spiders and heteropterans in bat guano.A fauna de oito cavernas areníticas da região de Altinópolis (província espeleológica arenítica da Serra Geral, Estado de São Paulo, Sudeste do Brasil foi amostrada. Nossos resultados aumentaram o conhecimento faunístico prévio da região, com o registro de 15 novas ocorrências para cavernas brasileiras e 26 para cavernas brasileiras em arenito. A fauna é caracterizada por um grande número de detritívoros/carnívoros tais como grilos e baratas, diversos predadores tais como aranhas e heterópteros no guano de morcego.

  8. Efeitos do sistema de plantio e da consorciação soja-milho sobre artrópodes capturados no solo

    Directory of Open Access Journals (Sweden)

    Cividanes Francisco Jorge


    Full Text Available O objetivo deste estudo foi avaliar os efeitos do plantio direto e da consorciação soja [Glycine max (L. Merrill] e milho (Zea mays L. sobre artrópodes que vivem no solo. Os tratamentos constituíram um fatorial 3 x 2 (monocultura de soja, monocultura de milho, consorciação soja-milho x plantio direto, plantio convencional em blocos casualizados com quatro repetições; as amostragens foram efetuadas com armadilhas de solo, durante 1996 a 1998. Resultados estatisticamente significativos em pelo menos uma safra indicaram que o plantio direto foi favorável a predadores, como formigas (Brachymyrmex sp., Camponotus spp. e Ectatomma sp., carabídeos (Metius sp. e aranhas (Lycosidae. A consorciação soja-milho aumentou o número de Acrididae, enquanto a presença do milho favoreceu a ocorrência de Dermaptera em sistemas de consorciação soja-milho.

  9. A resistência aos inseticidas e sua medida em mosquitos

    Directory of Open Access Journals (Sweden)

    Mario B. Aragão


    Full Text Available Depois de um ligeiro histórico scbre a evolução dos inseticidas, o autor chama a atenção para a mudança radical sofrida pela tática de combate a insetos, cem o aparecimento dos inseticidas orgânicos persistentes. Antes o que se visava era o inseto ou o seu alimento, depois passou-se a envenenar todo o espaço frequentado por esses animais. Lembra que existem, em alguns lugares, ambientes naturalmente envenenados onde prosperam seres vivos, perfeitamente adaptados a essas condições. Isso permitia prever o aparecimento de resistência aos inseticidas na escala hoje observada. Cita alguns çens e enzimas responsáveis pela resistência a alguns grupos de inseticidas e salienta a importância desses estudos para a descoberta de substâncias sinergentes. Descreve a técnica adotada pela Organização Mundial da Saúde para medir a susceptibilidade de mosquitos adultos. Menciona os processos de controle biológico por machos esterilizados, parasitas e predadores, e lembra que as duas campanhas contra insetos de importância sanitária que tiveram maior êxito no Brasil, a do Aedes aegypti e a do Anopheles gambiae, utilizaram táticas ecléticas, como é hoje preconizado pelos cntomologistas de vanguarda, no que se convencionou chamar de luta integrada.

  10. Predation on Alouatta guariba clamitans Cabrera (Primates, Atelidae by Leopardus pardalis (Linnaeus (Carnivora, Felidae Predação em Alouatta guariba clamitans Cabrera (Primates, Atelidae por Leopardus pordalis (Linnaeus (Carnivora, Felidae

    Directory of Open Access Journals (Sweden)

    João M. D. Miranda


    Full Text Available There are a few studies about predation on primates. Howler monkeys, being relatively large animals, were believed to be preyed on successfully only by medium to large-sized carnivores and large birds of prey. Our study took place at Chácara Payquerê, which is situated in the municipality of Balsa Nova, State of Paraná, Southern Brazil. Fingers and nails from Alouatta guariba clamitans Cabrera, 1940 were founded in two faecal samples from Leopardus pardalis (Linnaeus, 1758. With our documentation large howler monkey remains in faeces, the possibility of ocelot being a potential predator of all Neotropical primates should be taken into consideration.São poucos os estudos sobre a predação de primatas. Sendo os bugios animais relativamente grandes, acredita-se que somente médios e grandes carnívoros e grandes rapineiros possam lograr sucesso em sua predação. O estudo foi realizado na Chácara Payquerê, situada no município de Balsa Nova, Estado do Paraná, sul do Brasil. Dedos e unhas de Alouatta guariba clamitans Cabrera, 1940 foram encontradas em duas amostras fecais de Leopardus pardalis (Linnaeus, 1758 que foram coletadas. Com este registro de grande primata em fezes, a possibilidade de a jaguatirica ser um potencial predador de todos os primatas neotropicais pode ser levada em consideração.

  11. Dinámica de polifenoles y estudio anatomo-histoquímico en Schinus longifolius (Lindl. Speg. (Anacardiaceae en respuesta a la infección por Calophya mammifex (Hemiptera - Calophyidae

    Directory of Open Access Journals (Sweden)

    Ignacio AGUDELO


    Full Text Available Se analizaron los fenoles totales, taninos totales, proantocianidinas, flavonoides totales y ácidos hidroxicinámicos totales de hojas sanas y agallas de Schinus longifolius (Lindl. Speg. (Anacardiaceae infectado por Calophya mammifex (Hemiptera - Calophyidae. La agalla presenta una variación cuali-cuantitativa de los polifenoles estudiados, con una disminución de los fenoles, taninos, flavonoides y ácidos hidroxicinámicos y un aumento en el contenido de proantocianidinas, cuyo monómero se transforma en cianidina luego del clivaje ácido. Se realizó además un análisis anatómico de la agalla donde se encontraron acúmulos de esclereidas y un mayor desarrollo vascular respecto de la hoja sana y un ensayo histoquímico que mostró una expresión diferencial de metabolitos polifenólicos en sus tejidos. C. mammifex utiliza la agalla como refugio contra las condiciones climáticas adversas y predadores y provee además de alimento con menos compuestos potencialmente perjudiciales en las etapas tempranas de su desarrollo.

  12. Lesiones post mortales por fauna cadavérica: La acción de las hormigas sobre el cadáver Post-mortal injuries by cadaveric fauna: The action of the ants on human corpses

    Directory of Open Access Journals (Sweden)

    P.M. Garamendi


    Full Text Available Los animales pueden actuar como predadores de los restos humanos y las lesiones postmortales que infligen en los cadáveres pueden dar lugar a errores de interpretación de los hallazgos en las autopsias forenses. Entre la fauna cadavérica, las hormigas constituyen un caso excepcional al ser los únicos insectos que pueden iniciar su actividad predadora antes de instaurarse la putrefacción. Las hormigas suelen producir lesiones que por su asiento y morfología resultan típicas. Se presenta un caso en el que se evidencia la presencia de lesiones de morfología típica por la acción lesiva postmortal de hormigas, pero con una extensión y localización inhabituales.Post-mortem animal predation can lead to errors when interpreting forensic autopsy findings. Ants are the only insects that can attack human corpses after death and before decomposition process starts. Ants produce post mortal injuries in the skin that have a distinct location and morphology. We present a forensic case in which post mortal injuries produced by ants in a human corpse had a typical morphology; however their location and extension were unusual.

  13. Use of the flooded forest by fish assemblages in lakes of the National Park of Anavilhanas (Amazonas, Brazil Uso do igapó por assembléias de peixes nos lagos no Parque Nacional das Anavilhanas (Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Janette Noveras


    Full Text Available We evaluated diversity and distribution of fish species in two habitats: flooded forest and open water of lakes of Rio Negro. Each of four lakes within the Anavilhanas Archipelago was sampled three times from 2009-2010. Species diversity generally was higher in flooded forests and at night, according to correspondence analysis. Predators were most active at night, but showed no preference between the flooded forest and open water habitats. Omnivores, filter feeders, and detritivores were most active during the day.Avaliamos a diversidade e a distribuição de espécies de peixes em dois habitats: floresta alagada e água aberta de lagos do rio Negro. Três amostragens foram realizadas em quatro lagos do Arquipélago de Anavilhanas, em 2009 e 2010. Em geral, a diversidade de espécies foi maior na floresta alagada e durante a noite. A análise de correspondência indicou que predadores estavam mais ativos a noite nos dois habitats. Onívoros, filtradores e detritívoros foram mais capturados durante o dia.


    Directory of Open Access Journals (Sweden)

    Mario Arthur Favretto


    Full Text Available O presente trabalho teve como objetivo caracterizar a entomofauna aquática em um lago artificial no perímetro urbano no município de Joaçaba, estado de Santa Catarina, sul do Brasil. As coletas foram realizadas nos meses de agosto, outubro, novembro e dezembro de 2013, durante o período matutino com auxílio de rede entomológica. No total foram coletados 300 exemplares divididos em cinco ordens. Odonata foi a ordem mais abundante, tendo sido representada por Coenagrionidae, Lestidae e Aeshnidae. Ainda Hemiptera foi representada por Notonectidae, Belostomatidae, Nepidae, Gerridae, Mesovellidae e Corixidae e Ephemeroptera com Baetidae. Quanto aos grupos tróficos funcionais, 85% das espécies foram de predadores, 10% de fragmentadores/coletores e 5% de coletores. Palavras-chave: Entomofauna aquática. Hemiptera. Odonata. Sul do Brasil. DOI:

  15. A Century of Shope Papillomavirus in Museum Rabbit Specimens.

    Directory of Open Access Journals (Sweden)

    Clara Escudero Duch

    Full Text Available Sylvilagus floridanus Papillomavirus (SfPV causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, and whether SfPV occurs throughout the host range, or just in the Midwest. Secondary aims were to detect distinct strains, and evidence for strain spatio-temporal specificity. We found 20 of 1395 rabbits in the KU collection SfPV symptomatic. Three of 17 lagomorph species (S. nuttallii, and the two known hosts were symptomatic, while Brachylagus, Lepus and eight additional Sylvilagus species were not. 13 symptomatic individuals were positive by molecular testing, including the first S. nuttallii detection. Prevalence of symptomatic individuals was significantly higher in Sylvilagus (1.8% than Lepus. Half of these specimens came from Kansas, though new molecular detections were obtained from Jalisco-Mexico's first-and Nebraska, Nevada, New Mexico, and Texas, USA. We document the oldest lab-confirmed case (Kansas, 1915, pre-dating Shope's first case. SfPV amplification was possible from 63.2% of symptomatic museum specimens. Using multiple methodologies, rolling circle amplification and, multiple isothermal displacement amplification in addition to PCR, greatly improved detection rates. Short sequences were obtained from six individuals for two genes. L1 gene sequences were identical to all previously detected sequences; E7 gene sequences, were more variable, yielding five distinct SfPV1 strains that differing by less than 2% from strains circulating in the Midwest and Mexico, between 1915 and 2005. Our results do not clarify whether strains are host species

  16. Density and habitat requirements of sympatric hares and cottontails in northern Italy

    Directory of Open Access Journals (Sweden)

    Anna Vidus Rosin


    Full Text Available Abstract From 2005 to 2009, densities and habitat selection by the European hare (Lepus europaeus and Eastern cottontail (Sylvilagus floridanus were assessed during feeding activity in an intensively cultivated area in northern Italy. Hare average density (74 ind./km2 was comparable to the highest values reported for European farming areas. Preand post-breeding density fluctuated widely across the study years, probably as a consequence of changes in the carrying capacity of the study area. Cottontail population size progressively increased, as expected for a recently introduced species supported by high reproductive performances. Hares used both crops and spontaneous vegetation during their feeding activity. Conversely, cottontails avoided winter cereals and preferred to feed on alfalfa. Our results suggest that simplified agro-ecosystems cannot maintain high density hare populations even at a short time scale. Landscape heterogeneity could enhance the chances of coexistence between the two lagomorphs.
    Riassunto Densità ed esigenze ecologiche della lepre e del silvilago in condizioni di simpatria in Italia settentrionale Tra il 2005 e il 2009, la densità e l’uso del habitat durante l’attività di alimentazione da parte della Lepre europea (Lepus europaeus e del Silvilago (Sylvilagus floridanus sono stati indagati in un’area intensamente coltivata nell’Italia settentrionale. La densità media della lepre nell’area di studio (74 ind./km2 corrisponde ai valori maggiori riportati per le aree agricole europee. Le densità pre- e post riproduttive della lepre hanno mostrato sensibili fluttuazioni durante il periodo di studio, probabilmente dovute ai cambiamenti stagionali della capacità portante dell’area di studio. L’abbondanza del silvilago è aumentata durante gli ultimi tre anni di studio, come prevedibile per una

  17. Colonization of artificial substrata by teredinid larvae released from a previously infested focus at Ilha Grande Bay, RJ

    Directory of Open Access Journals (Sweden)

    Ricardo Silva Varotto


    Full Text Available The colonization pattern of wooden panels by teredinid larvae released from a previously infested focus was investigated. Panels were placed at different distances (1, 10, 20m and in different directions from the focus. The colonization experiment took place at Parcel do Aleijado, Ilha Grande Bay, RJ. The focus remained immersed in nearly surface water, by the coast, during three months for infestation by teredinids. After this period, it was transferred to the study site. The infested focus and colonization panels remained in water, 10m deep, for three months more. Total density and density of the dominant species were considered for each group of panels. Five teredinid species were found: Bankia fimbriatula, Bankia gouldi, Lyrodus floridanus, Lyrodus massa and Teredo furcifera. The dominant species was Teredo furcifera (76.6%. Significant differences were only observed between directions for total teredinids and for dominant species density. Results concerning the dominant species Teredo furcifera were even more expressive and suggested the occurrence of a local water circulation pattern.Foi estudado o padrão de colonização de larvas de teredinídeo liberadas a partir de um foco previamente infestado. Coletores foram posicionados a diferentes distâncias (1m, 10m, 20m e em diferentes sentidos a partir do foco. O experimento de colonização foi realizado junto ao Parcel do Aleijado, Baía da Ilha Grande, RJ. O foco permaneceu imerso próximo à superfície, junto à costa, durante 3 meses para infestação por teredinídeos. Após este período, foi tranferido para a área de estudo. O foco infestado e os coletores permaneceram imersos, a 10m de profundidade, por mais 3 meses. Foram consideradas a densidade total e a densidade da espécie dominante para cada grupo de coletores. Foram encontradas 5 espécies de teredinídeos: Bankia fimbriatula, Bankia gouldi, Lyrodus floridanus, Lyrodus massa and Teredo furcifera. A espécie dominante foi

  18. Prevalence of antibodies to Toxoplasma gondii in wild mammals of Missouri and east central Kansas: biologic and ecologic considerations of transmission. (United States)

    Smith, D D; Frenkel, J K


    Sera from 273 wild mammals from Missouri and Kansas (USA), collected between December 1974 and December 1987, were tested for the presence of antibodies to Toxoplasma gondii using the Sabin-Feldman dye test. Sixty-five (24%) had antibodies at titers of > or = 1:8, including 38 (66%) of 58 carnivores, 14 (15%) of 94 omnivores, 13 (11%) of 117 herbivores, and none of four insectivores. The prevalence of antibodies in mice (Mus musculus and Peromyscus spp.) and rats (Rattus norvegicus and Sigmodon hispidus) was low (3%), while medium sized herbivores such as squirrels (Sciurus spp.), rabbits (Sylvilagus floridanus), and muskrats (Ondatra zibethicus) had prevalences of about 18%. Red foxes (Vulpes fulva) and mink (Mustela vison) had the highest prevalence of antibodies with frequencies of 90 and 66%, respectively. In 32 attempts to isolate Toxoplasma gondii from wild mammals with positive (> or = 1:4) titers, only six (19%) were successful: a gray squirrel (Sciurus carolinensis), a beaver (Castor canadensis), an opossum (Didelphis marsupialis), a red fox and two mink. These findings are consistent with the hypothesis that the probability of infection with Toxoplasma gondii, and therefore prevalence of antibodies in wildlife, is greatest in carnivores. PMID:7563419

  19. Analyses of mammalian sera in enzyme-linked immunosorbent assays with different strains of Borrelia burgdorferi sensu lato. (United States)

    Magnarelli, L A; Anderson, J F; Johnson, R C


    Blood samples were collected from cottontail rabbits (Sylvilagus floridanus), raccoons (Procyon lotor), white-footed mice (Peromyscus leucopus), and white-tailed deer (Odocoileus virginianus) between 1977 and 1991 in southern Connecticut and New York State (USA) and were tested for antibodies against eight strains of Borrelia burgdorferi sensu lato in enzyme-linked immunosorbent assays. Among these spirochetes were six strains of B. burgdorferi sensu stricto, one strain of B. garinii (=IP90) and a strain (IPF) in group VS461. Sera from each study group reacted positively to all strains having origins in North America and Eurasia. Assay sensitivities normally ranged between 85% and 100% for all study groups. The lowest sensitivity (66%) was noted when mouse sera were tested with B. garinii, an isolate from Ixodes persulcatus in the former Soviet Union. Differences in serum reactivity to various strains were noted for all study groups, but because of multiple shared antigens among the closely related spirochetes tested, the selection of a particular North American strain of B. burgdorferi sensu stricto did not appear to be a critical factor for optimal assay performance. Locally obtained strains of this bacterium are preferred as coating antigens for serologic testing because of their availability. PMID:8583632

  20. First isolation and cultivation of Borrelia burgdorferi sensu lato from Missouri. (United States)

    Oliver, J H; Kollars, T M; Chandler, F W; James, A M; Masters, E J; Lane, R S; Huey, L O


    Five Borrelia burgdorferi sensu lato isolates from Missouri are described. This represents the first report and characterization of such isolates from that state. The isolates were obtained from either Ixodes dentatus or Amblyomma americanum ticks that had been feeding on cottontail rabbits (Sylvilagus floridanus) from a farm in Bollinger County, Mo., where a human case of Lyme disease had been reported. All isolates were screened immunologically by indirect immunofluorescence by using monoclonal antibodies to B. burgdorferi-specific outer surface protein A (OspA) (antibodies H3TS and H5332), B. burgdorferi-specific OspB (antibody H6831), Borrelia (genus)-specific antiflagellin (antibody H9724), and Borrelia hermsii-specific antibody (antibody H9826). Analysis of the isolates also involved a comparison of their protein profiles by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Finally, the isolates were analyzed by PCR with six pairs of primers known to amplify selected DNA target sequences specifically found in the reference strain B. burgdorferi B-31. Although some genetic variability was detected among the five isolates as well as between them and the B-31 strain, enough similarities were found to classify them as B. burgdorferi sensu lato. PMID:9431909

  1. Lead bioaccessibility in food web intermediates and the influence on ecological risk characterization. (United States)

    Kaufman, Claire A; Bennett, Joseph R; Koch, Iris; Reimer, Kenneth J


    Models simulating gastric conditions of mammalian (eastern cottontail, Sylvilagus floridanus; short-tailed shrew, Blarina brevicauda) and avian (American robin, Turdus migratorius) receptors were used to investigate the proportion of lead (Pb) mobilized into the digestive juices (the bioaccessible fraction) from soil, earthworms, and vegetation collected at a rifle and pistol (RP) range in eastern Ontario, Canada. Pb concentrations averaged 5044 mg kg(-1) in RP range surface soils, 727 mg kg(-1) in earthworm tissue, and 2945 mg kg(-1) in unwashed vegetation. For mammalian gastric models, the bioaccessible fraction of Pb in soils was 66 +/- 22%, in earthworm tissue was 77 +/- 14%, and in unwashed vegetation was 50 +/- 37%. For the avian gastric model, the bioaccessible fraction of Pb in soil was 53 +/- 43% and in earthworm tissue was 73 +/- 13%. The incorporation of soil and food web intermediate bioaccessibility data into standard risk calculations resulted in predicted risk being reduced for all receptors. The inclusion of bioaccessibility during ecological risk assessment affords a more realistic estimate of contaminant exposure, and is a valuable tool for use in contaminated sites management. PMID:17874804

  2. Ticks (Acari: Ixodidae) collected from small and medium-sized Kansas mammals. (United States)

    Brillhart, D B; Fox, L B; Upton, S J


    Seven species of hard-bodied ticks were collected from 20 species of small and medium-sized mammals in Kansas; Amblyomma americanum L., Dermacentor variabilis (Say), Haemaphysalis leporispalustris (Packard), Ixodes cookei Packard, I. kingi Bishopp, I. sculptus Neumann, and I. texanus Banks. Dermacentor variabilis was found statewide, A. americanum only in the eastern one-third of the state, and the Ixodes spp. and H. leporispalustris were widely scattered. The most common tick found was D. variabilis, both by itself and in association with other ticks. Mammals that ticks were collected from included Canis latrans Say, Cynomys ludovicianus ludovicianus (Ord), Didelphis virginianus Kerr, Geomys bursarius (Shaw), Lynx rufus (Schreber), Marmota monax bunkeri Black, Mephitis mephitis (Schreber), Microtus ochrogaster (Wagner), Mus musculus L., Peromyscus leucopus (Rafinesque), P. maniculatus (Wagner), Procyon lotor hirtus Nelson and Goldman, Reithrodontomys megalotis (Baird), Sciurus niger rufiventer Geoffroy, Sigmodon hispidus texianus (Audubon and Bachman), Sylvilagus floridanus (J. A. Allen), Taxidea taxus taxus (Schreber), and Vulpes velox velox (Say). PMID:8057327

  3. Ixodes dammini (Acari: Ixodidae) infestation on medium-sized mammals and blue jays in northwestern Illinois. (United States)

    Mannelli, A; Kitron, U; Jones, C J; Slajchert, T L


    High prevalence of infestation of five species of medium-sized mammals and blue jays, Cyanocitta cristata (L.), by immature Ixodes dammini Spielman, Clifford, Piesman and Corwin was found in Castle Rock State Park in northwestern Illinois during May-August 1991. Raccoons, Procyon lotor L., and opossums, Didelphis virginiana Kerr, were infested with the highest larval densities and were trapped primarily in bottomland forest and ecotone habitats. All species had similar nymphal densities, except the eastern cottontails, Sylvilagus floridanus Allen, which were infested with fewer nymphs. Infestation by I. dammini is reported for the first time for fox squirrels, Sciurus niger E. G. St. Hilaire, and for the first time in the midwestern United States for blue jays, C. cristata. These two species were hosts for nymphs in upland forest habitat. Molting rates varied among ticks that fed on different host species and among larvae that fed on individuals of the same species. Molting rate is proposed as an important factor in determining the relative importance of a host species to I. dammini population dynamics. PMID:8254647

  4. Methicillin-resistant Staphylococcus aureus in central Iowa wildlife. (United States)

    Wardyn, Shylo E; Kauffman, Lin K; Smith, Tara C


    Livestock and pets have been identified as carriers of Staphylococcus aureus; however, the role of wild animals as a reservoir of S. aureus strains has not yet been examined. We conducted a pilot study to determine the prevalence of methicillin-sensitive S. aureus (MSSA) and methicillin-resistant S. aureus (MRSA) in 37 species of wild animals rehabilitated at a university clinic. Nasal, wing, wound, and cloacal swabs were collected. Of 114 animals, seven (6.1%) were MSSA-positive and three (2.6%) were MRSA-positive. The MRSA isolates were obtained from two eastern cottontail rabbits (Sylvilagus floridanus) and a Lesser Yellowlegs (Tringa flavipes), a migratory shorebird. Antibiotic resistance testing of the MRSA isolates revealed that two were additionally resistant to tetracycline and erythromycin, and the third isolate was also resistant to erythromycin, clindamycin, and levofloxacin. All three isolates were positive for the Panton-Valentine leukocidin (PVL) gene. Sequence typing of the staphylococcal protein A (spa) region revealed one MRSA isolate to be t002, whereas the other two MRSA isolates were found to be t008. Our results suggest that S. aureus, including MRSA, is being carried by wild animals, although at a low prevalence with the limited number of animals tested. Additional studies are needed to determine how this may impact human health. PMID:23060511

  5. [Mammals' camera-trapping in Sierra Nanchititla, Mexico: relative abundance and activity patterns]. (United States)

    Monroy-Vilchis, Octavio; Zarco-González, Martha M; Rodríguez-Soto, Clarita; Soria-Díaz, Leroy; Urios, Vicente


    Species conservation and their management depend on the availability of their population behavior and changes in time. This way, population studies include aspects such as species abundance and activity pattern, among others, with the advantage that nowadays new technologies can be applied, in addition to common methods. In this study, we used camera-traps to obtain the index of relative abundance and to establish activity pattern of medium and large mammals in Sierra Nanchititla, Mexico. The study was conducted from December 2003 to May 2006, with a total sampling effort of 4 305 trap-days. We obtained 897 photographs of 19 different species. Nasua narica, Sylvilagus floridanus and Urocyon cinereoargenteus were the most abundant, in agreement with the relative abundance index (RAI, number of independent records/100 trap-days), and according to previous studies with indirect methods in the area. The activity patterns of the species showed that 67% of them are nocturnal, except Odocoileus virginianus, Nasua narica and others. Some species showed differences with previously reported patterns, which are related with seasonality, resources availability, organism sex, principally. The applied method contributed with reliable data about relative abundance and activity patterns. PMID:21516657

  6. Bird-feeding ticks transstadially transmit Borrelia burgdorferi that infect Syrian hamsters. (United States)

    Anderson, J F; Magnarelli, L A; Stafford, K C


    Bird-feeding Ixodes dammini ticks were documented for the first time to successfully molt and transstadially pass Borrelia burgdorferi spirochetes that were indistinguishable by sodium dodecyl sulfate-polyacrylamide gel electrophoresis from the type B31 strain. Forty-six of 73 blood-engorged larvae and 50 of 66 fully-fed nymphs, removed from wild-caught birds, successfully molted. Borreliae were isolated from 21 of 78 partially- and fully-fed larvae off birds, including six specimens that molted. Spirochete-positive cultures also were obtained from 35 of 60 partially- and fully-fed nymphs that had fed from birds, including 20 nymphs that molted into adult ticks. Transstadially passed borreliae by bird-feeding larval and nymphal I. dammini were infectious to hamsters, leading us to suggest that these ticks are capable of subsequently transmitting infectious spirochetes to mammals, including humans. An isolated of B. burgdorferi, recovered from a bird-feeding larval Ixodes dentatus, was indistinguishable by sodium dodecyl sulfate-polyacrylamide gel electrophoresis from the B31 strain. This isolate, unlike another from I. dentatus off a cottontail rabbit (Sylvilagus floridanus), had a protein band with a molecular weight of approximately 31,000 that reacted with murine monoclonal antibodies H3TS and H5332 in western blot analysis. Thus, closely related borreliae are present in both I. dentatus and I. dammini. PMID:2304189

  7. Isolation of Mycobacterium avium subsp paratuberculosis (Map) from feral cats on a dairy farm with Map-infected cattle. (United States)

    Palmer, Mitchell V; Stoffregen, William C; Carpenter, Jeremy G; Stabel, Judith R


    Paratuberculosis is an economically important disease of dairy cattle caused by Mycobacterium avium subsp. paratuberculosis (Map). The role of nonruminant, nondomestic animals in the epidemiology of paratuberculosis in cattle is unclear. To examine nonruminant, nondomestic animals for the presence of Map, 25 feral cats, nine mice (species unknown), eight rabbits (Sylvilagus floridanus), six raccoons (Procyon lotor), and three opossums (Didelphis virginiana) were collected from a mid-western dairy with known Map-infected cattle. Mycobacterium avium subsp. paratuberculosis was isolated from the mesenteric lymph node from seven of 25 (28%) feral cats. Ileum was culture-positive for three of these seven cats, and an isolation of Map was also made from the ileum of one of nine (11%) mice. Tissue samples from other species were negative as determined by Map culture; microscopic lesions consistent with paratuberculosis were not seen in any animal. Restriction fragment polymorphism analysis of isolates from cats and dairy cattle suggest interspecies transmission. The means by which interspecies transmission occurred may be through ingestion of Map-contaminated feces or waste milk or through ingestion of Map-infected prey. Shedding of Map from infected cats was not evaluated. The epidemiologic role of Map-infected feral cats on dairy farms requires further investigation. PMID:16244077

  8. Humoral immune response of cottontail rabbits naturally infected with Francisella tularensis in southern Illinois. (United States)

    Shoemaker, D; Woolf, A; Kirkpatrick, R; Cooper, M


    Cottontail rabbits (Sylvilagus floridanus) usually are thought to succumb to infection with Francisella tularensis. Reports of a rabbit population from southern Illinois (USA) with a high prevalence of F. tularensis antibodies suggested that some cottontails survived infection with this typically fatal bacterium. Our goal was to examine the humoral response of cottontails from a study area in southern Illinois for which multiple serum samples existed. Multiple sera were collected from 79 cottontails from 1986 to 1990 and 63% gained, lost, or maintained ELISA titers of IgM and IgG isotype antibodies. The typical pattern of antibody response appeared to be IgM isotype antibodies first, followed by IgG isotype antibodies, with both generally increasing to high titers. Negative culture attempts of liver tissue from 51 cottontails with varying antibody responses suggested that chronic infection did not occur in rabbits that developed antibody. The significance of the cottontail antibody response in resolution or prevention of tularemia infection remains unclear. PMID:9391956

  9. Pathogenesis of Herpesvirus sylvilagus infection in cottontail rabbits. (United States)

    Hesselton, R M; Yang, W C; Medveczky, P; Sullivan, J L


    Experimental infection with Herpesvirus sylvilagus produces clinical and histopathologic changes in its natural host, the cottontail rabbit (Sylvilagus floridanus), similar to those observed in humans acutely infected with Epstein-Barr virus (EBV). Twenty-seven seronegative cottontail rabbits were infected with Herpesvirus sylvilagus and all developed antibodies within 10 days. Neutralizing antibody was detected as early as 7 days after infection. Virus was isolated from blood mononuclear cells, spleen, bone marrow, thymus, lymph nodes, kidneys, lung, and liver as early as 3 days after infection. Infected animals showed leucocytosis, monocytosis, and lymphocytosis with the appearance of atypical lymphocytes. Peripheral blood abnormalities peaked at 10-14 days after infection, and returned to normal by 28 days after infection, with the exception of atypical lymphocytosis that persisted in some animals for more than 2 years after experimental infection. More severe histopathologic changes were seen in virus-infected juvenile rabbits than adult rabbits; these changes included viral myocarditis, interstitial pneumonia, and lymphocytic myositis. Reactive hyperplasia and subsequent lymphocytic depletion of spleen and lymph nodes were reminiscent of that seen in virus-associated hemophagocytosis syndrome. Prominent lymphoid hyperplasia of many nonlymphoid organs, most notably the kidney and lungs, was observed. The development of these lymphoproliferative lesions and other lymphoid changes during H. sylvilagus infection suggest that this system may be a model to study similar lesions induced by EBV infection in humans. PMID:2849303

  10. Enzootic transmission of the agent of Lyme disease in rabbits. (United States)

    Telford, S R; Spielman, A


    To determine whether cottontail rabbits (Sylvilagus floridanus) maintain an enzootic cycle of transmission of the Lyme disease spirochete (Borrelia burgdorferi), we examined the prevalence of infection in ticks and rabbits in a location in which rabbits were abundant. Of 72 unfed nymphal Ixodes dentatus swept from vegetation, 32% were infected by this spirochete, as determined by darkfield microscopy and indirect immunofluorescence using monoclonal antibody H5332. Infected ticks were reared from larvae feeding on each of 11 rabbits taken from the same site. Of 50 rabbits sampled there over a period of 2 years, sera of greater than 90% reacted with B. burgdorferi antigen by ELISA and by immunoblotting. Deer ticks (I. dammini) comprised less than 10% of ticks found on rabbits. We conclude that rabbits perpetuate the agent of Lyme disease in an enzootic cycle where rabbit-feeding Ixodes are abundant, that intensity of transmission is independent of the zoonotic cycle in mice, but that infection may occasionally be exchanged between these cycles. PMID:2802026

  11. The definitive and intermediate hosts of Fasciola hepatica in the natural watercress beds in central France. (United States)

    Rondelaud, D; Vignoles, P; Abrous, M; Dreyfuss, G


    Field investigations were carried out over a two-year period in 52 natural watercress beds located in the Limousin region of central France to list the mammal and bird species that frequented these sites. This enabled detection of the definitive hosts of Fasciola hepatica and determination of the prevalence of natural infection in snails. A total of 13 mammal and five bird species were listed in these watercress beds. Adult flukes were found in Lepus capensis (39.2%), Oryctolagus cuniculus (42.0%), and Sylvilagus floridanus (25.0%). No infection with F. hepatica was noted in the five species of rodents studied. Snails infected with F. hepatica were found in 14 watercress beds. The global prevalence of natural infection was 1.1% in Lymnaea truncatula and 0.3% in L. glabra. Among the other trematode larval forms detected, the most frequent was Haplometra cylindracea (0.5%). In the Limousin region, the presence of hares and rabbits in watercress beds ensured the continuation of the F. hepatica life cycle and permitted the subsequent infection of humans when this wild watercress was eaten. PMID:11411948

  12. Nonneutral evolution of tandem repeats in the mitochondrial DNA control region of lagomorphs. (United States)

    Casane, D; Dennebouy, N; de Rochambeau, H; Mounolou, J C; Monnerot, M


    The mitochondrial DNA of the European rabbit (Oryctolagus cuniculus) contains a tandem array of 153-bp repeats in the vicinity of the replication origin of the H-stand. Variation among molecules in the number of these repeats results in inter- and intraindividual length polymorphism (heteroplasmy). Generally, in an individual, one predominant molecular type is observed, the others representing a low percentage of the mtDNA content. At the tissue level, we observe a particular distribution of this polymorphism in the gonads compared with liver, kidneys, or brain, implying a relationship between the differentiation status of the cells and the types of new mtDNA molecules which appear and accumulate during lifetime. Similar tandem repeats were also found in the mtDNA noncoding region of European hares (Lepus europaeus), a cottontail (Sylvilagus floridanus), and a pika (Ochotona rufescens). The lengths and the sequences of these units evolve rapidly and in a concerted way, but the number of repeats is maintained in a narrow range, and an internal 20-bp segment is highly conserved. Constraints restrict the evolution of the primary sequence of these repeated units, the number of which is probably controlled by a stabilizing selection. PMID:9254915

  13. Host utilization and seasonal occurrence of Dermacentor species (Acari:Ixodidae) in Missouri, USA. (United States)

    Kollars, T M; Oliver, J H; Masters, E J; Kollars, P G; Durden, L A


    A total of 3,235 Dermacentor variabilis (Say) specimens were collected from birds, mammals, and by dragging vegetation, and 2,683 D. albipictus (Packard) ticks were collected from deer from 1993 to 1996. Peak seasonal occurrence of adult D. variabilis was from May through July with a precipitous decrease in August. Nymphal D. variabilis populations peaked in June. Peak activity of larvae was bimodal, with one activity peak during late summer (September) and a second peak in winter or early spring. The raccoon, Procyon lotor (L.), was the principal host of adults followed by the Virginia opossum, Didelphis virginiana Kerr. Rodents and the eastern cottontail rabbit, Sylvilagus floridanus (J. A. Allen), were the primary hosts of nymphs. The marsh rice rat, Oryzomys palustris (Harlan), was the principal host of larvae followed by the pine vole, Microtus pinetorum (Le Conte), and white-footed mouse, Peromyscus leucopus (Rafinesque). All stages of D. albipictus were found only on white-tailed deer, Odocoileus virginianus (Zimmermann). Numbers of adult and nymphal D. albipictus peaked in November, whereas larvae peaked in September. PMID:11201355

  14. Heavy metals in cottontail rabbits on mined lands treated with sewage sludge. [Sylvilagus floridanua

    Energy Technology Data Exchange (ETDEWEB)

    Dressler, R.L.; Storm, G.L.; Tzilkowski, W.M.; Sopper, W.E.

    Levels of heavy metals in soils, vegetation, and tissues of cottontail rabbits (Sylvilagus floridanus) on a Pennsylvania strip-mined site treated with sewage sludge were compared with those from a non-treated mine site to determine increases due to treatment effect. Concentrations of Cd, Cu, and Zn were higher in vegetation on the sludge-treated site. Zinc was higher in femurs of cottontails from the treated site, but levels of most metals in the tissues of cottontail rabbits from the treated site were comparable to those from a non-treated mine site and a nonmined area. Baseline values for the uptake of Cd were documented with captive cottontail rabbits fed diets supplemented with 0, 5, or 25 mg Cd kg/sup -1/. Captive rabbits fed diets supplemented with a Cd salt accumulated increasing levels of Cd in their tissues, except for muscle, as the dietary intake of Cd increased. Liver and muscle tissue of rabbits collected on treated mine sites contained higher Cd levels than laboratory controls, but overall, cottontail rabbits did not accumulate metals on the sludge-treated site at hazardous levels.

  15. The role of cottontail rabbits (Sylvilagus spp.) in the ecology of Rickettsia rickettsii in the United States. (United States)

    Burgdorfer, W; Cooney, J C; Mavros, A J; Jellison, W L; Maser, C


    Rocky Mountain (Sylvilagus nuttallii) and eastern (S. floridanus) cottontails were examined for their susceptibility to virulent and avirulent strains of the spotted fever agent, Rickettsia rickettsii. Both species of rabbits responded to inoculation of yolk sac suspensions containing 500 egg LD50 of either virulent or avirulent rickettsiae, with rickettsemias detectable as early as 3 days after inoculation and lasting up to 7 days. When fed upon by infected ticks, only one of three Rocky Mountain and one of four eastern cottontails developed rickettsemias detectable in embryonated hens' eggs. Rickettsial concentrations in the peripheral blood fo Rocky Mountain cottontails, infected either by syringe or by bites of one or more Dermacentor andersoni ticks harboring virulent R. rickettsii, were sufficient to infect simultaneously feeding normal larvae of this tick species. However, infection rates wre low and did not exceed 11.7%. In a single experiment, the bites of D. variabilis, infected with an avirulent strain of R. rickettsii, did not produce rickettsemias sufficient to infect normal D. variabilis larvae. These laboratory findings suggest that cottontail rabbits, although susceptible to R. rickettsii, do not serve as efficient reservoirs for infecting ticks. PMID:7406116

  16. Development of the stomach worm, Obeliscoides cuniculi (Graybill), in lagomorphs, woodchucks and small rodents. (United States)

    Measures, L N; Anderson, R C


    The parasitic development of Obeliscoides cuniculi multistriatus Measures and Anderson, 1983 was studied in New Zealand white rabbits (Oryctolagus cuniculus). Third-stage larvae exsheathed within 24 hr. The third molt occurred 3 days and the fourth 8-11 days post-infection. All worms were fifth stage 14 days post-infection. Males were mature at 16 days and copulation occurred in 15-16 days. Females were gravid at 18 days. The prepatent period was 16-22 days. The patent period was 61-118 days and males lived longer than females. All stages were found in the mucosa except the fifth which was found lying on the mucosal surface within a layer of mucus. Petechiae were the only lesions seen in experimentally infected rabbits. Patent infections of O. c. multistriatus were established experimentally in infected woodchucks (Marmota monax), snowshoe hares (Lepus americanus) and cottontail rabbits (Sylvilagus floridanus). Patent infections of O. c. cuniculi were established experimentally in snowshoe hares. Patent infections of O. c. multistriatus did not appear in experimentally infected HPB white (Swiss Webster) mice (Mus musculus). Wistar rats (Rattus norvegicus), H.O.R.F1 Syrian hamsters (Mesocricetus auratus), H.O.R.F1 smooth-haired guinea pigs (Cavia porcellus) and H.O.R.F1 gerbils (Meriones unguiculatus). PMID:6644921

  17. Environmental investigation following the first human case of babesiosis in Tennessee. (United States)

    Fritzen, Charissa; Mosites, Emily; Applegate, Roger D; Telford, Sam R; Huang, Junjun; Yabsley, Michael J; Carpenter, L Rand; Dunn, John R; Moncayo, Abelardo C


    Babesiosis is an emerging tick-borne zoonotic disease in the United States caused by Babesia parasites. In 2009, the first case of babesiosis was documented in Tennessee. Environmental investigation at the reported site of tick exposure included collection of ticks and specimens from eastern cottontail rabbits (Sylvilagus floridanus) and white-tailed deer ( Odocoileus virginianus ) that were tested for piroplasms by molecular and serologic methods. One hundred and sixty-six Ixodes scapularis ticks and biological samples from 8 rabbits and 5 deer were collected. Ixodes scapularis were PCR positive for Babesia odocoilei (n = 7, 4%) and Theileria cervi (n = 24, 14%). Deer were seropositive for B. odocoilei and PCR positive for T. cervi. Rabbits were seropositive for B. odocoilei and Babesia sp. MO1, and 1 rabbit was PCR positive for Babesia sp. MO1. In summary, zoonotic Babesia sp. MO1 infection in rabbits is reported here for the first time in Tennessee as well as infection of deer and I. scapularis ticks with 2 other piroplasms of veterinary importance. PMID:23971411

  18. Characteristics of natural infections of the stomach worm, Obeliscoides cuniculi (Graybill), in lagomorphs and woodchucks in Canada. (United States)

    Measures, L N; Anderson, R C


    Wild lagomorphs and woodchucks collected predominantly in southern Ontario, Canada were examined for subspecies of Obeliscoides cuniculi (Graybill). Obeliscoides cuniculi multistriatus was found in snowshoe hares (Lepus americanus). Obeliscoides cuniculi cuniculi was found in cottontail rabbits (Sylvilagus floridanus), European hares (Lepus capensis) and woodchucks (Marmota monax). Prevalence of Obeliscoides cuniculi multistriatus in snowshoe hares was 100% and mean intensity (and range of intensity) was 760 (9-4, 198) in Lindsay, Ontario in 1980. Mean intensity in hares varied trimonthly. The highest mean intensity of worms occurred in spring when most worms were adult. Transmission occurred mainly in spring. Most worms present in fall (70%) and winter (54%) were fourth stage. Immature fifth-stage and gravid females were present in hares during fall and winter. Prevalence and mean intensity of O. c. cuniculi in cottontails was 15% and 29 (1-118). Prevalence and mean intensity of O. c. cuniculi in woodchucks was 6% and 56 (16-118). European hares were infected with O. c. cuniculi, prevalence was 10% and mean intensity was 60 (36-83). In Ontario woodchucks and European hares were common in areas frequented by cottontail rabbits and probably acquired sporadic infections of O. c. cuniculi from infected cottontails. PMID:6644920

  19. Great horned owl (Bubo virginianus) dietary exposure to PCDD/DF in the Tittabawassee River floodplain in Midland, Michigan, USA. (United States)

    Coefield, Sarah J; Zwiernik, Matthew J; Fredricks, Timothy B; Seston, Rita M; Nadeau, Michael W; Tazelaar, Dustin L; Moore, Jeremy N; Kay, Denise P; Roark, Shaun A; Giesy, John P


    Soils and sediments in the floodplain of the Tittabawassee River downstream of Midland, Michigan, USA contain elevated concentrations of polychlorinated dibenzofurans (PCDF) and polychlorinated dibenzo-p-dioxins (PCDD). As a long-lived, resident top predator, the great horned owl (Bubo virginianus; GHO) has the potential to be exposed to bioaccumulative compounds such as PCDD/DF. Site-specific components of the GHO diet were collected along 115 km of the Tittabawassee, Pine, Chippewa, and Saginaw Rivers during 2005 and 2006. The site-specific GHO biomass-based diet was dominated by cottontail rabbits (Sylvilagus floridanus) and muskrats (Ondatra zibethicus). Incidental soil ingestion and cottontail rabbits were the primary contributors of PCDD/DF to the GHO diet. The great horned owl daily dietary exposure estimates were greater in the study area (SA) (3.3 to 5.0 ng 2,3,7,8-TCDD equivalents (TEQ(WHO-avian))/kg body wt/d) than the reference area (RA) (0.07 ng TEQ(WHO-Avian)/kg body wt/d). Hazard quotients (HQs) based on central tendency estimates of the average daily dose and no-observable-adverse effect level (NOAEL) for the screech owl and uncertainty factors were <1.0 for both the RA and the SA. Hazard quotients based on upper end estimates of the average daily dose and NOAEL were <1.0 in the RA and up to 3.4 in the SA. PMID:20872700

  20. West Nile virus associations in wild mammals: a synthesis. (United States)

    Jeffrey Root, J


    Exposures to West Nile virus (WNV) have been documented in a variety of wild mammals in both the New and Old Worlds. This review tabulates at least 100 mammal species with evidence of WNV exposure. Many of these exposures were detected in free-ranging mammals, while several were noted in captive individuals. In addition to exposures, this review discusses experimental infections in terms of the potential for reservoir competence of select wild mammal species. Overall, few experimental infections have been conducted on wild mammals. As such, the role of most wild mammals as potential amplifying hosts for WNV is, to date, uncertain. In most instances, experimental infections of wild mammals with WNV have resulted in no or low-level viremia. Some recent studies have indicated that certain species of tree squirrels (Sciurus spp.), eastern chipmunks (Tamias striatus), and eastern cottontail rabbits (Sylvilagus floridanus) develop viremia sufficient for infecting some mosquito species. Certain mammalian species, such as tree squirrels, mesopredators, and deer have been suggested as useful species for WNV surveillance. In this review article, the information pertaining to wild mammal associations with WNV is synthesized. PMID:23212739

  1. Host associations of ticks (Acari: Ixodidae) parasitizing medium-sized mammals in a Lyme disease endemic area of southern New York. (United States)

    Fish, D; Dowler, R C


    Ticks of eight medium-sized mammal species were studied in an area of endemic Lyme disease in Westchester County, N.Y., from 1 April 1984 to 31 March 1985. Most (81%) of the 266 total mammal captures were raccoon, Procyon lotor (L.) (47%), opossum, Didelphis virginiana (Kerr) (19%), and striped skunk, Mephitis mephitis Schreber (15%); these host species accounted for 91% of the 1,519 ticks collected. Although the total number of ticks was rather evenly distributed among these mammals, species composition of ticks on each host species differed markedly. Ixodes dammini Spielman, Clifford, Piesman, and Corwin was the most abundant tick species and accounted for 45% (690) of the total ticks collected. Immatures were most prevalent (56%) on opossum, and nearly all (86%) adults were found on this host species. I. cookei Marx was second in abundance (34%) and was most prevalent (60%) on skunk. I. texanus Banks and Dermacentor variabilis (Say) were less abundant (less than 20% collectively) and were most prevalent on raccoon. I. dentatus Marx on eastern cottontail, Sylvilagus floridanus (Allen), and I. marxi Banks on gray squirrel, Sciurus carolinensis Gmelin, were least abundant (less than 2% collectively). The prevalence of I. dammini on medium-sized mammals in southern New York may influence the epizoötiology of Lyme disease. PMID:2724317

  2. A new rabbit species (Sylvilagus, Mammalia: Leporidae) from the lowlands of Venezuela. (United States)

    Durant, P; Guevara, M A


    A new species of Venezuelan rabbit of the genus Sylvilagus from Fundo Millano (08 degrees 46'N and 69 degrees 56'W) and Chorrosco Bajo (08 degrees 05'N and 69 degrees 18'W), between 190 and 120 masl, state of Barinas, is described based on: 1. Body and skull measurements. 2. Coloration patterns of the pelage. 3. Arrangement and length of the color hair bands of dorsal, lateral, ventral nuchal, and gular patches. Body and cranial measurements, and some color patterns of the new species, Sylvilagus varynaensis, were compared with those of the closest relative groups such as S. brasiliensis (from Venezuela and Brazil), S. b. meridensis from the Venezuelan paramos, and three of the most representative groups of S. floridanus (S. f. continentis, S. f. orinoci, and S. f. valenciae). Most of the values recorded for these parameters were significantly higher for the new species (P < 0.005; Student "t" test). Cluster and principal components analysis of the data recorded for cranial characteristics indicated that S. varynaensis is the largest and darkest of the known Venezuelan rabbits, with a broader elongated skull and a different arrangement of the color hair bands. PMID:11795167

  3. Seasonal activity and host associations of Ixodes scapularis (Acari: Ixodidae) in southeastern Missouri. (United States)

    Kollars, T M; Oliver, J H; Kollars, P G; Durden, L A


    Based on tick collections recovered from wild vertebrates and by dragging, the seasonal occurrence of adult blacklegged ticks, Ixodes scapularis Say, extended from October through May in southeastern Missouri. Adult activity was bimodal with the higher peak occurring in November followed by a lower peak in February. The activity of immature I. scapularis had the general pattern of that found in the Northeast where Lyme disease is hyperendemic, with larval activity (July) peaking after that of nymphs (May and June). Vertebrates varied in their importance as hosts of I. scapularis. White-tailed deer, Odocoileus virginanus (Zimmerman), and coyotes, Canis latrans Say, were the primary hosts of adult I. scapularis. Broad-headed skinks, Eumeces laticeps (Schneider), and eastern fence lizards, Sceloporus undulatus (Latreille), were the primary hosts of nymphal I. scapularis. The broad-headed skink, 5-lined skink, Eumeces fasciatus (L.), and Carolina wren, Thryothorus ludovicianus (Latham), were the primary hosts of larval I. scapularis. Homeotherms were important hosts of immature I. scapularis, accounting for 30% of nymphs and 39% of larvae collected. The eastern cottontail rabbit, Sylvilagus floridanus (Allen), may play an important role in the epidemiology of Lyme disease in Missouri. Isolates of Borrelia burgdorferi Johnson, Schmid, Hyde, Steigerwalt & Brenner were made from ticks recovered from rabbits, making the cottontail rabbit a key species for further study of the epidemiology of Lyme borreliosis in Missouri. PMID:10593072

  4. Detection of L1, infectious virions and anti-L1 antibody in domestic rabbits infected with cottontail rabbit papillomavirus. (United States)

    Hu, Jiafen; Budgeon, Lynn R; Cladel, Nancy M; Culp, Timothy D; Balogh, Karla K; Christensen, Neil D


    Shope papillomavirus or cottontail rabbit papillomavirus (CRPV) is one of the first small DNA tumour viruses to be characterized. Although the natural host for CRPV is the cottontail rabbit (Sylvilagus floridanus), CRPV can infect domestic laboratory rabbits (Oryctolagus cuniculus) and induce tumour outgrowth and cancer development. In previous studies, investigators attempted to passage CRPV in domestic rabbits, but achieved very limited success, leading to the suggestion that CRPV infection in domestic rabbits was abortive. The persistence of specific anti-L1 antibody in sera from rabbits infected with either virus or viral DNA led us to revisit the questions as to whether L1 and infectious CRPV can be produced in domestic rabbit tissues. We detected various levels of L1 protein in most papillomas from CRPV-infected rabbits using recently developed monoclonal antibodies. Sensitive in vitro infectivity assays additionally confirmed that extracts from these papillomas were infectious. These studies demonstrated that the CRPV/New Zealand White rabbit model could be used as an in vivo model to study natural virus infection and viral life cycle of CRPV and not be limited to studies on abortive infections. PMID:18024897

  5. Effects of enhanced UV-B radiation on plant chemistry: nutritional consequences for a specialist and generalist lagomorph. (United States)

    Thines, Nicole J; Shipley, Lisa A; Bassman, John H; Fellman, John K; Mattison, D Scott; Slusser, James R; Gao, Wei


    Ultraviolet-B (UV-B) radiation has been increasing in temperate latitudes in recent decades and is expected to continue rising for some time. Enhanced UV-B radiation can change plant chemistry, yet the effects of these changes on mammalian herbivores are unknown. To examine the influence of enhanced UV-B radiation on nutrition of a specialist and generalist hindgut fermenter, we measured nutritional and chemical constituents of three common North American range plants, big sagebrush (Artemisia tridentata), yarrow (Achillea millefolium), and bluebunch wheatgrass (Pseudoregneria spicata), and how these changes influenced in vitro dry matter digestibility and in vivo digestibility by pygmy rabbits (Brachylagus idahoensis) and eastern cottontails (Sylvilagus floridanus). Forages were irradiated for 3 mo with ambient (1x) or supplemental (1.6x) UV-B radiation representing a 15% ozone depletion for Pullman, WA, USA. Enhanced UV-B radiation had minimal effects on the nutritional content and the tannin-binding capacity of forages. Similarly, the terpene concentration in sagebrush and yarrow was not affected by higher UV-B irradiances. Flavonoid compounds increased in sagebrush but decreased in yarrow. Rabbit preference and intake was not affected by treatment levels for any forage species and no differences were found between treatments for dry matter, fiber, protein digestibility, and apparent digestible energy. PMID:17406969

  6. Herpesvirus sylvilagus in cottontail rabbits: evidence of shedding but not transplacental transmission. (United States)

    Spieker, J O; Yuill, T M


    Herpesvirus sylvilagus was inoculated into five cottontail rabbits (Sylvilagus floridanus) at various stages of pregnancy; they subsequently had litters in the laboratory. Three other cottontails chronically infected with the virus were bred and bore young in large outdoor pens. Thirty-four living neonates and dead fetuses were weighed, measured and aseptically necropsied. A total of 31 liver, spleen and kidney samples, 16 lymph node, 28 heart and 10 brain samples were collected and processed for inoculation into rabbit kidney cell cultures to attempt virus isolation. Virus was not detected in the 147 tissue samples tested. Pre-conception viremias ranged from 10-21 plaque-forming units per 0.5 ml. Virus isolation was attempted from 26 oral and lacrymal, 23 genital, nine urine and fecal, and four milk and male ejaculate samples from eight infected rabbits. Virus was recovered from two salivary samples from the same rabbit. Triamcinolone acetonide administered daily for four days to five rabbits did not stimulate excretion of virus. PMID:190423

  7. Influence of habitat modification on the intestinal helminth community ecology of cottontail rabbit populations. (United States)

    Boggs, J F; McMurry, S T; Leslie, D M; Engle, D M; Lochmiller, R L


    The influence of five brush management treatments using the herbicides tebuthiuron and triclopyr, with or without prescribed burning, on the intestinal helminth community of cottontail rabbits (Sylvilagus floridanus) was studied in 1987 on the Cross Timbers Experimental Range in Payne County, Oklahoma (USA). Six helminth species were found (Dermatoxys veligera, Trichostrongylus calcaratus, Passalurus nonanulatus, Wellcomia longejector, Taenia pisiformis cystercercus, and Mosgovoyia pectinata americana) in 102 rabbits (88 adult and 14 juveniles) collected over two seasons (winter and summer). Prevalence of M. pectinata americana in cottontail rabbits was significantly greater in untreated control pastures than herbicide treated pastures in winter, while prevalence of T. pisiformis was significantly greater in burned than unburned pastures. Abundances of helminth species in the intestinal tract of cottontail rabbits were unaffected by brush treatments. Mosgovoyia pectinata americana abundance demonstrated a highly significant increase from winter to summer; conversely, abundance of all oxyurid pinworms combined (D. veligera, P. nonanulatus, W. longejector) was significantly higher in winter than summer. Helminth community dynamics were significantly influenced by season, but were unaffected by brush treatments. Habitat modification could have influenced cestode transmission by altering the ecology of invertebrate and vertebrate hosts. PMID:2338720

  8. Experimental infection of vertebrates of the Pocomoke Cypress Swamp, Maryland with Keystone and Jamestown Canyon viruses. (United States)

    Watts, D M; Tammariello, R F; Dalrymple, J M; Eldridge, B F; Russell, P K; Top, F H


    Experimental studies were conducted to assess the susceptibility of white-tailed deer (Odocoileus virginianus), gray squirrels (Sciurus carolinensis), and cottontail rabbits (Sylvilagus floridanus) to Jamestown Canyon (JC) and/or Keystone (KEY) virus infection. Viremia occurred in 5 of 6 deer inoculated with JC virus; however, all deer developed KEY virus neutralizing antibody. Based on the observation that antibody elicited by primary infection of deer with either KEY or JC virus exhibited partial heterologous neutralization in vitro, cross-challenge experiments were performed in these animals. Keystone virus failed to infect deer 30 days post primary JC virus infection; however, deer became infected when challenged with KEY virus 80 days after the initial JC virus infection as indicated by a substantial increase in antibody titer. Similarly, JC virus failed to produce viremia in immune animals infected with KEY virus 80 days previously, although 2 of the 3 animals challenged had serological evidence of infection. Three field-collected cottontail rabbits with no evidence of KEY antibody were readily susceptible to KEY virus infection and developed viremias of 1-4 days' duration; rabbits with KEY virus antibody did not develop viremia upon KEY virus challenge. Eight antibody-negative field-collected gray squirrels became viremic following injection with KEY virus; however, a comparable group of squirrels did not become viremic when injected with JC virus. PMID:453437

  9. Discovery of defense- and neuropeptides in social ants by genome-mining.

    Directory of Open Access Journals (Sweden)

    Christian W Gruber

    Full Text Available Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant, Camponotus floridanus (carpenter ant and Harpegnathos saltator (basal genus. Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae and supports recent findings in Tribolium castaneum (red flour beetle and Nasonia vitripennis (parasitoid wasp, and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee, another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value.

  10. Discovery of defense- and neuropeptides in social ants by genome-mining. (United States)

    Gruber, Christian W; Muttenthaler, Markus


    Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant), Camponotus floridanus (carpenter ant) and Harpegnathos saltator (basal genus). Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins) and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae) and supports recent findings in Tribolium castaneum (red flour beetle) and Nasonia vitripennis (parasitoid wasp), and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee), another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family) and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value. PMID:22448224

  11. Structural Changes of Oil Palm Empty Fruit Bunch (OPEFB after Fungal and Phosphoric Acid Pretreatment

    Directory of Open Access Journals (Sweden)

    Mohammad J. Taherzadeh


    Full Text Available Oil palm empty fruit bunch (OPEFB was pretreated using white-rot fungus Pleurotus floridanus, phosphoric acid or their combination, and the results were evaluated based on the biomass components, and its structural and morphological changes. The carbohydrate losses after fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 7.89%, 35.65%, and 33.77%, respectively. The pretreatments changed the hydrogen bonds of cellulose and linkages between lignin and carbohydrate, which is associated with crystallinity of cellulose of OPEFB. Lateral Order Index (LOI of OPEFB with no pretreatment, with fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 2.77, 1.42, 0.67, and 0.60, respectively. Phosphoric acid pretreatment showed morphological changes of OPEFB, indicated by the damage of fibre structure into smaller particle size. The fungal-, phosphoric acid-, and fungal followed by phosphoric acid pretreatments have improved the digestibility of OPEFB’s cellulose by 4, 6.3, and 7.4 folds, respectively.

  12. Structural changes of oil palm empty fruit bunch (OPEFB) after fungal and phosphoric acid pretreatment. (United States)

    Isroi; Ishola, Mofoluwake M; Millati, Ria; Syamsiah, Siti; Cahyanto, Muhammad N; Niklasson, Claes; Taherzadeh, Mohammad J


    Oil palm empty fruit bunch (OPEFB) was pretreated using white-rot fungus Pleurotus floridanus, phosphoric acid or their combination, and the results were evaluated based on the biomass components, and its structural and morphological changes. The carbohydrate losses after fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 7.89%, 35.65%, and 33.77%, respectively. The pretreatments changed the hydrogen bonds of cellulose and linkages between lignin and carbohydrate, which is associated with crystallinity of cellulose of OPEFB. Lateral Order Index (LOI) of OPEFB with no pretreatment, with fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 2.77, 1.42, 0.67, and 0.60, respectively. Phosphoric acid pretreatment showed morphological changes of OPEFB, indicated by the damage of fibre structure into smaller particle size. The fungal-, phosphoric acid-, and fungal followed by phosphoric acid pretreatments have improved the digestibility of OPEFB's cellulose by 4, 6.3, and 7.4 folds, respectively. PMID:23247371

  13. Ability of bed bug-detecting canines to locate live bed bugs and viable bed bug eggs. (United States)

    Pfiester, Margie; Koehler, Philip G; Pereira, Roberto M


    The bed bug, Cimex lectularius L., like other bed bug species, is difficult to visually locate because it is cryptic. Detector dogs are useful for locating bed bugs because they use olfaction rather than vision. Dogs were trained to detect the bed bug (as few as one adult male or female) and viable bed bug eggs (five, collected 5-6 d after feeding) by using a modified food and verbal reward system. Their efficacy was tested with bed bugs and viable bed bug eggs placed in vented polyvinyl chloride containers. Dogs were able to discriminate bed bugs from Camponotus floridanus Buckley, Blattella germanica (L.), and Reticulitermes flavipes (Kollar), with a 97.5% positive indication rate (correct indication of bed bugs when present) and 0% false positives (incorrect indication of bed bugs when not present). Dogs also were able to discriminate live bed bugs and viable bed bug eggs from dead bed bugs, cast skins, and feces, with a 95% positive indication rate and a 3% false positive rate on bed bug feces. In a controlled experiment in hotel rooms, dogs were 98% accurate in locating live bed bugs. A pseudoscent prepared from pentane extraction of bed bugs was recognized by trained dogs as bed bug scent (100% indication). The pseudoscent could be used to facilitate detector dog training and quality assurance programs. If trained properly, dogs can be used effectively to locate live bed bugs and viable bed bug eggs. PMID:18767752

  14. Biological and physical contributions to the accumulation of strombid gastropods in a Pliocene shell bed

    Energy Technology Data Exchange (ETDEWEB)

    Geary, D.H. (Univ. of Wisconsin, Madison (USA)); Allmon, W.D. (Univ. of South Florida, Tampa (USA))


    Before the evolutionary and ecological information contained in shell beds can be interpreted, the conditions of shell bed formation must be understood. Here the authors investigate the mode and time scale of accumulation of a dense layer of Strombus floridanus in the Pliocene Pinecrest Beds of Florida. They utilize a variety of comparative taphonomic data, including the extent of encrustation and boring on strombid shells of different ontogenetic ages, and on accompanying pelecypods of different ecological types. The taphonomic comparisons enable them to reconstruct more accurately the events of shell bed formation. The formation of the strombid shell layer involved both biological and physical components. The characteristically gregarious behavior of Strombus is reflected in the large number of individuals preserved in this layer. Based on average densities of individuals in strombid colonies today, the authors estimate that a time period of tens to hundreds of years was required to accumulate these fossils. Repeated sediment winnowing by storms, followed by rapid reburial in a regime of at least episodically high sedimentation rates, is the most likely mechanism of accumulation, and accounts for the observed patterns of encrustation and boring on the shells of Strombus and various associated pelecypods. The origin of Florida's Plio-Pleistocene shelly sands is poorly understood; analysis of this bed may provide a working model for future taphonomic studies.

  15. Characterization and expression of the antifungal protein from Monascus pilosus and its distribution among various Monascus species. (United States)

    Tu, Ching-Yu; Chen, Yu-Pei; Yu, Ming-Chen; Hwang, Ing-Er; Wu, Dai-Ying; Liaw, Li-Ling


    Monascus species are traditionally used for food preservation. This study used the disc diffusion method to verify the antifungal activity of protein extracted from Monascus pilosus BCRC38072 against 15 fungal pathogens. An antifungal protein, designated as MAFP1, was successfully purified and confirmed through N-terminal sequencing. To further explore the antifungal gene, a mafp1 gene that is similar to that of PgAFP from Penicillium chrysogenum was cloned from M. pilosus BCRC38072. According to the N-terminal sequencing and in silico analysis, the signal peptide was assumed to have 18 amino acids and the mature MAFP1 to contain 58 peptides. Moreover, the mafp1 gene was recognized in Monascus ruber, Monascus barkeri, Monascus floridanus, and Monascus lunisporas through polymerase chain reaction and DNA sequencing and showed high homology. By contrast, the mafp1 gene was absent in Monascus kaoliang, Monascus purpureus, and Monascus sanguineus. In addition, the mafp1 gene with N-terminal polyhistidine fusion was overexpressed in Escherichia coli. However, the antifungal activity of recombinant MAFP1 was significantly lower than that of native MAFP1. According to the properties of MAFP1, Monascus species may have food preservation applications. PMID:26803705

  16. Effect of fungal and phosphoric acid pretreatment on ethanol production from oil palm empty fruit bunches (OPEFB). (United States)

    Ishola, Mofoluwake M; Isroi; Taherzadeh, Mohammad J


    Oil palm empty fruit bunches (OPEFB), a lignocellulosic residue of palm oil industries was examined for ethanol production. Milled OPEFB exposed to simultaneous saccharification and fermentation (SSF) with enzymes and Saccharomyces cerevisiae resulted just in 14.5% ethanol yield compared to the theoretical yield. Therefore, chemical pretreatment with phosphoric acid, a biological pretreatment with white-rot fungus Pleurotus floridanus, and their combination were carried out on OPEFB prior to the SSF. Pretreatment with phosphoric acid, combination of both methods and just fungal pretreatment improved the digestibility of OPEFB by 24.0, 16.5 and 4.5 times, respectively. During the SSF, phosphoric acid pretreatment, combination of fungal and phosphoric acid pretreatment and just fungal pretreatment resulted in the highest 89.4%, 62.8% and 27.9% of the theoretical ethanol yield, respectively. However, the recovery of the OPEFB after the fungal pretreatment was 98.7%, which was higher than after phosphoric acid pretreatment (36.5%) and combined pretreatment (45.2%). PMID:24630370

  17. Biological aspects of the immature stages of Ceraeochrysa everes (Banks (Neuroptera: Chrysopidae Aspectos biológicos dos estágios imaturos de Ceraeochrysa everes (Banks (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Leonardo Rodrigues Barbosa


    Full Text Available A knowledge of the behavior and biological aspects of natural enemies is extremely important for the establishment of biological control programs. Biological aspects of the larvae, pre-pupae and pupae of the predator Ceraeochrysa everes (Banks were studied. Larvae of the adult F1 generation were reared in the laboratory (25 ± 2°C, 65 ± 10 % RH and 14h photophase on eggs of the Angoumois grain moth Sitotroga cerealella (Olivier. The duration and viability of the embryonic period, development of the immature stages and egg-adult period were evaluated. The mean embryonic period was 5.0 days, while the mean durations of the first, second and third instars were: 5.1 ± 0.03; 4.3 ± 0.05 and 4.5 ± 0.05 days, respectively, with viability exceeding 90%. Duration of the larval, pre-pupal and pupal stages averaged 13.9 ± 0.07; 5.7 ± 0.07 and 9.6 ± 0.12 days, respectively. Duration of the biological cycle was 34 ± 0.11 days on average. S. cerealella eggs were not suitable for rearing C. everes under laboratory conditions because they affected predator development.Para o estabelecimento de um programa de controle biológico, o conhecimento de alguns aspectos biológicos e de comportamento dos inimigos naturais é de extrema importância. Os aspectos biológicos do desenvolvimento larval e pupal do predador Ceraeochrysa everes (Banks foram estudados. Larvas oriundas de adultos da geração F1 foram mantidas em laboratório a 25 ± 21°C, 70 ± 10 % UR e fotofase 14 horas, sendo alimentadas com ovos de Sitotroga cerealella (Olivier. A duração e viabilidade do período embrionário, estágios imaturos de desenvolvimento e o período de ovo a adulto foram avaliados. O período embrionário foi em média de 5,0 dias, enquanto que as durações médias para o primeiro, segundo e terceiro instares foram de 5,1 ± 0,03; 4,3 ± 0,05 e 4,5 ± 0,05 dias, respectivamente, com viabilidade superior a 90 %. Os estágios larval, pré-pupal e pupal apresentaram

  18. Juveniles of the piscivorous dourado Salminus brasiliensis mimic the piraputanga Brycon hilarii as an alternative predation tactic

    Directory of Open Access Journals (Sweden)

    Eduardo Bessa


    Full Text Available In the district of Bom Jardim, in Nobres, Mato Grosso State, Brazil, there are clear water streams originating on karstic terrain. The dourado, Salminus brasiliensis, is an apex stalking predator in these streams. In clear waters, where visually oriented prey may perceive predator in advance, surprise is needed for successful attacks. These streams are cohabited by other Characiformes, like the frugivorous piraputanga Brycon hilarii, which lives in schools and exhibits body colour and shape similar to the dourados. Here we describe an alternative predatory tactic for juvenile dourado occurring in headwater streams of the Paraguay River basin, in which they act as an aggressive mimic of the piraputanga. Based on 43 h of observations in Bom Jardim, and on additional 11 h in the Bodoquena Plateau Rivers of Mato Grosso do Sul State, we quantified the number of rushes by dourados when they were among piraputangas or foraging alone, and observed the proportion of piraputangas per dourado in multispecific schools. Dourados of up to 30 cm total length (TL stayed among the piraputangas of similar size hiding within the school and going to the periphery of the school before rushing against prey. The dourados exhibited colours similar to the piraputangas. They not only stayed longer among piraputangas (78% of the observation time, but also rushed against prey more often than when foraging alone (53 rushes/h against 14 rushes/h, respectively.No distrito de Bom Jardim, Nobres, Mato Grosso, Brasil, existem rios de águas claras que se originam sobre terreno cárstico. O dourado, Salminus brasiliensis, é um predador perseguidor de topo de cadeia nestes rios. Em águas, onde presas visualmente orientadas são capazes de perceber antecipadamente o predador, o fator surpresa é necessário para ataques bem sucedidos. Estes córregos são coabitados por outros Characiformes, como a frugívora piraputanga, Brycon hilarii, a qual vive em cardumes e exibe colora

  19. Post-embryonic development of Ceraeochrysa cincta (Schneider, 1851 (Neuroptera: Chrysopidae fed with eggs of Diatraea saccharallis (Fabricius, 1794 (Lepidoptera: CrambidaeDesenvolvimento pós-embrionário de Ceraeochrysa cincta (Schneider, 1851 (Neuroptera: Chrysopidae alimentada com ovos de Diatraea saccharallis (Fabricius, 1794 (Lepidoptera: Crambidae

    Directory of Open Access Journals (Sweden)

    Luis Gustavo Amorim Pessoa


    Full Text Available The lacewings (Ceraeochrysa cincta are important predators found associated to many pests in several agroecosystems. Eggs of Sitotroga cerealella and Anagasta kuehniella are used traditionally for massal rearing of these predators. Other foods can be used in substitution to the traditional ones, but little is known about the biology of lacewings and other alternative foods. So, this work was carried out to evaluate the effect of different diets on the post-embryonic development of C. cincta in laboratory. After been individualized in glass tubes, each larva was fed with S. cereallella and Diatraea saccharallis. It was evaluated the larvae duration, weight and viability in each instar, the duration, weight and viability of the pupa and pre-pupa stages and the duration of the post-embryonic period. It was adopted a completely randomized design with ten replications per treatment, each consisting of five eggs or larvae of C. cincta. Larvae were weighed 48 hours after hatching and 48 hours after each molt, and pre-pupae and pupae, 48 hours after starting these stages. There was no effect of the kind of food provided on the parameters evaluated. Therefore, D. saccharallis eggs can be used to feed C. cincta.Os crisopídeos são importantes predadores encontrados associados a diversos artrópodes-praga em diversos agroecossistemas. Para a criação massal desses predadores são utilizados tradicionalmente ovos de Sitotroga cerealella e de Anagasta kuehniella. Outros alimentos podem ser utilizados em substituição aos tradicionais, mas pouco se conhece sobre a biologia de crisopídeos e outros alimentos alternativos. Assim, este trabalho objetivou verificar o efeito de diferentes dietas sobre o desenvolvimento pós-embrionário dessa espécie em laboratório. Após a individualização em tubos de vidro, cada larva foi alimentada com ovos de S. cerealella e Diatraea saccharallis. Avaliou-se a duração, o peso e a viabilidade das larvas em cada

  20. Seletividade de inseticidas a Orius insidiosus Selectivity of insecticides to Orius insidiosus

    Directory of Open Access Journals (Sweden)

    Fabrícia Zimermann Vilela Torres


    Full Text Available A utilização de produtos fitossanitários seletivos a inimigos naturais é importante para o sucesso de programas de manejo integrado de pragas em agroecossistemas. Objetivou-se investigar efeitos letais e subletais de inseticidas empregados para o controle de pragas da roseira sobre ovos e ninfas de quinto ínstar de Orius insidiosus (Say Hemiptera: Anthocoridae, em condições laboratoriais. Formulações comerciais dos seguintes inseticidas foram diluídas em água destilada (concentração em g i.a./100 ml: endosulfam (0,021, formetanato (0,04, espinosade (0,0144 e deltametrina (0,0008. O tratamento testemunha foi somente com água destilada. Os bioensaios foram mantidos em câmara climática a 25 ± 2ºC, UR de 70 ± 10% e fotofase de 12 horas. Ovos do predador colocados em hastes de picão-preto (Bidens pilosa L. foram imersos nas caldas inseticidas por cinco segundos. As ninfas de quinto ínstar do predador foram tratadas com os inseticidas em torre de Potter. O efeito total dos inseticidas foi estimado e enquadrados em classes toxicológicas de acordo com a IOBC. O inseticida deltametrina foi nocivo a ovos e ninfas de quinto ínstar de O. insidiosus; endosulfam, formetanato e espinosade foram levemente nocivos. Endosulfam e formetanato não afetaram negativamente as características reprodutivas de fêmeas oriundas de ovos tratados. Endosulfam e espinosade reduziram o número de ovos colocados por fêmeas oriundas de ninfas de quinto ínstar que receberam tratamento, e espinosade afetou negativamente a viabilidade desses ovos.The use of selective pesticides to natural enemies is important for the success of integrated pest management programs. The objective of this study was to investigate lethal and sublethal effects of some insecticides, used to control pests in rose crops, on eggs and fifth instar-nymphs of Orius insidiosus (Say under laboratory conditions. Commercial formulations of the following insecticides were diluted in

  1. Seletividade de inseticidas a Doru luteipes (Scudder, 1876 (Dermaptera: Forficulidae e Cotesia sp. (Hymenoptera: Braconidae inimigos naturais de Ascia monuste orseis (Godart, 1818 (Lepdoptera: Pieridae Selectivity of insecticides to Doru luteipes (Scudder, 1876 (Dermaptera: Forficulidae and Cotesia sp. (Hymenoptera: Braconidae natural enemies of Ascia monuste orseis (Godart, 1818 (Lepdoptera: Pieridae

    Directory of Open Access Journals (Sweden)

    Marcelo Coutitnho Picanço


    Full Text Available Este trabalho objetivou estudar a seletividade dos inseticidas carbaril, deltametrina, paratiom metílico, permetrina e triclorfom em favor do predador Doru luteipes (Scudder (Dermaptera: Forficulidae e do parasitóide Cotesia sp. (Hymenoptera: Braconidae, em relação ao controle do curuquerê Ascia monuste orseis (Godart (Lepidoptera: Pieridae. Foram determinadas as CL90 para A. monuste orseis e estas foram utilizadas como doses discriminatórias para se avaliar o grau de seletividade dos inseticidas. Deltametrina e permetrina foram altamente seletivos em favor de D. luteipes. Deltametrina foi medianamente seletiva em favor de Cotesia sp. e a permetrina não apresentou seletividade em favor deste parasitóide. Triclorfom foi altamente seletivo em favor de ninfas de quarto estádio e adultos de D. luteipes e mediamente seletivo em favor de Cotesia sp. e de ninfas de primeiro estádio do predador. Carbaril foi medianamente seletivo em favor de Cotesia sp. mas não apresentou seletividade em favor de D. luteipes. Paratiom metílico não foi seletivo em favor de Cotesia sp. e D. luteipes. Adultos de D. luteipes foram menos sensíveis a deltametrina, permetrina e triclorfom do que adultos de Cotesia sp., sendo que o inverso ocorreu com o carbaril. Esses inimigos naturais apresentaram alta sensibilidade ao paratiom metílico. Ninfas de quarto estádio e adultos de D. luteipes foram mais sensíveis ao paratiom metílico e triclorfom que ninfas de primeiro estádio. Ninfas e adultos de D. luteipes apresentaram semelhante sensibilidade ao carbaril, deltametrina e permetrina.This work aimed to study the selectivity of the insecticides carbaryl, deltamethrin, methyl parathion, permethrin and trichlorfon in favor of the predator Doru luteipes (Scudder (Dermaptera: Forficulidae and of the parasitoid Cotesia sp. (Hymenoptera; Braconidae in relation to the control of the kale leafworm Ascia monuste orseis (Godart (Lepidoptera: Pieridae. LC90 were determined

  2. Seletividade fisiológica de inseticidas aos inimigos naturais de Plutella xylostella (L. (Lepidoptera: Plutellidae em brássicas Insecticide physiological selectivity to natural enemies of Plutella xylostella (L. (Lepidoptera: Plutellidae in Brassicae

    Directory of Open Access Journals (Sweden)

    Leandro Bacci


    Full Text Available A conservação de inimigos naturais é um componente fundamental no manejo integrado de pragas. Neste trabalho, estudou-se a seletividade de sete inseticidas usados no manejo de Plutella xylostella (L. (Lepidoptera: Plutellidae ao parasitóide Oomyzus sokolowskii (Kurdjumov (Hymenoptera: Eulophidae e aos predadores Discodon sp. (Coleoptera: Cantharidae e Lasiochilus sp. (Hemiptera: Anthocoridae. Os organofosforados metamidofós e paratiom metílico e o carbamato carbaril foram altamente tóxicos aos três inimigos naturais estudados. Dimetoato apresentou seletividade em favor do Discodon sp., na dose e subdose. O inseticida acefato apresentou alto impacto ao Discodon sp., no momento da aplicação e seu efeito foi reduzido com a metade da concentração do princípio ativo. Deltametrina apresentou seletividade à O. sokolowskii nas duas dosagens. Já permetrina foi seletiva a Lasiochilus sp., somente na subdose. Discodon sp. foi mais tolerante à dose e subdose do dimetoato e à subdose do acefato do que O. sokolowskii e Lasiochilus sp. O predador Lasiochilus sp. foi mais tolerante à dose e subdose da permetrina do que O. sokolowskii e Discodon sp. O parasitóide O. sokolowskii foi mais tolerante à dose e subdose da deltametrina do que Lasiochilus sp. e Discodon sp. Os resultados desta pesquisa foram obtidos em condições de exposição extrema, portanto indicam que os inseticidas seletivos possivelmente não serão prejudiciais aos inimigos naturais, em condições de campo.The conservation of natural enemies is a fundamental component in the integrated pest management. In this work, one studied the selectivity of seven insecticides, used in the management of Plutella xylostella (L. (Lepidoptera: Plutellidae, to the parasitoid Oomyzus sokolowskii (Kurdjumov (Hymenoptera: Eulophidae, and to the predators Discodon sp. (Coleoptera: Cantharidae and Lasiochilus sp. (Hemiptera: Anthocoridae. The organophosphates methamidophos and methyl parathion

  3. Avaliação da predação de Podocnemis expansa e Podocnemis unifilis (Testudines, Podocnemididae no rio Javaés, Tocantins Evaluation of predation in Podocnemis expansa and Podocnemis unifilis (Testudines, Podocnemididae in the Javaés River, Tocantins

    Directory of Open Access Journals (Sweden)

    Giovanni Salera Junior


    Full Text Available Podocnemis expansa e P. unifilis são animais de vida longa, com uma demorada maturação sexual, o que influencia uma baixa taxa de substituição de indivíduos. Suas populações são caracterizadas por uma pequena mortalidade dos animais adultos, mas alta taxa de mortalidade de filhotes e embriões. Sendo a predação natural de ninhos e filhotes um dos fatores mais importantes do baixo sucesso de eclosão dessas espécies. No rio Javaés, os ovos e recém-eclodidos podem ser predados por uma grande diversidade de animais: dentre as aves, urubus (Coragyps atratus e Cathartes aura, carcará (Polyborus plancus, jaburu (Jabiru mycteria; lagartos (Tupinambis teguixin e mamíferos de pequeno porte, coati (Nasua nasua e cachorro-do-mato (Cerdocyon thous. Do total anual de desovas de P. unifilis em média 65,98% são predadas, sendo 41,68% de forma total e 24,30% parcialmente. Enquanto que apenas 5,31% das ninhadas de P. expansa são sempre parcialmente predadas. Dentre os predadores aquáticos existem diversos peixes, principalmente piranhas (Serrasalmus nattereri e jacarés (Melanosuchus niger e Caimam crocodilus. Os predadores das fêmeas de P. unifilis são: jacaré-açu (Melanosuchus niger, onça-pintada (Panthera onca e onça-parda (Puma concolor. Enquanto que as fêmeas de P. expansa em postura, somente são predadas por P. onca. As fêmeas de P. unifilis em postura são predadas num total médio de 3,93% anualmente, enquanto que para P. expansa a média anual é 5,66% das fêmeas.Podocnemis expansa and P. unifilis long lived with late sexual maturation, which influences a low replacement rate of individuals. Their populations are characterized by low adults mortality, but high mortality of embryos and hatchlings. The natural nest predation is an important factor for hatchling success. In Javaés River, the eggs and hatchlings can be predated by a large number of animals such as birds, vultures (Coragyps atratus and Cathartes aura, carcar

  4. Aspectos biológicos de Harmonia axyridis alimentada com duas espécies de presas e predação intraguilda com Eriopis connexa Biological aspects of Harmonia axyridis fed on two prey species and intraguild predation with Eriopis connexa

    Directory of Open Access Journals (Sweden)

    Natália Ribeiro Pereira dos Santos


    Full Text Available O objetivo deste trabalho foi determinar os aspectos biológicos de Harmonia axyridis, alimentada com duas espécies de presas, e a ocorrência de predação intraguilda com Eriopis connexa. Larvas de H. axyridis foram alimentadas diariamente com ovos de Anagasta kuehniella ou com o pulgão Schizaphis graminum. Adultos da joaninha foram separados em dez casais que receberam o mesmo tipo de alimento da fase larval. Na avaliação da predação, uma larva de quarto instar de cada espécie foi mantida na presença ou ausência de abrigo e de ovos de A. kuehniella. A fase larval de H. axyridis durou 10,2 e 8,9 dias, quando alimentada com A. kuehniella e S. graminum, respectivamente. A sobrevivência do predador, em fase imatura, variou de 70 a 100%. A joaninha apresentou período de oviposição de 47,3 e 51,7 dias, com 887,6 e 822,5 ovos, ao se alimentar de A. kuehniella e S. graminum, respectivamente. A longevidade das fêmeas foi de 74,1 e 76,2 dias e a dos machos de 67,3 e 70,3 dias, em A. kuehniella e S. graminum, respectivamente. H. axyridis atuou como predador intraguilda e foi a espécie dominante na competição com E. connexa.The objective of this work was to determine the biological aspects Harmonia axyridis, fed on two prey species, and the occurrence of intraguild predation with Eriopis connexa. Larvae of H. axyridis were fed daily with Anagasta kuehniella eggs or Schizaphis graminum aphid. Adults of H. axyridis were separated in ten couples which received the same food type of the larval stage. For the estimation of predation, a fourth instar larva of each species was maintained in the presence or absence of shelter and eggs of A. kuehniella. The larval stage lasted 10.2 days, when H. axyridis fed on A. kuehniella eggs, and 8.9 days when reared with S. graminum. The survival of predator during immature stages ranged from 70 to 100%. H. axyridis had an oviposition period of 47.3 and 51.7 days, laying a total of 887.6 and 822.5 eggs

  5. Seletividade de agrotóxicos usados na cultura da macieira a Neoseiulus Californicus (McGregor (Acari: Phytoseiidae1 Pesticide selectivity used in apple crops Neoseiulus californicus (McGregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Geraldine de Andrade Meyer


    Full Text Available Objetivou-se avaliar os efeitos secundários dos principais agrotóxicos utilizados em macieira sobre adultos e imaturos de Neoseiulus californicus (McGregor (Acari: Phytoseiidae. Os testes foram conduzidos em laboratório, utilizando as doses dos produtos recomendadas para a cultura e o método de contato e residual com pulverização em superfície de folha. Foram testados tebufenozida, fosmete, metidationa, clorpirifós, abamectina, fenpiroximato, piridabem, captana, mancozebe (duas dosagens e ditianona. Para o cálculo do efeito total (E% sobre os adultos, avaliaram-se a mortalidade, a oviposição e a viabilidade dos ovos, e para os imaturos, somente a mortalidade. Os resultados do E% foram avaliados 96 horas após a pulverização. Os produtos foram classificados quanto ao efeito total (E% de toxicidade proposta pela IOBC/WPRS. Fosmete, tebufenozida e metidationa foram inócuos; abamectina, fenpiroximato, clorpirifós, captana, mancozebe (nas duas dosagens testadas e ditianona foram levemente nocivos, e piridabem foi moderadamente nocivo aos adultos de N. californicus. O fungicida mancozebe, na maior dosagem (320g,i.a./100L, foi o que mais afetou o ácaro predador. Quanto à seletividade dos agrotóxicos aos imaturos, constatouse que abamectina e piridabem foram moderadamente nocivos, e os demais foram inócuos. Nenhum produto foi classificado como nocivo, evidenciando a tolerância de N. californicus a estes agrotóxicos. Estes resultados permitem uma escolha e manejo mais adequado para os agrotóxicos utilizados nos pomares comerciais de macieira, de forma que a presença deste ácaro predador exerça pressão de controle do ácaro-vermelho.The objective of this study was to evaluate the side effects of the main pesticides used in adult and immature Neoseiulus californicus (McGregor (Acari: Phytoseiidae. The tests were carried out in the laboratory by using the contact and residual spraying method on the leaf surface. It was tested

  6. Efeitos de Fatores Ambientais na Reprodução de Tartarugas Environmental factors effects in turtles reproduction

    Directory of Open Access Journals (Sweden)

    Paulo Dias Ferreira Júnior


    Full Text Available Para as espécies de tartaruga que apresentam a determinação sexual dependente da temperatura da incubação o local e o momento da desova, exercem influências que vão além da definição do sexo dos embriões. A influência do local da desova se estende a todo o desenvolvimento embrionário afetando o comportamento e o tamanho dos filhotes. O momento em que ocorre a desova trará conseqüências ao ambiente térmico dos ninhos à medida que a temperatura e a umidade variam ao longo do ano. A umidade será decisiva nas trocas hídricas e gasosas entre os ovos e o meio afetando a absorção do vitelo e o crescimento dos embriões. As cheias e os alagamentos são importantes fatores de perda de ninhos nas espécies de tartaruga de água doce. A desova no momento adequado possibilita uma incubação segura, sem a interferência de alagamentos dos ninhos e conseqüente morte dos embriões. A predação dos ninhos varia de acordo com o local da desova, o tipo e a abundância de predadores e a profundidade da câmara de ovos. A escolha de pontos de desova no interior da vegetação, onde a taxa de predação é geralmente menor, nem sempre é a estratégia mais frequentemente adotada pelas tartarugas, uma vez que esse procedimento pode levar a uma maior exposição das fêmeas aos predadores, à diminuição do sucesso da eclosão ou a alterações na razão sexual provocadas por diferenças na temperatura da incubação.Turtle species in which the sex determination is dependent of incubation temperature, the nest site and the laying moment will affect more than embryo sex determination. The influence of the laying site extends all over the embryonic development, affecting hatching weight and size. The time of the egg-laying will bring consequences to the nest thermal environment, as the temperature and humidity change throughout the year. The humidity will be decisive in gaseous and hydric exchanges between eggs and the environment, affecting

  7. Avaliação de substratos de oviposição para Orius insidiosus (Say (Hemiptera, Anthocoridae Evaluation of oviposition substrates for Orius insidiosus (Say (Hemiptera, Anthocoridae

    Directory of Open Access Journals (Sweden)

    Lívia M. Carvalho


    Full Text Available Avaliação de substratos de oviposição para Orius insidiosus (Say (Hemiptera, Anthocoridae. Fêmeas do predador O. insidiosus usam tecidos de plantas para colocação de seus ovos, o que caracteriza a oviposição endofítica. Este trabalho teve por objetivo avaliar diferentes substratos de oviposição para este predador. O estudo foi conduzido em sala climatizada a 25 ± 2ºC, UR de 70 ± 10% e fotofase de 12 horas. Os substratos de oviposição utilizados foram brotos de feijão (Phaselus vulgaris L., brotos de soja [Glycine max (L. Merr.], brotos de batata (Solanum tuberosum L., vagem de feijão (Phaselus vulgaris L. e inflorescências de picão-preto (Bidens pilosa L.. Foram avaliados os números médio diário e total de ovos por um período de 15 dias, o número de adultos vivos em cada recipiente e a viabilidade na produção dos adultos. Todos os substratos testados foram aceitos pelas fêmeas. Entretanto, foi observado um número significativamente maior de ovos de O. insidiosus em brotos de feijão (4,3 ovos por dia e brotos de soja (3,9 ovos por dia, comparado aos demais substratos avaliados. As menores (pFemales of O. insidiosus deposit their eggs in the plant tissue. This study aimed to evaluate oviposition substrates for this predator. The study was conducted in an air-conditioned room at 25 ± 2ºC, 70 ± 10% RH, and a 12 h photophase. The oviposition substrates used consisted of bean sprouts (Phaseolus vulgaris L., soybean sprouts [Glycine max (L. Merr.], potato sprouts (Solanum tuberosum L., bean pods (Phaseolus vulgaris L., and farmer's friend inflorescences (Bidens pilosa L.. Evaluations included the daily mean and total numbers of eggs per female during a 15-day period, the number of live adults in each container, and adult production viability. All substrates tested were accepted by the females. However, a significantly higher number of O. insidiosus eggs was found on bean sprouts (4.3 eggs per day and soybean sprouts (3

  8. Toxicidade de acaricidas a ovos e adultos de Ceraeochrysa cubana (Hagen, 1861 (Neuroptera: Chrysopidae Toxicity of acaricides to eggs and adults of Ceraeochrysa cubana (Hagen, 1861 (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Geraldo Andrade Carvalho


    Full Text Available Objetivou-se, neste trabalho, avaliar o efeito de treze acaricidas sobre ovos e adultos de Ceraeochrysa cubana (Hagen, 1861. Os acaricidas foram pulverizados por meio de torre de Potter, nas concentrações recomendadas para o controle de ácaros na cultura dos citros. Os ensaios foram conduzidos sob condições controladas de 25 ± 2º C, umidade relativa de 70 ± 10% e fotofase de 12 horas. Os acaricidas não foram tóxicos ao predador em sua fase de ovo. Em relação aos adultos, o carbosulfan e o triazophos foram altamente tóxicos (100% de mortalidade, enquanto que os piretróides bifenthrin e fenpropathrin causaram mortalidade aproximadamente de 60%. Os acaricidas dicofol, bromopropylate, tetradifon, clofentezine, abamectin, hexythiazox, cyhexatin e óxido de fenbutatin não provocaram mortalidade dos adultos de C. cubana. Flufenoxuron inibiu a capacidade de oviposição e provocou a inviabilização dos ovos. Baseando-se na escala da IOBC, os acaricidas carbosulfan, triazophos e flufenoxuron foram enquadrados na classe 4 = nocivos; bifenthrin e fenpropathrin na classe 2 = levemente nocivos, e dicofol, bromopropylate, tetradifon, clofentezine, abamectin, hexythiazox, cyhexatin e óxido de fenbutatin na classe 1 = inócuos a C. cubana. Os compostos enquadrados na classe 1 podem ser recomendados em programas de manejo integrado de pragas de citros objetivando a integração entre os métodos químico e biológico por meio dessa espécie de predador.The objective of this work was to evaluate the effects of thirteen acaricides on eggs and adults of the lacewing Ceraeochrysa cubana (Hagen, 1861. The acaricides were sprayed using a Potter's tower at the rate recommended for mite control in citrus orchard. The trials were performed in climatic chamber at 25 ± 2º C, 70 ± 10% RH and photophase of 12 hours. The egg stage showed high tolerance to the tested acaricides. Carbosulfan and triazophos caused 100% adult mortality, whereas bifenthrin and

  9. Bemisia tabaci, Brevicoryne brassicae and Thrips tabaci abundance on Brassica oleracea var. acephala Abundância de Bemisia tabaci, Brevicoryne brassicae e Thrips tabaci em Brassica oleracea var. acephala

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available Kale Brassica oleracea var. acephala is attacked by whitefly Bemisia tabaci, aphid Brevicoryne brassicae and Thrips tabaci. One of the main reasons for extensive insecticide application is the lack of information about factors that control insect population. The objectives of this study were to investigate the relationships between predators and parasitoids, organic compound leaves, levels of leaf nitrogen and potassium, total rainfall, relative humidity, sunlight and median temperature on the abundance of whitefly, aphid, and thrips in kale genotype "Talo Roxo". The beating tray method, direct counting and magnifying lens were used to estimate the number of these pests, predators and parasitoids. Median temperature, sunlight and relative humidity correlated to the amount of leaf nonacosane, which in turn was associated with aphids population increase. A tendency in the reduction of aphids and thrips populations with increase in total rainfall was observed. The whitefly can be a harmful pest in kale producing regions of higher temperature and smaller rainfall. In regions which present moderate temperature, where there is a high incidence of aphids, genotype with low leaf wax content should be chosen. Natural enemies, especially the parasitoid Adialytus spp., can control agents of the aphids population in kale.A couve, Brassica oleracea var. acephala, é atacada por mosca-branca Bemisia tabaci, pulgão Brevicoryne brassicae e tripes Thrips tabaci. Uma das principais razões para o uso intensivo de inseticidas é a falta de informação sobre os fatores que controlam a população de insetos. O objetivo deste estudo foi investigar as relações entre predadores e parasitóides, compostos orgânicos foliares, níveis foliares de nitrogênio e de potássio, pluviosidade total, umidade relativa, insolação e temperatura média na abundância da mosca-branca, pulgões e tripes em couve genótipo Talo Roxo. Foi usado o método da batida em bandeja

  10. Efeitos do plantio direto e da consorciação soja-milho sobre inimigos naturais e pragas Effects of no-tillage and of soybean-corn intercropping on natural enemies and pests

    Directory of Open Access Journals (Sweden)

    Francisco Jorge Cividanes


    Full Text Available Procurou-se avaliar os efeitos do plantio direto e da consorciação soja (Glycine max (L. Merrill e milho (Zea mays L. sobre pragas e inimigos naturais. Os tratamentos constituíram um fatorial 3 x 2 (monocultura de soja, monocultura de milho, consorciação soja-milho x plantio direto, plantio convencional, em blocos casualizados. Os insetos foram amostrados pelo método do pano, rede entomológica, procura visual e armadilha de sucção. Entre os insetos-pragas do milho, Maecolaspis assimilis ocorreu em maior número no sistema de plantio convencional; o mesmo ocorreu com os predadores Cycloneda sanguinea e Doru sp. Por outro lado, M. assimilis e o predador Toxomerus sp. foram mais numerosos na monocultura de milho em relação à cultura do milho consorciado com soja. Dos insetos-pragas da soja, destacaram-se pelo maior número Anticarsia gemmatalis e Diabrotica gracilenta, no sistema de plantio convencional, e o mesmo aconteceu com a espécie da família Trichogrammatidae, enquanto as espécies da família Eulophidae foram mais numerosas na soja sob sistema de plantio direto. Na soja consorciada com milho foi maior o número de insetos-pragas Megalotomus sp. e Maecolaspis sp. e dos inimigos naturais Geocoris sp., Lebia concina, Orius sp., Braconidae e Scelionidae.This study evaluated the effects of no-tillage and of strip intercropping of soybean (Glycine max (L. Merrill and corn (Zea mays L. on the abundance of pests and natural enemies. The plots were arranged in a randomized complete block design for a 3 x 2 factorial experiment (soybean monoculture, corn monoculture, strip intercropping of soybean-corn x no-tillage and conventional tillage. Insects were sampled by sweep net, ground cloth, visual search and suction net. Among the corn insect pests, Maecolaspis assimilis occurred in highest number in the no-tillage system, the same being observed with the predators Cycloneda sanguinea and Doru sp. On the other hand, M. assimilis and the

  11. Plantas de ocorrência espontânea como substratos alternativos para fitoseídeos (Acari, Phytoseiidae em cultivos de seringueira Hevea brasiliensis Muell. Arg. (Euphorbiaceae Weeds as alternative substrates to phytoseiids (Acari, Phytoseiidae in rubber tree Hevea brasilienis, Muell. Arg. (Euphorbiaceae cultivation

    Directory of Open Access Journals (Sweden)

    Marcos Roberto Bellini


    Full Text Available O objetivo deste estudo foi determinar as espécies de plantas espontâneas em áreas de cultivo de seringueira que poderiam servir com reservatório de ácaros predadores. O trabalho foi conduzido em Olímpia, Estado de São Paulo, Brasil, em dois cultivos de seringueira. A cada três meses, cerca de 1.000 cm³ de folhas de cada uma das cinco espécies de plantas espontâneas dominantes em cada cultivo foi tomada para determinar os fitoseídeos. Como as plantas espontâneas dominantes variaram durante o estudo, um total de 20 espécies foi verificado. Somente Cecropia sp. foi dominante em todo estudo, em ambos os cultivos. Um total de 336 fitoseídeos pertencentes às seguintes espécies foi encontrado: Euseius citrifolius Denmark & Muma, 1970, E. concordis (Chant, 1959, Galendromus annectens (DeLeon, 1958, Iphiseiodes zuluagai Denmark & Muma, 1972, Neoseiulus anonymus (Chant & Baker, 1965 e N. tunus (DeLeon, 1967. E. citrifolius (189 espécimes e N. tunus (138 espécimes foram os mais abundantes. A maior abundância (231espécimes e diversidade (5 espécies foram observadas sobre Cecropia sp. Sobre esta planta foi encontrado o maior número de ácaros por amostra (29 espécimes, seguida por Piper duncum Linnaeus (22, Guarea sp. (18 e Ageratum conyzoides Linnaeus (12. E. citrifolius tem sido determinado como um dos ácaros predadores mais abundantes sobre seringueiras cultivadas na região onde este trabalho foi conduzido. Cecropia sp. parece ser uma das plantas espontâneas mais importantes consideradas como reservatório de E. citrifolius porque está continuamente presente nos cultivos. Estudos complementares poderiam indicar a viabilidade de se manejar esta planta nas áreas de cultivo de seringueira para permitir o controle biológico dos ácaros-praga desta cultura.The objective of this study was to determine weed species of rubber tree cultivation areas that could serve as reservoirs of predatory mites. The work was conducted in Ol

  12. Utilização da serologia na identificação de Ascia monuste orseis (Latreille, 1819 (Lepidoptera: Pieridae = Using the serological technique to identify Ascia monuste orseis (Latreille, 1819 (Lepidoptera: Pieridae

    Directory of Open Access Journals (Sweden)

    Fabiano de Mello Costa


    Full Text Available O presente trabalho teve como objetivo obter antissoro específico para Ascia monuste orseis (Latreille, 1819 com a finalidade de identificar seus predadores. Para a obtenção do antissoro, um coelho foi imunizado, via linfonódulo, com uma injeção de antígeno obtido pela maceração de lagartas do 4o e 5o instares de A. monuste orseis. Reações serológicas homólogas, realizadas por meio do método de dupla difusão em ágar, foram positivas após 21 dias da 1a inoculação do antígeno. Ovos, lagartas do 1o, 2o e 3o instares, pupas e adultos de A. monuste orseis também reagiram positivamente ao antissoro obtido.This study aimed to obtain specific antiserum for Ascia monuste orseis (Latreille, 1819, with the aim of identifying the predators associated with this insect. The preparation of specific antiserum was performed by immunizing a rabbit via a lymph nodule injection containing antigen obtained from the maceration of 4th and 5th instars of A. monuste orseis caterpillars. Serological homologous tests performed using double diffusion in agar gel were positive 21 days after the first antigen inoculation. Eggs, 1th, 2th and 3th instar caterpillars, pupae and adults of A. monuste orseis also reacted positively to the obtained antiserum.

  13. Utilização da serologia na identificação de Ascia monuste orseis (Latreille, 1819 (Lepidoptera: Pieridae - DOI: 10.4025/actascibiolsci.v31i2.515 Using the serological technique to identify Ascia monuste orseis (Latreille, 1819 (Lepidoptera: Pieridae - DOI: 10.4025/actascibiolsci.v31i2.515

    Directory of Open Access Journals (Sweden)

    Carlos Roberto Sousa-Silva


    Full Text Available O presente trabalho teve como objetivo obter antissoro específico paraAscia monuste orseis (Latreille, 1819 com a finalidade de identificar seus predadores. Para a obtenção do antissoro, um coelho foi imunizado, via linfonódulo, com uma injeção de antígeno obtido pela maceração de lagartas do 4o e 5o instares de A. monuste orseis. Reações serológicas homólogas, realizadas por meio do método de dupla difusão em ágar, foram positivas após 21 dias da 1a inoculação do antígeno. Ovos, lagartas do 1o, 2o e 3o instares, pupas e adultos de A. monuste orseis também reagiram positivamente ao antissoro obtido.This study aimed to obtain specific antiserum for Ascia monuste orseis (Latreille, 1819, with the aim of identifying the predators associated with this insect. The preparation of specific antiserum was performed by immunizing a rabbit via a lymph nodule injection containing antigen obtained from the maceration of 4th and 5th instars of A. monuste orseis caterpillars. Serological homologous tests performed using double diffusion in agar gel were positive 21 days after the first antigen inoculation. Eggs, 1th, 2th and 3th instar caterpillars, pupae and adults of A. monuste orseis also reacted positively to the obtained antiserum.

  14. Diversidade e dinâmica populacional de ácaros em pomar cítrico

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available As plantas de citros hospedam diversas espécies de ácaros que causam sérios prejuízos à produção e qualidade de frutos no Brasil. Esta pesquisa teve por objetivo estudar a diversidade de ácaros e a dinâmica populacional das principais espécies de ácaros em pomar de citros, Citrus sinensis (L. Osbeck, localizado no município de Descalvado, Estado de São Paulo. Foram realizadas 14 avaliações em um período de 12 meses, de fevereiro de 2007 a fevereiro de 2008. Em cada avaliação, foram coletadas dez folhas e cinco frutos na parte interna de cada uma das 40 plantas demarcadas no pomar. Foram encontradas 34 espécies de ácaros, distribuídas em 17 famílias. As espécies mais abundantes foram: Phyllocoptruta oleivora (Ashmed (Eriophyidae, Panonychus citri (McGregor (Tetranychidae, Brevipalpus phoenicis (Geijskes (Tenuipalpidae e Fungitarsonemus sp. (Tarsonemidae. Entre os ácaros predadores, a família Phytoseiidae foi a de maior riqueza (oito espécies e abundância (1.072 indivíduos. A espécie predominante foi Euseius concordis (Chant, correspondendo a 98,3% dos ácaros desta família. Foram observadas correlações significativas entre densidades populacionais de E. concordis e dos ácaros fitófagos P. citri, B. phoenicis e P. oleivora. Também foram observadas correlações significativas entre densidades populacionais desses ácaros e fatores meteorológicos como temperatura e precipitação pluvial. Os resultados indicam que E. concordis atua como inimigo natural de P. citri, B. phoenicis e P. oleivora no pomar cítrico estudado.

  15. Primeiro registro de Fulgurodes sartinaria (Lepidoptera: Geometridae em plantas de Eucalyptus cloeziana (Myrtaceae (Nota Científica. First record of Fulgurodes sartinaria (Lepidoptera: geometridae in Eucalyptus cloeziana (Myrtaceae (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Claubert Wagner Guimarães de MENEZES


    Full Text Available O objetivo deste trabalho foi registrar a oviposição e o desenvolvimento de uma nova espécie de lepidóptera associada à Eucalyptus cloeziana F. Muell, 1878 (Myrtaceae. Ovos, imaturos e adultos de Fulgurodes sartinaria Guenée, 1858 (Lepidoptera: Geometridae foram encontrados em plantas de E. cloeziana no município de Itamarandiba, Minas Gerais, Brasil. Este trabalho é o primeiro registro desse desfolhador em plantas de eucalipto. Ninfas de Brontocoris tabidus Signoret, 1852 (Heteroptera: Pentatomidae foram também observadas predando as lagartas de F. sartinaria, isto indica que este predador poderá ser um potencial agente de controle biológico da espécie. A ocorrência de F. sartinaria ovipositando e se desenvolvendo em plantas de E. cloeziana mostra que este lepidóptero pode se tornar um desfolhador importante da espécie, sendo recomendável sua inclusão em monitoramentos de pragas do eucalipto visando seu manejo integrado.The aim of this study was to record the oviposition and development of a new species of lepidopteran pests of Eucalyptus cloeziana F. Muell, 1878 (Myrtaceae. Eggs, immatures and adults of Fulgurodes sartinaria Guenée, 1858 (Lepidoptera: Geometridae were found in plants of E. cloeziana in Itamarandiba, Minas Gerais state, Brazil. This work is the first record of this defoliator in eucalyptus plants. Nymphs of the Brontocoris tabidus Signoret, 1852 (Heteroptera: Pentatomidae have also been observed preying on the larvae of F. sartinaria, this indicates that this predator is a probable potential biological control agent of the species. The occurrence of F. sartinaria developing and laying eggs on plants of E. cloeziana shows that this insect can become an important defoliator and it is recommended its inclusion in monitoring pest of eucalyptus for integrated pest management.

  16. Influência do formato do aquário na sobrevivência e no desenvolvimento de larvas de matrinxã Brycon cephalus (Osteichthyes, Characidae Effects of two formats of aquariums on survival and development of matrinxã Brycon cephalus larvae (Osteichthyes, Characidae

    Directory of Open Access Journals (Sweden)

    Marcelo Mattos Pedreira


    Full Text Available Neste experimento, utilizaram-se cinco aquários cilíndricos com relevo no fundo (em forma de anel e cinco retangulares com fundo liso para estudo da influência do formato do aquário na sobrevivência e no desenvolvimento de larvas de matrinxã Brycon cephalus. Observou-se melhor eficiência dos aquários retangulares, confirmada pela maior sobrevivência e biomassa. Os valores de temperatura, pH, condutividade e oxigênio dissolvido foram similares entre os tipos de aquários, sugerindo que esses parâmetros não influenciaram os resultados. O relevo no fundo dos aquários cilíndricos afetou negativamente o cultivo de larvas de matrinxã, pela criação de zonas com pequena capacidade da água em suspender partículas, o que resultou em acúmulo de dejetos, predadores, competidores e alimento. Aquários retangulares com fundo liso são mais adequados ao cultivo de larvas de matrinxã, por promover melhor circulação da água.This experiment compared the effects of five cylindrical aquarium with circular relief in the bottom or a rectangular aquariums with flat bottom on the intensive cultivation of matrinxã larvae (Brycon cephalus. Five aquariums of each format were used and the rectangular aquarium was the most efficient, confirmed by better survival average and biomass. Limnological variables were similar between aquariums, assuming that the parameters did not affect the results. The bottom relief in the aquarium resulted in areas with slow flow velocity, which resulted in the accumulation of waste, predators competitors and aliment, showing negative effects to culture of matrinxã. Rectangular aquariums with flat bottom are more recommended for matrinxã culture, because it provides better water circulation.

  17. Categorização funcional trófica das comunidades de macroinvertebrados de dois reservatórios na região Centro-Oeste do Estado de São Paulo, Brasil = Functional trophic categorization of macroinvertebrate communities of two reservoirs in the Midwestern region of São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Fabio Laurindo da Silva


    Full Text Available A utilização do conceito de guilda pode ser útil para a categorização funcional trófica de comunidades, pois não há obrigatoriedade da identificação dos organismos em nível de espécie, nem de tratar cada espécie como uma entidade separada. O objetivo deste estudo foi analisar os grupos funcionais tróficos (coletores-catadores, coletores-filtradores, fragmentadores, predadores e raspadores das comunidades de macroinvertebrados de dois reservatórios da região Centro-Oeste do Estado de São Paulo, Brasil. As amostragens foramrealizadas nos períodos chuvoso (março/abril - 2001 e de seca (julho/agosto - 2001 e os dados obtidos indicam que os coletores-catadores foram a guilda mais frequente. Este fato sugere grande importância da matéria orgânica como recurso alimentar na dieta dosmacroinvertebrados analisados.The use of the concept of guild can be useful for the functional trophic categorization of communities, because there is no requirement identification of organisms in the level of species and not to treat each species as a separate entity. The aim of this studywas to analyze the functional feeding groups (collectors-gatherers, collectors-filterers, shredders, predators and grazer-scrapers of the macroinvertebrate communities of two reservoirs in the Midwestern region of São Paulo State. Sampling was carried out in rainy(March/April - 2001 and dry (July/August - 2001 seasons and the data obtained indicate that ‘collectors-gatherers’ is the most frequent guild. This fact suggests a great importance of organic matter as a food source in the diet of the macroinvertebrates analyzed.

  18. Populations analysis of the Brazilian Sharpnose Shark Rhizoprionodon lalandii (Chondrichthyes: Carcharhinidae on the São Paulo coast, Southern Brazil: inferences from mt DNA sequences

    Directory of Open Access Journals (Sweden)

    Fernando Fernandes Mendonça


    Full Text Available Sharks of the genus Rhizoprionodon can be considered some of the most important predators along the trophic coastal marine ecosystems and represent an important economic resource for the small-scale fisheries, especially on the Brazilian coastline. In order to analyze the population structure of the shark Rhizoprionodon lalandii of São Paulo, Southeastern coast of Brazil, levels of genetic diversity were identified by nucleotide sequence analyses of the mitochondrial DNA control region. The results obtained from this study present moderate values of haplotype diversity and low nucleotide diversity. Although the AMOVA tests (ΦST = 0.08394, P Tubarões do gênero Rhizoprionodon são considerados predadores de grande importância ao longo da cadeia trófica nos ecossistemas costeiros e marinhos, também representando um importante recurso econômico para a pesca, especialmente no litoral brasileiro. A fim de analisar a estrutura populacional do tubarão Rhizoprionodon lalandii no litoral de São Paulo, sudeste do Brasil, foram identificados os níveis de diversidade genética a partir da análise de sequências nucleotídicas da região controladora do DNA mitocondrial. Os dados obtidos neste estudo apresentam valores moderados de diversidade haplotípica e baixos índices de diversidade nucleotídica. Embora os testes de AMOVA (ΦST = 0,08394, P < 0,01 tenham revelado uma pequena diferença entre as amostras estudadas, evidências sobre a ocorrência de estruturação populacional não foram encontradas o que pode representar uma característica geral para tubarões vivendo em áreas costeiras.

  19. Fatores naturais que influenciam o ataque da mosca-branca em pimentão Natural factors influencing whitefly attack in sweet pepper

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available Este trabalho objetivou determinar os efeitos da pluviosidade, da temperatura, da umidade relativa, dos predadores e parasitóides, da idade das plantas, dos compostos químicos foliares (cromatógrafo a gás acoplado a espectrômetro de massa - CG/EM, dos níveis de N e de K foliares sobre a intensidade do ataque de Bemisia tabaci biótipo B (Genn. (Homoptera: Aleyrodidae em pimentão (Capsicum annuum var. Myr-10. As correntes totais de íons dos picos 28,178 min. (tempo de retenção e 42,755 min. (tempo de retenção correlacionaram-se positivamente com as ninfas e adultos da mosca-branca, respectivamente, e a corrente total de íons do pico 36,352 min. (tempo de retenção correlacionou-se negativamente com ninfas deste inseto.The objective of this work was to determine the effect of rainfall, temperature, relative humidity, predators, parasitoids, plant age, leaf chemical composition (GC/MS-gas chromatographic-mass spectrometric analysis of hexane extract and levels of N and K on the intensity of attack by Bemisia tabaci biotype B (Genn. (Homoptera: Aleyrodidae on sweet pepper (Capsicum annuum var. Myr-10. Out of the four peaks detected in the hexane extract on GC/MS analysis, areas of the peak eluting at 28.178 and 42.755 min correlated positively to the nymph and adult population, respectively. The peak eluting at 36.352 min correlated negatively with the nymph population.

  20. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino


    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera. Este estudo constitui o primeiro registro de Temnocephala Blanchard (Platyhelminthes, Temnocephalidae, um ectosimbionte em larvas de Megaloptera, como um possível predador de larvas de Chironomidae. Vinte e oito larvas de Corydalidae (Corydalus e Protochauliodes foram examinadas sobre estereomicroscópio na busca por Temnocephala e larvas de Chironomidae, das quais cinco larvas de Megaloptera continham 24 Temnocephala sp. associadas. Além disso, oito Temnocephala possuíam em seu conteúdo estomacal larvas de Chironomidae, uma interação desconhecida anteriormente. A análise do conteúdo estomacal revelou Corynoneura como o quironomídeo mais abundante, e também algumas larvas de Larsia, Rheotanytarsus e Tanytarsus. Este estudo inclui Corydalus e Protochauliodes como hospedeiros de Temnocephala, os quais podem ser importantes

  1. Feeding strategy of the night shark (Carcharhinus signatus and scalloped hammerhead shark (Sphyrna lewini near seamounts off northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Teodoro Vaske Júnior


    Full Text Available A total of 425 stomachs of night shark (Carcharhinus signatus, and 98 stomachs of scalloped hammerhead shark (Sphyrna lewini, from longline and surface gillneters near seamounts off northeastern Brazil, were analysed between 1992 and 1999. Both predators prey upon reef and benthopelagic fishes, migrant cephalopods and deep water crustaceans, showing similar feeding niches (Schoener Index T=0.75. The great prey richness of the diets may reflect the fact that the marine food web for these species is very extensive in this region. Due to the concentration for feeding of both predators in the seamounts, intense fisheries should be monitored to avoid localised depletions.Um total de 425 estômagos de tubarão-toninha (Carcharhinus signatus e 98 estômagos de tubarão-martelo-entalhado (Sphyrna lewini, oriundos da pesca de espinhel e pesca com rede de emalhe nas adjacências dos bancos oceânicos do nordeste do Brasil, foi analisado entre 1992 e 1999. Ambas as espécies predam sobre peixes bento-pelágicos e recifais, cefalópodes migradores, e crustáceos de águas profundas, apresentando nichos alimentares similares (Índice de Schoener T=0.75. A alta riqueza de presas nas dietas deve ser um reflexo de que as teias alimentares para estas espécies são consideravelmente longas nessa região. Devido à concentração alimentar de ambos predadores nos bancos oceânicos, a pescaria intensa deve ser monitorada para evitar depleções locais.

  2. Factors affecting the attack rate of Bemisia tabaci on cucumber Fatores que afetam o ataque de Bemisia tabaci em pepino

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available The objective of this work was to determine the effects of rainfall, temperature, predators, parasitoids, plant age, leaf chemical composition, levels of leaf nitrogen and potassium, besides density of leaf trichomes, on attack intensity of Bemisia tabaci biotype B on the Cucumis sativus. An increase in the number of whitefly adults and nymphs per leaf was observed with plant aging. A higher number of whitefly adults per leaf and eggs cm-2 was verified in the apical part than in the middle and bottom part of the plants canopy. However, the higher number of whitefly nymphs was observed in the mid-part than in the apical and bottom part of the plant canopy. The incidence of whitefly nymphs was negatively affected with foliar nitrogen. Pentacosane and octacosane positively affected whitefly adults and the first compound also affected the nymphs of this pest species.O objetivo deste trabalho foi determinar os efeitos de pluviosidade, temperatura, predadores, parasitóides, idade de planta, composição química foliar, níveis de nitrogênio e potássio foliares, assim como de densidade de tricomas, na intensidade de ataque de Bemisia tabaci biótipo B em Cucumis sativus. Observaram-se maiores números de adultos e de ninfas de mosca-branca por folha com o aumento de idade de plantas. Adultos por folha e ovos cm-2 foram encontrados com maior freqüência na parte apical do que na parte mediana e basal do dossel das plantas. Entretanto, observou-se maior número de ninfas desse inseto no terço mediano do que nos terços apical e basal. Nitrogênio foliar afetou negativamente ninfas de mosca-branca. Pentacosano e octacosano afetaram positivamente adultos e o primeiro composto afetou também as ninfas dessa praga.

  3. Ação de produtos fitossanitários utilizados em cafeeiros sobre pupas e adultos de Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Silva Rogério Antônio


    Full Text Available Avaliou-se a ação de produtos fitossanitários usados em cafeeiros sobre pupas e adultos de Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae. Os bioensaios foram conduzidos no Departamento de Entomologia da Universidade Federal de Lavras - UFLA, Lavras, MG, Brasil. Os tratamentos avaliados, em g i.a.L-1 de água, foram: 1- endosulfan (Thiodan 350 CE - 1,75, 2- chlorpyrifos (Lorsban 480 CE -1,2, 3- betacyfluthrin (Turbo 50 CE - 0,013, 4- enxofre (Kumulus 800 PM - 4,0, 5- azocyclotin (Peropal 250 PM - 0,31, 6- oxicloreto de cobre (Cuprogarb 500 PM - 5,0 e 7- Testemunha (água. As pulverizações foram realizadas diretamente sobre pupas e adultos do crisopídeo por meio de torre de Potter. As pupas foram colocadas em tubos de vidro e os adultos em gaiolas de PVC, e mantidos em sala climatizada a 25 ? 2degreesC, UR de 70 ? 10% e fotofase de 12 horas. O delineamento experimental foi inteiramente casualizado, com sete tratamentos e dez repetições, sendo cada parcela formada por quatro pupas ou um casal de C. externa. Os produtos foram distribuídos nas quatro classes de toxicidade conforme escala estabelecida pela IOBC. O chlorpyrifos mostrou-se levemente nocivo para pupas (classe 2, 30?E?79%, e os demais produtos foram inócuos (classe 1, E99%. Os produtos testados à base de endosulfan, enxofre, azocyclotin e oxicloreto de cobre podem ser recomendados em programas de manejo de pragas do cafeeiro em associação com C. externa, em função da baixa toxidade apresentada por esses compostos ao predador.

  4. Consumo de Uroleucon ambrosiae (Thomas, 1878 (Hemiptera: Aphididae por larvas de Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae em casa-de-vegetação Consumption of Uroleucon ambrosiae (Thomas, 1878 (Hemiptera: Aphididae BY Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae larvae in greenhouse

    Directory of Open Access Journals (Sweden)

    Alexander M. Auad


    Full Text Available Com esta pesquisa objetivou-se verificar o consumo de Uroleucon ambrosiae em diferentes densidades, por larvas de Chrysoperla externa provenientes de diferentes regimes alimentares, em casa-de-vegetação. Ninfas de 3º e 4º ínstares do afídeo foram separadas nas densidades 30, 40 e 50, e colocadas nas plantas de alface (35 dias de idade, as quais, foram envolvidas por gaiola de armação de ferro de 27x27x26 cm cobertas com tecido “voil” e acoplada nos tubos de PVC do cultivo hidropônico. Quatro horas após, uma larva de C. externa, de diferentes ínstares e previamente alimentadas com U. ambrosiae ou ovos de Sitotroga cerealella (Olivier, 1819, foi liberada próximo à colônia de afídeos, sendo a gaiola fechada imediatamente; o mesmo procedimento foi adotado sem que a larva fosse confinada. Após quarenta e oito horas, realizou-se a contagem do número de afídeos consumidos em cada densidade de presa disponível. A eficiência do predador, confinado em gaiola, foi de 12,46%, 13,63% e 25,76% para larvas de 1º, 2º e 3º ínstares previamente alimentadas com ovos de S. cerealella; 9,59% e 17,63% para aquelas de 2º e 3º ínstares alimentadas anteriormente com ninfas de U. ambrosiae, respectivamente e de 18,62% para larvas de 3º ínstar previamente alimentadas com ovos do lepidóptero no 1º ínstar e ninfas dos afídeos no 2º instar; no entanto, para larvas não confinadas, não foram verificadas diferenças significativas na eficiência. Nas densidades de 40 e 50 afídeos, as porcentagens de predação (18,30 e 18,72, respectivamente foram significativamente superiores quando comparada à densidade 30 (11,79; para testes sem confinamento, não houve influência da densidade da presa na resposta do predador. Assim, o alimento fornecido às larvas de C. externa antes de serem liberadas em casa-de-vegetação, o confinamento das mesmas e a densidade de U. ambrosiae disponível influenciaram o potencial de consumo do predador

  5. Velocidade da água e a distribuição de larvas e pupas de Chirostilbia pertinax (Kollar (Diptera, Simuliidae e macroinvertebrados associados Water velocity and the distribution of larvae and pupae of Chirostilbia pertinax (Kollar (Diptera, Simuliidae and associated macroinvertebrates

    Directory of Open Access Journals (Sweden)

    José Eloy dos Santos Jr


    Full Text Available O presente trabalho objetivou investigar a relação entre a velocidade da água e a distribuição dos estágios imaturos de Chirostilbia pertinax (Kollar, 1832 e os macroinvertebrados bentônicos associados. As coletas foram realizadas em cinco pontos, no trecho superior do Rio dos Sinos, no Estado do Rio Grande do Sul. A fauna bentônica foi amostrada com substratos artificiais, que permaneceram instalados nos locais de maior corenteza d'água por períodos de 14 dias. Antes do recolhimento dos substratos foram realizadas medidas de velocidade d'água no local da sua instalação. Essas medidas foram agrupadas em três classes: baixa (0,20 a 0,63 m/s, média (0,64 a 1,07 m/s e alta (1,08 a 1,50 m/s para posterior relação com a distribuição da fauna coletada. Para avaliar a influência da velocidade de água sobre a distribuição dos macroinvertebrados e a abundância de C. pertinax foi realizada uma regressão múltipla. As coletas resultaram em 39.598 indivíduos, sendo 33.418 simulídeos e 6.180 macroinvertebrados associados. Entre os simulídeos 5.704 espécimes correspondem a larvas do último ínstar e pupas, dos quais 828 são de C. pertinax. Quanto à distribuição dessa espécie, 30,8% ocorreram na classe de baixa velocidade d'água, 24,9% na velocidade média e 44,3% na alta velocidade. Foi observado que a abundância de C. petinax aumenta à medida que os macroinvertebrados predadores diminuem e os organismos não predadores aumentam (GLM, R² = 0,207; F 2,50 = 6,536; P = 0,003. Esses resultados revelam que os imaturos de C. pertinax têm uma tendência em ocupar um microhábitat com menor ocorrência de predadores.The objective of the current study was to evaluate the distribution of the immature stages of Chirostilbia pertinax (Kollar, 1832 and associated bentic macroinvertebrates in relation to water velocity. This study was carried out on the upper course of Sinos river, in Rio Grande do Sul. Seasonal collections of larvae

  6. Educação ambiental e a conservação da onça parda: potenciais das unidades de conservação do nordeste paulista. Environmental education and puma conservation: potentials of the protected areas of northeastern São Paulo state (Brazil.

    Directory of Open Access Journals (Sweden)

    Mayla Willk VALENTI


    Full Text Available No nordeste do Estado de São Paulo as unidades de conservação abrigam importante parcela da biodiversidade brasileira. Espécies predadoras de topo de cadeia, como a onça parda (Puma concolor, ainda estão presentes nessa região e dependem dessas unidades para sobreviverem. Nesse contexto, a educação ambiental pode contribuir com a conservação das espécies, embora existam desafios a serem superados. O objetivo deste trabalho foi identificar potencialidades e limites da educação ambiental para a conservação da biodiversidade nas unidades de conservação do nordeste paulista, tendo como tema a conservação de predadores, em especial a onça parda. A área de estudo foi definida com base na população dessa espécie na região. Realizamos levantamento das unidades de conservação na área de estudo e consulta para identificar aquelas com programas de educação ambiental ativos. Visitamos sete áreas protegidas, sendo que em cada uma realizamos entrevista estruturada com pessoas envolvidas em ações de educação ambiental e/ou gestores das unidades, totalizando sete entrevistas. Os dados indicaram que essas unidades estão em contextos relevantes para a realização de ações educativas voltadas à conservação de predadores. Contudo, as/os entrevistadas/os relataram dificuldades em se aproximar da população do entorno fora do ambiente escolar, especialmente o público adulto. Apesar disso, identificamos uma preocupação em envolver a comunidade do entorno, percebida nos próprios objetivos das atividades realizadas pelas unidades de conservação. A partir dos resultados obtidos, consideramos que, embora o tema dos predadores não seja especificamente trabalhado, existe um potencial grande para atuação nesse sentido. Ainda, destacamos que as unidades de conservação são espaços privilegiados para a integração dos conhecimentos científicos e educação ambiental. In northeastearn São Paulo state (Brazil, the

  7. Differentiation between the traces of predation of muricids and naticids in Spanish Pliocene Chlamys

    Directory of Open Access Journals (Sweden)

    Reyment, R. A.


    identificación para los especímenes analizados. En concreto, se ha podido establecer diferencias significativas en las relaciones entre los predadores y las presas. Se ha podido responder afirmativamente a la cuestión de cómo eligen los sitios preferentes para la localización de las perforaciones en el caso de los murídicos. También, para los murícidos la mayoría de las perforaciones observadas (74,1% se ha concentrado en la región del músculo abductor; en cambio, para los natícidos no se ha observado este techo (sólo un 36,9%, de perforaciones en la región del músculo abductor. Para los natícidos se ha podido demostrar una asociación entre el lugar de la presa donde se producen las perforaciones y predador, únicamente cuando se toman en cuenta presas de muchas especies y géneros distintos. También existe una estrecha asociación entre el tamaño de la presa y el lugar donde perforan ambos grupos de predadores. No hay una evidencia decisiva que permita correlacionar la localización de las perforaciones para los natícidos, pero probablemente si la haya para los murícidos. La estrategia de selección del lugar de la perforación para los murícidos se ha determinado en función del músculo abductor en los monomiarios Chlamys para facilitar el acceso a las vísceras. En general, los métodos de análisis multivariado y en especial el método de correlaciones canónicas, se han encontrado como de gran ayuda en la interpretación de observaciones cuantitativas.

  8. Roadkills of vertebrates in Venezuela Vertebrados mortos em estradas na Venezuela

    Directory of Open Access Journals (Sweden)

    Jan Pinowski


    Full Text Available This paper presents an analysis of vertebrate roadkills in five different habitats of tropical South America. Observations of vertebrate roadkills were conducted in 1978, on a 572 km road between Caracas and Mantecal/Apure in Venezuela, during the rainy season (June-October. During five passages on this route, which includes five distinct habitats, 79 vertebrate carcasses - mammals and reptiles - were found. If we assume that the carcasses remain for two days on the road, vehicles can be expected to strike 350 spectacled caimans Caiman crocodilus Linnaeus, 1758 (Alligatoridae during the rainy season alone. Similar calculations for other species yield 313 snakes and lizards, 294 opossums Didelphis marsupialis Linnaeus, 1758 (Didelphidae, 220 crab-eating foxes Cerdocyon thous (Linnaeus, 1776 (Canidae, 129 tamanduas Tamandua tetradactyla (Linnaeus, 1758 (Myrmecophagidae, 55 capybaras Hydrochaerus hydrochaeris (Linnaeus, 1766 (Hydrochaeridae and 37 eastern cottontails Sylvilagus floridanus Allen, 1890 (Leporidae. Numerous papers have been published on vertebrates killed by vehicles on roads in Europe, North America, and Australia, and several papers are available regarding vertebrate roadkills in Africa and Asia. From South America there are several papers on vertebrates, birds, and mammals, whereas from Venezuela only one and it deals with iguanas (Iguana iguana Linnaeus, 1758, Iguanidae.Este trabalho apresenta uma análise de vertebrados mortos em estrada em cinco habitats tropicais diferentes na América do Sul. As observações dos vertebrados mortos em estrada foram feitas em 1978, a 572 km da rodovia entre Caracas e Mantecal/Apure na Venezuela, durante a estação das chuvas (junho-outubro. Durante cinco passagens nesta rota, a qual inclui cinco habitats diferentes, foram encontradas 79 carcaças de vertebrados - répteis e mamíferos. Assumindo que as carcaças permaneçam por dois dias na estrada, é esperado que veículos matem 350

  9. Evidence for and geomorphologic consequences of a reptilian ecosystem engineer: The burrowing cascade initiated by the Gopher Tortoise (United States)

    Kinlaw, A.; Grasmueck, M.


    Physical ecosystem engineers often make major, durable physical constructs that can provide living space for other species and can structure local animal communities over evolutionary time. In Florida, a medium sized chelonian, the Gopher Tortoise (Gopherus polyphemus) will excavate extensive subterranean chambers that can endure for long periods of time. The tortoise starts a 'burrowing cascade', by first excavating a larger burrow that may extend 10 m, which is then re-engineered by Florida Mice (Podomys floridanus) and other rodents that dig smaller side-burrows and pockets. This sequence is often followed by an invertebrate, the camel cricket (Ceuthophilus labibuli) which is reported to excavate even smaller chambers. Our first aim was to quantify the zoogeomorphic impact of this burrowing cascade by measuring the amount of soil excavated in a large sample of burrows in two communities. Secondly, we hypothesized that the high biodiversity reported for these structures might be related to the quasi-fractal nature of the geometry, following the work of Frontier (1987). To visualize this underground geometry, we used high-resolution 3D Ground Penetrating Radar (GPR), which provided images and insights previously unobtainable using excavations or 2D GPR. Our images verified that the active tortoise burrow had a spiraling shape, but also showed splits in the larger burrow apparently dug by tortoises. For the first time, the smaller Florida Mouse burrows were imaged, showing side loops that exit and re-renter the tortoise burrow. This study also presents new information by making the discovery of numerous remnants of past tortoise burrows underground in the sampling grid surrounding the active burrow. Our third aim was to interpret our field results with previous ecological field studies to evaluate the strength of evidence that this species ranks as an ecosystem engineer.

  10. Phylogeographic Analyses of American Black Bears (Ursus americanus) Suggest Four Glacial Refugia and Complex Patterns of Postglacial Admixture. (United States)

    Puckett, Emily E; Etter, Paul D; Johnson, Eric A; Eggert, Lori S


    Studies of species with continental distributions continue to identify intraspecific lineages despite continuous habitat. Lineages may form due to isolation by distance, adaptation, divergence across barriers, or genetic drift following range expansion. We investigated lineage diversification and admixture within American black bears (Ursus americanus) across their range using 22 k single nucleotide polymorphisms and mitochondrial DNA sequences. We identified three subcontinental nuclear clusters which we further divided into nine geographic regions: Alaskan (Alaska-East), eastern (Central Interior Highlands, Great Lakes, Northeast, Southeast), and western (Alaska-West, West, Pacific Coast, Southwest). We estimated that the western cluster diverged 67 ka, before eastern and Alaskan divergence 31 ka; these divergence dates contrasted with those from the mitochondrial genome where clades A and B diverged 1.07 Ma, and clades A-east and A-west diverged 169 ka. We combined estimates of divergence timing with hindcast species distribution models to infer glacial refugia for the species in Beringia, Pacific Northwest, Southwest, and Southeast. Our results show a complex arrangement of admixture due to expansion out of multiple refugia. The delineation of the genomic population clusters was inconsistent with the ranges for 16 previously described subspecies. Ranges for U. a. pugnax and U. a. cinnamomum were concordant with admixed clusters, calling into question how to order taxa below the species level. Additionally, our finding that U. a. floridanus has not diverged from U. a. americanus also suggests that morphology and genetics should be reanalyzed to assess taxonomic designations relevant to the conservation management of the species. PMID:25989983

  11. Organochlorine pesticides and thiamine in eggs of largemouth bass and American alligators and their relationship with early life-stage mortality (United States)

    Sepulveda, M.S.; Wiebe, J.J.; Honeyfield, D.C.; Rauschenberger, H.R.; Hinterkopf, J.P.; Johnson, W.E.; Gross, T.S.


    Thiamine deficiency has been linked to early mortality syndrome in salmonids in the Great Lakes. This study was conducted to compare thiamine concentrations in American alligators (Alligator mississippiensis) and Florida largemouth bass (Micropterus salmoides floridanus) eggs from sites with high embryo mortality and high exposure to organochlorine pesticides (OCPs) (Lakes Apopka and Griffin, and Emeralda Marsh, Florida, USA) to those from sites that have historically exhibited low embryo mortality and low OCPs (Lakes Woodruff and Orange, Florida). During June-July 2000, 20 alligator clutches were collected from these sites, artificially incubated, and monitored for embryo mortality. Thiamine and OCPs were measured in one egg/clutch. During February 2002, 10 adult female bass were collected from Emeralda Marsh and Lake Woodruff and mature ovaries analyzed for thiamine and OCP concentrations. Although ovaries from the Emeralda Marsh bass contained almost 1,000-fold more OCPs compared with the reference site, Lake Woodruff, there were no differences in thiamine concentrations between sites (11,710 vs. 11,857 pmol/g). In contrast, alligator eggs from the reference site had five times the amount of thiamine compared with the contaminated sites (3,123 vs. 617 pmol/g). Similarly, clutches with > 55% hatch rates had significantly higher concentrations of thiamine compared with clutches with alligator embryo survival but not in reproductive failure and recruitment of largemouth bass. The cause(s) of this thiamine deficiency are unknown but might be related to differences in the nutritional value of prey items across the sites studied and/or to the presence of high concentration of contaminants in eggs. ?? Wildlife Disease Association 2004.

  12. Novel Hepatozoon in vertebrates from the southern United States. (United States)

    Allen, Kelly E; Yabsley, Michael J; Johnson, Eileen M; Reichard, Mason V; Panciera, Roger J; Ewing, Sidney A; Little, Susan E


    Novel Hepatozoon spp. sequences collected from previously unrecognized vertebrate hosts in North America were compared with documented Hepatozoon 18S rRNA sequences in an effort to examine phylogenetic relationships between the different Hepatozoon organisms found cycling in nature. An approximately 500-base pair fragment of 18S rDNA common to Hepatozoon spp. and some other apicomplexans was amplified and sequenced from the tissues or blood of 16 vertebrate host species from the southern United States, including 1 opossum (Didelphis virginiana), 2 bobcats (Lynx rufus), 1 domestic cat (Felis catus), 3 coyotes (Canis latrans), 1 gray fox (Urocyon cinereoargenteus), 4 raccoons (Procyon lotor), 1 pet boa constrictor (Boa constrictor imperator), 1 swamp rabbit (Sylvilagus aquaticus), 1 cottontail rabbit (Sylvilagus floridanus), 4 woodrats (Neotoma fuscipes and Neotoma micropus), 3 white-footed mice (Peromyscus leucopus), 8 cotton rats (Sigmodon hispidus), 1 cotton mouse (Peromyscus gossypinus), 1 eastern grey squirrel (Sciurus carolinensis), and 1 woodchuck (Marmota monax). Phylogenetic analyses and comparison with sequences in the existing database revealed distinct groups of Hepatozoon spp., with clusters formed by sequences obtained from scavengers and carnivores (opossum, raccoons, canids, and felids) and those obtained from rodents. Surprisingly, Hepatozoon spp. sequences from wild rabbits were most closely related to sequences obtained from carnivores (97.2% identical), and the sequence from the boa constrictor was most closely related to the rodent cluster (97.4% identical). These data are consistent with recent work identifying prey-predator transmission cycles in Hepatozoon spp. and suggest this pattern may be more common than previously recognized. PMID:21506825

  13. Nutritional requirements and diet choices of the pygmy rabbit (Brachylagus idahoensis): a sagebrush specialist. (United States)

    Shipley, Lisa A; Davila, Tara B; Thines, Nicole J; Elias, Becky A


    Sagebrush (Artemisia tridentata) comprises up to 99% of the winter and 50% of the summer diets of pygmy rabbits (Brachylagus idahoensis). Few animals specialize on such plants as sagebrush, which contain high levels of plant chemicals that can be toxic. We investigated the nutritional requirements of pygmy rabbits and their ability and propensity to consume sagebrush alone and as part of a mixed diet. We compared diet choices of pygmy rabbits with that of a generalist forager, the eastern cottontail (Sylvilagus floridanus). Pygmy rabbits had a moderately low nitrogen requirement (306.5 mg N/kg(0.75)/d), but a relatively high energy requirement, needing 750.8 kJ digestible energy/kg(0.75)/d to maintain their body mass while residing in small cages. They digested fiber in pelleted diets similarly to other small hindgut fermenters, but both cottontails and pygmy rabbits digested the fiber in sagebrush better than expected based on its indigestible acid detergent lignin content. Pygmy rabbits consumed more sagebrush than cottontails, regardless of the amount and nutritional quality of supplemental pellets provided. When consuming sagebrush alone, they ate barely enough to meet their energy requirements, whereas cottontails ate only enough sagebrush to meet 67% of theirs. Both rabbit species ate more sagebrush as the quality and quantity of supplemental pellets declined, and more greenhouse-grown sagebrush than sagebrush grown outside. Urine was more acidic when consuming sagebrush than when consuming pellets, indicating detoxification by the liver. Pygmy rabbits do not require sagebrush to survive, but seem to tolerate terpenes and other plant chemicals in sagebrush better than cottontails do. PMID:17082988

  14. An Analysis of Overstory Tree Canopy Cover in Sites Occupied by Native and Introduced Cottontails in the Northeastern United States with Recommendations for Habitat Management for New England Cottontail.

    Directory of Open Access Journals (Sweden)

    Bill Buffum

    Full Text Available The New England cottontail (Sylvilagus transitionalis is a high conservation priority in the Northeastern United States and has been listed as a candidate species under the Endangered Species Act. Loss of early successional habitat is the most common explanation for the decline of the species, which is considered to require habitat with dense low vegetation and limited overstory tree canopy. Federal and state wildlife agencies actively encourage landowners to create this habitat type by clearcutting blocks of forest. However, there are recent indications that the species also occupies sites with moderate overstory tree canopy cover. This is important because many landowners have negative views about clearcutting and are more willing to adopt silvicultural approaches that retain some overstory trees. Furthermore, it is possible that clearcuts with no overstory canopy cover may attract the eastern cottontail (S. floridanus, an introduced species with an expanding range. The objective of our study was to provide guidance for future efforts to create habitat that would be more favorable for New England cottontail than eastern cottontail in areas where the two species are sympatric. We analyzed canopy cover at 336 cottontail locations in five states using maximum entropy modelling and other statistical methods. We found that New England cottontail occupied sites with a mean overstory tree canopy cover of 58% (SE±1.36, and was less likely than eastern cottontail to occupy sites with lower overstory canopy cover and more likely to occupy sites with higher overstory canopy cover. Our findings suggest that silvicultural approaches that retain some overstory canopy cover may be appropriate for creating habitat for New England cottontail. We believe that our results will help inform critical management decisions for the conservation of New England cottontail, and that our methodology can be applied to analyses of habitat use of other critical wildlife

  15. The safety of ONRAB® in select non-target wildlife. (United States)

    Fry, Tricia L; Vandalen, Kaci K; Duncan, Colleen; Vercauteren, Kurt


    ONRAB(®) is a recombinant human adenovirus type 5 (HAd5) with the rabies glycoprotein gene incorporated into its genome. ONRAB(®) has been used in Canada as an oral rabies vaccine in target wildlife species such as: red fox (Vulpes vulpes), raccoon (Procyon lotor), and striped skunk (Mepthis mephitis). We evaluated the safety of ONRAB(®) in non-target wildlife species likely to contact the vaccine baits during oral rabies vaccine campaigns in the United States. We investigated the effects of oral inoculation of high titer ONRAB(®), approximately ten times the dose given to target species, in wood rats (Neotoma spp.), eastern cottontail rabbits (Sylvilagus floridanus), Virginia opossums (Didelphis virginiana), eastern wild turkeys (Meleagris gallopavo silvestri), and fox squirrels (Sciurus niger). We performed real-time polymerase chain reaction (PCR) on fecal swabs, oral swabs, and tissues, including lung, liver, kidney, small intestine, large intestine, and when appropriate nasal turbinates, to detect ONRAB(®) DNA from inoculated animals. By seven days post-inoculation, turkeys, opossums, and cottontails had all stopped shedding ONRAB(®) DNA. One wood rat and one fox squirrel still had detectable levels of ONRAB(®) DNA in fecal swabs 14 days post-inoculation. Real-time PCR analysis of the tissues revealed some ONRAB(®) DNA persisting in certain tissues; however, there were no significant gross or histologic lesions associated with ONRAB(®) in any of the species studied. Our results suggest that many non-target species are not likely to be impacted by the distribution of ONRAB(®) as part of oral rabies vaccination programs in the United States. PMID:23831321

  16. Detection of Babesia and Anaplasma species in rabbits from Texas and Georgia, USA. (United States)

    Yabsley, Michael J; Romines, Janean; Nettles, Victor F


    Rabbits have been shown to harbor a suite of zoonotic organisms, including a Babesia species, Borrelia burgdorferi, and Anaplasma phagocytophilum. In this study, we conducted a molecular survey for various tick-borne pathogens in three species of rabbits from Texas and Georgia. Of 18 black-tailed jackrabbits (Lepus californicus) tested from Texas, six (28%) were polymerase chain reaction (PCR) positive for Babesia, and nucleotide sequencing revealed two distinct species or strains. Two jackrabbits were infected with a Babesia species or strain (Babesia sp. A) that was nearly identical (99.9%) to a piroplasm previously detected in humans from Washington state, and the remaining four jackrabbits were infected with a Babesia species (Babesia sp. B) that was most similar (99.7%) to a Babesia species detected in cottontail rabbits from Massachusetts and humans from Kentucky and Missouri. Eleven (61%) black-tailed jackrabbits were positive for A. bovis, and one was positive for A. phagocytophilum. Two of four desert cottontails (Sylvilagus audubonii) from Texas were positive for the Babesia sp. B, and one desert cottontail each was positive for A. bovis and A. phagocytophilum. One of these desert cottontails was coinfected with the Babesia sp. B and A. phagocytophilum, and five jackrabbits were coinfected with Babesia species and A. bovis. Of 19 eastern cottontails (S. floridanus) from Georgia, only one (5.3%) was positive for A. phagocytophilum, and three (15.8%) were positive for A. bovis. No rabbits from Texas or Georgia were positive for Borrelia species. The only tick species detected on the Texas and Georgia rabbits was the rabbit tick, Haemaphysalis leporispalustris. These data extend the geographic and host range of these pathogens, and because both the Babesia species and A. phagocytophilum are potential zoonotic pathogens, it is important to be aware that these organisms are enzootic in parts of the southern United States. PMID:16584322

  17. Evolution of viral sensing RIG-I-like receptor genes in Leporidae genera Oryctolagus, Sylvilagus, and Lepus. (United States)

    Lemos de Matos, Ana; McFadden, Grant; Esteves, Pedro J


    One of the most severe European rabbit (Oryctolagus cuniculus) pathogens is myxoma virus (MYXV), a rabbit-specific leporipoxvirus that causes the highly lethal disease myxomatosis. Other leporid genera, Sylvilagus and Lepus, encompass species with variable susceptibilities to MYXV, but these do not develop the lethal form of the disease. The protective role of the retinoic acid-inducible gene-I (RIG-I/DDX58) in sensing MYXV in nonpermissive human myeloid cells prompted the study of the RIG-I-like receptor (RLR) family evolution in the three leporid genera. This viral-sensor family also includes the melanoma differentiation-associated factor 5 (MDA5/IFIH1), and the laboratory of genetics and physiology 2 (LGP2/DHX58). Considering specifically the MYXV susceptible host (European rabbit) and one of the virus natural long-term hosts (Sylvilagus bachmani, brush rabbit), the amino acid differences of positively selected sites in RIG-I between the two species were located in the protein region responsible for viral RNA recognition and binding, the repressor domain. Such differences might play a determinant role in how MYXV is sensed. When looking for episodic selection on MDA5 and LGP2 of the eastern cottontail (Sylvilagus floridanus), we also uncovered evidence of selective pressures that might be exerted by a species-specific leporipoxvirus, the Shope fibroma virus. Finally, a putative alternative splicing case was identified in Oryctolagus and Lepus MDA5 isoforms, corresponding to the deletion of one specific exon. This study provided the first insights into the evolution of the leporid RLR gene family that helps illuminate the origins of the species-specific innate responses to pathogens and more specifically to MYXV. PMID:24220721

  18. An Analysis of Overstory Tree Canopy Cover in Sites Occupied by Native and Introduced Cottontails in the Northeastern United States with Recommendations for Habitat Management for New England Cottontail. (United States)

    Buffum, Bill; McGreevy, Thomas J; Gottfried, Amy E; Sullivan, Mary E; Husband, Thomas P


    The New England cottontail (Sylvilagus transitionalis) is a high conservation priority in the Northeastern United States and has been listed as a candidate species under the Endangered Species Act. Loss of early successional habitat is the most common explanation for the decline of the species, which is considered to require habitat with dense low vegetation and limited overstory tree canopy. Federal and state wildlife agencies actively encourage landowners to create this habitat type by clearcutting blocks of forest. However, there are recent indications that the species also occupies sites with moderate overstory tree canopy cover. This is important because many landowners have negative views about clearcutting and are more willing to adopt silvicultural approaches that retain some overstory trees. Furthermore, it is possible that clearcuts with no overstory canopy cover may attract the eastern cottontail (S. floridanus), an introduced species with an expanding range. The objective of our study was to provide guidance for future efforts to create habitat that would be more favorable for New England cottontail than eastern cottontail in areas where the two species are sympatric. We analyzed canopy cover at 336 cottontail locations in five states using maximum entropy modelling and other statistical methods. We found that New England cottontail occupied sites with a mean overstory tree canopy cover of 58% (SE±1.36), and was less likely than eastern cottontail to occupy sites with lower overstory canopy cover and more likely to occupy sites with higher overstory canopy cover. Our findings suggest that silvicultural approaches that retain some overstory canopy cover may be appropriate for creating habitat for New England cottontail. We believe that our results will help inform critical management decisions for the conservation of New England cottontail, and that our methodology can be applied to analyses of habitat use of other critical wildlife species. PMID

  19. Small mammal survival and trapability in mark-recapture monitoring programs for hantavirus. (United States)

    Parmenter, C A; Yates, T L; Parmenter, R R; Mills, J N; Childs, J E; Campbell, M L; Dunnum, J L; Milner, J


    Following the 1993 hantavirus pulmonary syndrome (HPS) epidemic in the south-western United States, mammalogists and epidemiologists instituted long-term studies to monitor population density and prevalence of infection in rodents which constitute the reservoir for Sin Nombre virus (SNV). In this study, field techniques used in sampling small mammals for SNV infection were evaluated to determine if trapping and handling protocols were having significant effects on future trapability or mortality of animals. We compared rodent mark-recapture control plots, on which all rodents were simply measured, marked, and released on site, with experimental plots on which all animals were anesthetized with methoxyflurane, sampled for blood and saliva, measured, marked, and released. Blood samples were obtained from anesthetized animals on the experimental plots via a retro-orbital sinus puncture using a heparinized capillary tube. Dacron tipped oral swabs were used to collect buccal cells and saliva from the rodent's oral cavity. Field data were collected monthly from August 1994 to August 1996 at two sites in New Mexico (USA). Analyses were based on 3,661 captures of 1,513 individuals representing 21 species from three rodent families (Rodentia: Muridae, Heteromyidae, Sciuridae) and two species of rabbits (Lagomorpha: Leporidae). Overall, for most murid rodents (including five Peromyscus spp., Neotoma albigula, and Onychomys leucogaster) and one rabbit species (Sylvilagus floridanus), the handling/bleeding procedures had no significant effects on recapture rates or mortality. In contrast, several species of heteromyids (Dipodomys ordii and Perognathus flavus), one murid (Reithrodontomys megalotis) and one leporid (S. auduboni) suffered higher mortality rates, and heteromyid kangaroo rats (D. ordii and D. merriami) exhibited lower trapability as a result of the anesthesia and sampling procedures. In view of the overall non-significant influence of the sampling procedures on

  20. Serum antibodies to whole-cell and recombinant antigens of Borrelia burgdorferi in cottontail rabbits. (United States)

    Magnarelli, Louis A; Norris, Steven J; Fikrig, Erol


    Archived serum samples, from 95 eastern cottontail rabbits (Sylvilagus floridanus) captured in New York, New York, USA and Millbrook, New York, USA, during 1985-86, were analyzed in solid-phase enzyme-linked immunosorbent assays (ELISA) for total and class-specific immunoglobulin (Ig) M antibodies to whole-cell or recombinant antigens of Borrelia burgdorferi sensu stricto. Using a polyvalent conjugate, rabbit sera contained antibodies to whole-cell and recombinant antigens (protein [p]35, p37, or VlsE) during different seasons, but there was no reactivity to outer surface protein (Osp)A or OspB. Seventy-six of the 102 sera (75%) analyzed were reactive with one or more of the antigens; 61 of the positive samples (80%) reacted to whole-cell antigens, followed by results for the p35 (58%, 44/76), VlsE (43%, 33/76), and p37 (29%, 22/ 76) antigens. Fifty-eight sera (76%) contained antibodies to the VlsE or p35 antigens with or without reactivity to whole-cell antigens. High antibody titers (≥1:2,560) recorded for 52 sera indicate robust antibody production. In analyses for IgM antibodies in an ELISA containing whole-cell antigens, there were 30 positive sera; titers ranged from 1:160 to 1:640. There was minimal cross-reactivity when rabbit antisera to Treponema pallidum or four serovars of Leptospira interrogans were screened against B. burgdorferi antigens. Based on more-specific results, VlsE and p35 antigens appear to be useful markers for detecting possible B. burgdorferi infections. PMID:22247369

  1. High contaminant loads in Lake Apopka's riparian wetland disrupt gene networks involved in reproduction and immune function in largemouth bass. (United States)

    Martyniuk, Christopher J; Doperalski, Nicholas J; Prucha, Melinda S; Zhang, Ji-Liang; Kroll, Kevin J; Conrow, Roxanne; Barber, David S; Denslow, Nancy D


    Lake Apopka (FL, USA) has elevated levels of some organochlorine pesticides in its sediments and a portion of its watershed has been designated a US Environmental Protection Agency Superfund site. This study assessed reproductive endpoints in Florida largemouth bass (LMB) (Micropterus salmoides floridanus) after placement into experimental ponds adjacent to Lake Apopka. LMB collected from a clean reference site (DeLeon Springs) were stocked at two periods of time into ponds constructed in former farm fields on the north shore of the lake. LMB were stocked during early and late oogenesis to determine if there were different effects of contamination on LMB that may be attributed to their reproductive stage. LMB inhabiting the ponds for ~4months had anywhere from 2 to 800 times higher contaminant load for a number of organochlorine pesticides (e.g. p, p'-DDE, methoxychlor) compared to control animals. Gonadosomatic index and plasma vitellogenin were not different between reproductively-stage matched LMB collected at reference sites compared to those inhabiting the ponds. However, plasma 17β-estradiol was lower in LMB inhabiting the Apopka ponds compared to ovary stage-matched LMB from the St. Johns River, a site used as a reference site. Sub-network enrichment analysis revealed that genes related to reproduction (granulosa function, oocyte development), endocrine function (steroid metabolism, hormone biosynthesis), and immune function (T cell suppression, leukocyte accumulation) were differentially expressed in the ovaries of LMB placed into the ponds. These data suggest that (1) LMB inhabiting the Apopka ponds showed disrupted reproduction and immune responses and that (2) gene expression profiles provided site-specific information by discriminating LMB from different macro-habitats. PMID:27397556

  2. New records of stink bugs (Hemiptera: Pentatomidae) from Colombia. (United States)

    Castro-Huertas, Valentina; Schwertner, Cristiano F; Fernández, Fernando


    New records of genera and species of stink bugs (Hemiptera: Pentatomidae) from Colombia are provided. Two genera are new records for South America: Alathetus and Schraderiellus. Fifteen genera are new record for Colombia: Agaclitus, Boea, Ceratozygum, Euthyrhynchus, Eritrachys, Doesburguedessa, Lopadusa, Marmessulus, Paralincus, Patanius, Peromatus, Phalaecus, Phoeacia, Rio, and Tyrannocoris. Forty-nine species from five subfamiles are recorded for the first time in Colombia. Asopinae: Coryzorhaphis carneolus Erichson, Coryzorhaphis superba Breddin, Euthyrhynchus floridanus (Linnaeus), Podisus sagitta Fabricius, Stiretrus anchorago (Fabricius), Stiretrus cinctellus Germar, Tylospilus peruvianus Horvath, Tyrannocoris nigriceps Thomas. Cyrtocorinae: Ceratozygum horridum (Germar). Discocephalinae: Agaclitus dromedarius Stål, Antiteuchus melanoleucus (Westwood), Antiteuchus sepulcralis (Fabricius), Dinocoris gibbosus (Fallou), Dinocoris variolosus (Linnaeus), Discocephalessa terminalis (Walker), Dryptocephala crenata Ruckes, Dryptocephala dentifrons (Latreille), Eurystethus ovalis Ruckes, Paralcippus dimidiatus (Ruckes), Alathetus rufitarsus Dallas, Eritrachys bituberculata Ruckes, Paralincus bimaculatus (Ruckes), Schraderiellus cinctus (Ruckes), Xynocoris recavus (Garbelotto & Campos). Edessinae: Brachystethus cribus (Fabricius), Brachystethus tricolor Bolívar, Doesburguedessa elongatispina Fernandes and Lopadusa fuscopunctata (Distant). Pentatominae: Banasa fulgida Thomas, Banasa paraexpallescens Thomas, Dichelops divisus (Walker), Dichelops nigrum Bergroth, Euschistus carbonerus Rolston, Mormidea bovilla (Distant), Mormidea triangularis (Walker), Murgantia bifasciata Herrich-Schaeffer, Murgantia violascens (Westwood), Oebalus pugnax (Fabricius), Oebalus ypsilon-griseus (DeGeer), Odmalea concolor (Walker), Patanius vittatus Rolston, Proxys albopunctulatus (Palisot), Proxys punctulatus (Palisot), Rhyncholepta grandicallosa Bergroth, Rio insularis Ruckes, Roferta

  3. Chemical defense of Hymeniacidon heliophila (Porifera: halichondrida against tropical predators

    Directory of Open Access Journals (Sweden)

    Suzi Meneses Ribeiro


    Full Text Available Various benthic organisms have chemical defenses which reduce their predators' consumption. Although their efficiency may be noticed in many organisms, many of their effects are not well- known yet. Multiple ecological roles of secondary metabolites are shown in some sponges, which may represent an adaptative advantage considering the high amount of energy used to produce these chemical compounds. The goal of this work was to investigate the defensive property of the extracts from the sponge Hymeniacidon heliophila against the tropical predators: hermit crabs (Calcinus tibicens, sea urchins (Lytechinus variegatus and generalist fishes. Extracts obtained with n-hexane, ethyl acetate and acetone/methanol were used in assays and all of them were effective in reducing the consumption by C. tibicens; n-hexane extract reduced the consumption by L. variegatus; and medium polarity extracts reduced fish consumption. Either the variation in action or the multiple ecological roles of the extracts indicates that different types of compounds can be associated to the defensive system produced by H. heliophila.Diversos organismos bênticos possuem defesas químicas que ajudam a diminuir a predação. Embora sua eficácia seja comprovada, muitos de seus efeitos são ainda desconhecidos. Múltiplas funções dos metabolitos secundários foram evidenciadas em algumas esponjas e isso pode representar uma vantagem adaptativa, considerando o alto valor energético gasto pelas espécies para produzí-los. O objetivo desse trabalho foi investigar as propriedades defensivas de extratos da esponja Hymeniacidon heliophila contra predadores tropicais: paguros (Calcinus tibicens, ouriços-do-mar (Lytechinus variegatus e peixes generalistas. Extratos em n-hexano, acetato de etila e acetona/metanol foram usados nos ensaios e todos foram eficientes na redução do consumo por C. tibicen; extratos em n-hexano reduziram o consumo por L. variegatus; e extratos de m

  4. Hemiptera acuáticos asociados a los estuarios de la costa pacífica colombiana Aquatic Hemiptera associated to estuaries of the colombian pacific coast

    Directory of Open Access Journals (Sweden)



    Full Text Available la mayoría de los hemípteros acuáticos son insectos predadores que habitan en agua dulce, estuarios y mar. Las familias que incluyen especies de hábitat salobres y estuarios son Gerridae y Veliidae. Con el fin de contribuir al conocimiento faunístico y ecológico de los hemípteros acuáticos asociados a los estuarios de la Costa Pacífica de Colombia y de la región del Chocó biogeográfico, se estudiaron seis estuarios del municipio de Tumaco: El Bajito, El Morro, Villa del Sol, Agua clara, Chilvi, e Inguapi, donde se realizaron recolecciones y se caracterizó el hábitat a través de la medición de algunos parámetros fisicoquímicos del agua. En total se colectaron diez especies, pertenecientes a tres familias: Gerridae con cuatro géneros Limnogonus, Rheumatobates, Telmatometroides y Trepobates; Veliidae, con dos géneros Microvelia y Rhagovelia; y un Mesoveliidae, con Mesovelia. Se caracteriza el hábitat y se señalan las especies más abundantes por sitio de muestreo. Se registra por primera vez en Colombia la especie Microvelia inquilina y se adicionan nuevos datos para las especies en la costa Pacífica del departamento de Nariño.Most of the aquatic hemipterans are predatory insects that inhabit fresh waters, estuaries and a few live in the open ocean. Ocean-dwelling and estuarine-inhabiting families include Gerridae and Veliidae. With the purpose of contributing to the biodiversity and ecology of aquatic hemipterans associated with estuaries of the Pacific coast of Colombia and the Chocó biogeographical region, six estuaries were studied from the municipality of Tumaco: El Bajito, El Morro, Villa del Sol, Agua clara, Chilvi, and Inguapi. Aquatic hemiptera were collected and each habitat was characterized measuring physical-chemical parameters of the water. In total, ten species were collected belonging to four genera Limnogonus, Rheumatobates, Telmatometroides, and Trepobates (Family: Gerridae; and two genera Microvelia and


    Directory of Open Access Journals (Sweden)

    Cindy Alexandra Córdoba Vargas

    Full Text Available En una finca ecológica (FE y una convencional (FC se comparó el comportamiento de poblaciones de babosas y su relación con algunos carábidos predadores, la presencia de arvenses, prácticas agrícolas y la productividad de cuatro variedades de lechuga (Lactuca sativa. L.. Semanalmente se realizaron capturas de babosas, conteos de nivel de daño, altura y número de hojas en 10 plantas. Se recolectaron arvenses y coleópteros en las dos fincas. Los conteos totales de babosas en la FE fueron estadísticamente superiores. Se colectaron cuatro especies (Deroceras. reticulatum, Milax gagates, Deroceras. laeve y Limax. maximux frente a dos encontradas en FC. Con excepción de la variedad "Morada Lisa", no se encontraron diferencias significativas en el nivel de daño en las otras variedades entre las dos fincas, pero sí en la variable peso seco de FE. En FE se presentaron 5 especies de carábidos y 25 de arvenses frente a ninguna y 6 en FC, respectivamente. Los datos anteriores se explican en función de las prácticas agronómicas de cada sistema de manejo.In an organic (FE and a conventional (FC farm system the population behavior of slugs and their relationship with some carabids predators was compared, as well as, the presence of weeds, agricultural practices and productivity of four varieties of lettuce. Weekly catches of slugs were made and the damage level, height and the number of leaves in ten plants was measured. Weeds and carabids were collected in both farms. The total number of slugs in the FE was statistically higher and four species (D. reticulatum, Milax gagates, D. and L. laev maximux were collected compared with two found in FC. With the exception of the variety "Morada Lisa", there were no significant differences in the level of damage in the other varieties between the two farms. There were significant differences in the dry weight variable in favour of the organic farm. In FE, 5 carabids species and 25 weeds were presented

  6. The food spectrum of the cardinal - tetra (Paracheirodon axelrodi, Characidae in its natural habitat Estratégias alimentares do cardinal-tetra (Paracheirodon axelrodi, Characidae em seu ambiente natural

    Directory of Open Access Journals (Sweden)

    Ilse Walker


    Full Text Available The cardinal tetra (Paracheirodon axelrodi is the most intensively commercialized ornamental fish from the Rio Negro Basin (Amazonas State, Brasil. Analysis of the stomach and gut contents of fish caught in their natural habitats show conclusively that the cardinal is essentially a predator, feeding on the mesofauna that adheres to submerged litter, roots and waterplants. Microcrustacea and chironomid larvae (Diptera were the most frequently ingested prey, while algae intake was relatively infrequent. It is argued that the relatively small size of the cardinals captured in their natural habitat is due to the annual migrations imposed by the inundation cycles, rather than to resource limitation, because it is known from earlier investigations of similar habitats, that these plant substrates are densely colonized by the aquatic mesofauna. Cardinals raised in captivity are larger and have higher rates of growth.O cardinal (Paracheirodon axelrodi é o peixe ornamental comercializado com maior intensidade na Bacia do Rio Negro (Estado do Amazonas, Brasil. Análise do conteúdo estomacal de peixes capturados nos seus habitats naturais mostra, que o cardinal é essencialmente um predador, alimentando-se da mesofauna que está colonizando a liteira submersa, arbustos submersos, raízes flutuantes e plantas aquáticas. As presas principais são microcrustáceos e larvas de quironomídeos (Chironomidae, Diptera, enquanto ingestão de algas é pouco freqüente. Considera-se que o tamanho relativamente pequeno de cardinais capturados nos ambientes naturais é devido as migrações anuais que acompanham os ciclos anuais de enchente e vazante, e não à falta de recursos; já que é conhecido de ambientes parecidos de outros rios da região, que estes substratos aquáticos são densamente colonizados pela mesofauna. Cardinais criados em cativeiros tem taxas de crescimento mais altas e são de tamanho maiores.

  7. Estrutura da Comunidade de Invertebrados Bentônicos do Rio Piranhas-Assu, Rio Grande do Norte, Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Jansen Fernandes Medeiros


    Full Text Available Esse trabalho teve como objetivo conhecer os invertebrados bentônicos, bem como caracterizar os grupos tróficos funcionais existentes no rio Piranhas-Assu, município de Alto do Rodrigues, Rio Grande do Norte. As coletas foram realizadas nos meses de maio (chuva, julho e setembro (seca de 2002, em trechos diferentes do rio. Foi medida a velocidade da correnteza, a largura, profundidade do rio e temperatura da água. Foram coletados 3525 indivíduos de Insecta e outras classes (Malacostraca, Gastropoda, Bivalvia, Arachnida, Ostracoda e Copepoda. A maior abundância da classe Insecta ocorreu no mês de setembro (seca. A vazão apresentou correlação com a abundância com na Classe Insecta, já a velocidade superficial da água para outras classes. Entre os Insecta observou-se uma maior abundância de predadores, seguida dos coletores, já para as outras classes os raspadores foram mais abundantes.Structure of benthic invertebrate’s community with focus in the aquatic insects of the Piranhas-Assu river, State of Rio Grande do Norte, Northeast, BrazilAbstract. The aim of this work was to verify the benthonic invertebrates, and to identify the functional trophic groups that exist in the Piranhas-Assu, in Alto do Rodrigues municipality, Rio Grande do Norte State. The samples were carried taken on May (rain season, July and September (dry season from 2002, in different sites in the river. The measurements of water speed, wide, temperature and river deep where made. It was collected 3525 individuals of Insecta and other classes (Malacostraca, Gastropoda, Bivalvia, Arachnida, Ostracoda and Copepoda. Insecta showed a higher abundance in September (dry season. The river discharge showed significant correlation with Insecta classe abundance, and the superficial water speed had correlation with other classes. The insects showed a highest abundance of predators, followed by collectors, in the other classes, the scrappers were the most abundant.

  8. Selectivity of phytosanitary products used in organic farming on adult of Cryptolaemus montrouzieri (Coleoptera, Coccinellidae under laboratory conditionsSeletividade de produtos fitossanitários, usados no sistema de produção orgânica, sobre adultos de Cryptolaemus montrouzieri (Coleoptera, Coccinellidae, em laboratório

    Directory of Open Access Journals (Sweden)

    Cláudia Bernardes Ourique


    Full Text Available The association of pesticides with biological control is possible only if they provide some selectivity to natural enemies. In the organic production system the effect of insecticides on beneficial insects has not been extensively studied. Thus, this study aimed to evaluate in laboratory conditions the effect of pesticides used in this system on the adults of the predator Cryptolaemus montrouzieri Mulsant (Coleoptera, Coccinellidae. We used four treatments, which corresponded to four multiple values (0.25x, 0.5x, 2x and 1x of the concentration recommended by manufacturers of the following products: Rotenat CE®, Pironat®, Biopirol 7M®, Organic Neem®, Natuneem® and lime sulfur, which were tested in C. montrouzieri by topical application and residual exposure. None of the products, at any concentrations tested, had a significant effect on the survival of adults of C. montrouzieri, what did not differ from the distilled water control, showing that the products tested are selective to the adults of this species. However, other forms of exposure and evaluation methods must be studied.A associação do controle biológico com produtos fitossanitários só é possível se estes apresentarem alguma seletividade aos inimigos naturais. No sistema de produção orgânica, o efeito de inseticidas sobre insetos benéficos não tem sido extensivamente estudado. Assim, este trabalho objetivou avaliar em laboratório o efeito de produtos fitossanitários utilizados neste sistema, sobre adultos do predador Cryptolaemus montrouzieri Mulsant (Coleoptera, Coccinellidae. Foram utilizados quatro tratamentos, os quais corresponderam quatro múltiplos (0,25x, 0,5x, 1x e 2x da concentração recomendada pelos fabricantes dos seguintes produtos comerciais: Rotenat CE®, Pironat®, Biopirol 7M®, Organic neem®, Natuneem® e calda sulfocálcica, que foram testados sobre C. montrouzieri por aplicação tópica e exposição a resíduos. Nenhum dos produtos, em qualquer

  9. Solapamiento trófico entre el lobo marino de un pelo Otaria flavescens y la pesquería de arrastre demersal del golfo San Matías, Patagonia, Argentina Trophic overlap between the South American sea lion Otaria flavescens and the demersal trawl fishery in San Matías Gulf, Patagonia, Argentina

    Directory of Open Access Journals (Sweden)

    María Alejandra Romero


    Full Text Available A nivel internacional, paralelo a la declinación y al colapso de pesquerías de gran escala, surgió un interés creciente por el estudio de las interacciones entre mamíferos marinos y pesquerías. El golfo San Matías (Patagonia, Argentina es considerado un ecosistema pesquero independiente de las aguas de la Plataforma Continental Argentina, con condiciones oceanográficas y biológicas particulares. La condición de sistema semi-cerrado podría generar escenarios particulares para la interacción entre la flota pesquera de arrastre de fondo y la población de lobos marinos de un pelo Otaria flavescens. En el presente trabajo se caracterizó la dieta del predador y la composición de las capturas pesqueras a fin de evaluar el solapamiento trófico entre ambos componentes. A partir de este análisis y la comparación de las tallas de las presas consumidas, se encontró que la posibilidad de una interacción competitiva entre la flota pesquera y los lobos marinos, a partir de la utilización de recursos similares, sería baja en el ecosistema del golfo San Matías.As world fisheries began to decline and massive collapses were observed, the competition between marine mammals and fisheries became an issue of growing concern. San Matías Gulf (Patagonia, Argentina is considered to be a fishery ecosystem independent of the Argentine Continental Shelf waters, with particular oceanographic and biological properties. As a semi-enclosed ecosystem, this gulf may generate particular scenarios for interactions between the demersal trawl fishery fleet and the population of South American sea lions Otaria flavescens. In this paper, the diet of the top predator and the composition of fishery catches were characterized in order to assess the trophic overlap between these two components. This analysis and a comparison of the sizes of prey consumed revealed a low probability of competition for similar resources between the fishing fleet and the marine mammals

  10. Duração e viabilidade das fases pré-imaginais de Chrysoperla externa (Hagen alimentadas com Aphis gossypii Glover e Sitotroga cerealella (Olivier Duration and viability of Chrysoperla externa (Hagen pre-imago phases, fed with Aphis gossypii (Glover and Sitotroga cerealella (Olivier

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo


    Full Text Available Estudou-se a duração e a viabilidade das fases imaturas de Chrysoperla externa (Hagen (Neuroptera, Chrysopidae alimentadas com o pulgão do algodoeiro, Aphis gossypii Glover (Homoptera, Aphididae, e com a traça do milho, Sitotroga cerealella (Olivier (Lepidoptera: Gelechiidae. A pesquisa foi conduzida no Laboratório de Entomologia da Embrapa - CNPA, em Campina Grande, Paraíba, em 1998/99 em condições controladas sob temperatura de 25±2ºC, 70±10% UR e fotofase de 12 horas. O desenvolvimento pré-imaginal de C. externa decorreu normalmente: fase larval com três ínstares, pré-pupa e pupa. De acordo com os resultados, pode-se concluir que as larvas de C. externa alimentadas com A. gossypii apresentam uma duração significativamente maior para o primeiro e terceiro ínstares, que às alimentadas com S. cerealella. Entretanto, não há efeito dessas presas na viabilidade das fases desse predador, exceto para a de pré-pupa. C. externa pode ser criado em A. gossypii ou S. cerealella sem risco de perda de viabilidade, embora algumas fases possam ser mais longas.This work was carried out at the Laboratório de Entomologia da Embrapa - CNPA, in Campina Grande, state of Paraíba, Brazil, in 1998/99, to study the duration and viability of Chrysoperla externa (Hagen (Neuroptera, Chrysopidae larvae, fed with Aphis gossypii (Homoptera, Aphididae and Sitotroga cerealella (Lepidoptera: Gelechiidae, under controlled conditions. The temperature was 25+-2º C, 70+-10% UR and 12-hour photophase. The C. externa pre-imaginal development was normal: larval phase with three instars, pre-pupa and pupa. The results showed that C. externa larvae fed on A. gossypii had a first and third instar longer than the ones fed with S. cerealella. However, no effect was observed in the phases' viability, excepting the pre-pupa. C. externa can feed on both preys without viability loss, although this may enhance some phases' duration.

  11. Toxicidade diferencial de agrotóxicos utilizados em citros para Neoseiulus californicus, Euseius concordis e Brevipalpus phoenicis

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available Brevipalpus phoenicis (Geijskes (Acari: Tenuipalpidae é considerada uma das principais pragas em citros no Brasil, devido à transmissão do vírus da leprose dos citros e à necessidade de frequentes aplicações de acaricidas para seu controle. Assim, objetivou-se comparar a toxicidade dos principais agrotóxicos utilizados em citros no Brasil, sobre populações de B. phoenicis e de ácaros predadores das espécies Neoseiuluscalifornicus (McGregor e Euseius concordis (Chant (Acari: Phytoseiidae. Foram avaliadas duas populações de E. concordis: uma procedente de Jaboticabal (SP e outra de Descalvado (SP. Arenas de folhas (para fitoseídeos ou frutos (para B. phoenicis de Citrus sinensis Osbeck (L. cv. Pera, contendo 25 fêmeas adultas de cada espécie foram pulverizadas em torre de Potter. As avaliações de mortalidade foram realizadas 72 horas após a aplicação. Foram utilizadas 4 a 6 concentrações de cada produto (abamectina, acefato, azociclotina, bifentrina, clorfenapir, dicofol, dinocape, óxido de fembutatina, propargito e piridabem para a obtenção das curvas de concentração-resposta. Abamectina, azociclotina, clorfenapir, dicofol, dinocape, óxido de fembutatin, propargito e piridabem foram altamente tóxicos a B. phoenicis, com valores de CL90 iguais ou inferiores aos das concentrações recomendadas desses produtos. N. californicus foi mais tolerante a bifentrina, propargito, óxido de fembutatina e dinocape que B. phoenicis e E. concordis (ambas as populações. Esses acaricidas tiveram baixa toxicidade aos adultos de N. californicus, para o qual as CL50 foram pelo menos seis vezes maiores que suas concentrações recomendadas. Acefato foi extremamente tóxico a E. concordis, mas inócuo a adultos de N. californicus. A população de E. concordis de Jaboticabal foi mais resistente que a de Descalvado a azociclotina, bifentrina, clorfenapir, dicofol e propargito.

  12. Predação de sementes ao longo de uma borda de Floresta Ombrófila Mista e pastagem Seed predation along an edge gradient between Araucaria forest and pasture

    Directory of Open Access Journals (Sweden)

    Ronei Baldissera


    Full Text Available Este estudo teve como objetivo avaliar o processo de predação de sementes em três árvores nativas (Mimosa scabrella Bentham, Prunus sellowii Koehne e Myrsine laetevirens Mez. ao longo de uma borda de Floresta Ombrófila Mista e pastagem, na Floresta Nacional de São Francisco de Paula, RS, Brasil. Grupos de sementes foram distribuídos em dez pontos aleatórios nas distâncias: 0m, 25m, 50m, 100m e 250m da borda para dentro da floresta e 5m e 50m da borda para dentro da pastagem. As sementes foram monitoradas até a predação total ou até esgotado o tempo para germinação. Houve redução nas taxas de predação de sementes até 50m da borda para dentro da floresta em relação ao interior da floresta e da pastagem. M. scabrella e M. laetevirens apresentaram redução nas taxas de predação de sementes na pastagem próxima à borda da floresta. Os resultados indicam que houve decréscimo na atividade de predadores de sementes nas proximidades da borda florestal estudada, podendo ocorrer maior regeneração de plantas próximo à borda e um avanço da floresta na pastagem adjacente.This study aims to evaluate how seed predation of three native tree species (Mimosa scabrella Bentham, Prunus sellowii Koehne, and Myrsine laetevirens Mez. could be altered along an edge between Araucaria forest and pasture at the National Forest of São Francisco de Paula, Rio Grande do Sul, Brazil. Groups of seeds were placed at ten random points in each of the following distances from the forest edge: 0m, 25m, 50m, 100m, and 250m from the edge into the forest, and 5m and 50m from the edge into the pasture. Seeds were monitored until total predation or until their time for germination was over. Seed predation rates decreased from the edge up to 50m inside the forest in relation to the forest interior and open pasture. M. scabrella and M. laetevirens showed a reduction in seed predation rates in pasture points that were located at the vicinities of the forest

  13. Fallen leaves on the water-bed: diurnal camouflage of three night active fish species in an Amazonian streamlet

    Directory of Open Access Journals (Sweden)

    Ivan Sazima


    cores crípticas e os movimentos de fuga, como uma convergência de respostas defensivas a vertebrados aquáticos que caçam visualmente orientados, provavelmente peixes predadores de hábitos diurnos.

  14. Notas sobre o comportamento alimentar do Anu branco, Guira Guira (GMELIN, 1788 (Cuculiformes, Aves

    Directory of Open Access Journals (Sweden)

    José Hernán Fandiño Mariño


    Full Text Available O comportamento aumentar de um grupo de anus brancos, Guira guira, foi observado em condições naturais, no campus da Universidade Estadual de Londrina, no Paraná. Foram totalizadas vinte horas diurnas de observação direta em várias sessões, no período pôs-reprodutivo. A alimentação ocorre ao longo do dia com intervalos nos quais atividades de manutenção como tomar o sol e o contato de limpeza mú tua, são freqüentes. As áreas de alimentação são abertas, apresentando baixa densidade em árvores. O tipo de alimento está baseado principalmente em insetos saltadores, mas pequenos vertebrados são também aproveitados. O comportamento alimentar é uma atividade de grupo cujo processo inclui aparentemente as seguintes etapas: lo. - Permanência prévia num ponto alto e próximo ao terreno alimentar. 2o. - Descida progressão no terreno, emitindo freqüentemente um chamado característico dos deslocamentos. 3o. — Em terra a técnica de captura consiste em "caminhar perturbando ". A atividade é realizada em grupo o que facilita e aumenta a captura das presas em fuga. O avanço do grupo no campo não tem formação fixa, mas urna tendência a formar linhas paralelas ao sentido da progressão. Uma característica ressaltante do comportamento alimentar, foi a presença quase invariável de um sentinela num ponto alto que teria como função denunciar a presença de predadores terrestres. Diversos mecanismos de coesão do grupo parecem ter evoluído, como possíveis evidências do valor adaptativo desta estrutura social. Entre esses mecanismos, alguns padrões visuais conspícuos, uma ampla gama de vocalizações e certos padrões de comportamento social nos quais se estabelece um contato íntimo entre os indivíduos, pareceram-me de maior importância.

  15. Predação de sementes de plantas daninhas em áreas cultivadas Weed seeds predation in cultivaded fields

    Directory of Open Access Journals (Sweden)

    Alvadi Antonio Balbinot Jr.


    Full Text Available Na investigação das relações ecológicas entre as espécies, observou-se que certos animais, principalmente insetos, alimentavam-se de sementes de plantas daninhas antes e depois da sua deiscência, reduzindo a entrada de sementes no banco de sementes do solo e, portanto, a quantidade total de propágulos disponíveis à germinação. Em situações favoráveis à atividade dos predadores, o consumo de sementes pode ser significativo, chegando a 90% do total de sementes produzidas. Esse processo depende, basicamente, das condições de ambiente e das práticas de manejo adotadas, como: método de preparo do solo, espécie cultivada, densidade e espaçamento da cultura e também do tamanho da lavoura. Deste modo, a predação de sementes pode ser uma ferramenta natural importante para o manejo integrado de plantas daninhas. Todavia são necessários estudos com maior consistência dos fatores envolvidos na regulação do processo de consumo de sementes para elucidação e orientação de práticas culturais que maximizem a intensidade de ocorrência desta forma biológica de manejo de infestantes.In investigating ecological relations among species, it has been observed that various animals, mainly insects, feed on weed seeds before and after their dehiscence, reducing seed replenishment in the soil and total amount of propagules available for future germination. Under favorable conditions for predation activity, consumption of seeds can be quite high, reaching as much as 90% of total seeds produced. This process depends, basically, on environmental conditions and on management practices adopted, as soil preparation method, crop species, crop density and spacing, and on the size of cultivated area. Therefore, seed predation is an important natural tool to be used in integrated weed management. Nevertheless, seed predation requires additional studies in order to elucidate more consintently the factors involved in the regulation of seed

  16. Behavioral changes in Rattus norvegicus experimentally infected by Toxocara canis larvae Alterações de comportamento em Rattus norvegicus experimentalmente infectados por larvas de Toxocara canis

    Directory of Open Access Journals (Sweden)

    Pedro P. Chieffi


    levantaram nas patas traseiras e comportamento exploratório nos ratos infectados, principalmente nos pertencentes ao G2, sugerindo a ocorrência de alterações comportamentais que favoreceriam a transmissão de Toxocara canis para canídeos por meio de relação presa-predador.

  17. Aproximaciones teóricas a la relación naturaleza - cultura: algunas contribuciones entre 1980 – 2004

    Directory of Open Access Journals (Sweden)

    Ricardo Gómez


    Full Text Available El objetivo del presente artículo es mostrar algunas de las críticas más importantes dadas en el debate actual entre naturaleza y cultura. Busca reivindicar nuevos paradigmas de las ciencias dentro de la problemática del agotamiento de los recursos naturales del hogar que habitamos, la tierra, y el papel que juegan las comunidades locales contra el discurso predador del capitalismo global, a partir de su existencia cultural y social. Este trabajo se divide en tres partes que proponen por analogía, un símil entre los momentos de cambio de la noche al amanecer de un nuevo día; de la misma forma en que podríamos pasar de paradigmas “clásicos”, a procesos sociales recientes que incluyen los conocimientos locales. La primera, llamada “la noche”, expone brevísimamente los planteamientos más comunes que el capitalismo y las corrientes positivistas de la ciencia, mantienen frente a la naturaleza. La segunda, “el amanecer”, es una de las partes más importantes del presente escrito, ya que realiza una crítica a la oscuridad de la noche, a los planteamientos del capitalismo global desde el marxismo, el post-estructuralismo y el género. La tercera, “nuevo día”, concluye que a la luz de estas nuevas perspectivas de análisis podemos comprender mejor la relación entre los seres humanos y la tierra. Estos nuevos conocimientos políticos, culturales, ambientales y globales, desde el centro y la periferia, están atravesados por vínculos de poder que proponen una posición integradora entre conceptos aparentemente contradictorios y suponen susuperación a partir de la conciencia que autogeneran buscando orientar el tema político hacia estos nuevos conocimientos dentro de una agenda global.

  18. Insecticide effects of Ruta graveolens, Copaifera langsdorffii and Chenopodium ambrosioides against pests and natural enemies in commercial tomato plantation = Ação inseticida de Ruta graveolens, Copaifera langsdorffii e Chenopodium ambrosioides sobre pragas de tomate

    Directory of Open Access Journals (Sweden)

    Flávia Silva Barbosa


    . Verificou-se que após 24h de pulverização, as parcelas tratadas com o extrato de C. ambrosioides apresentaram menores números de adultos de Tuta absoluta (Lepidoptera: Gelechiidae seguido pelas parcelas tratadas com extrato de R. graveolens. Foram observados menores números do parasitoide de ovos de lepidópteros Trichogramma sp. (Hymenoptera: Trichogrammatidae e da soma dos inimigos naturais (predadores + parasitoides nos tratamentos que receberam as pulverizações com os extratos das plantas de C. langsdorffii e C. ambrosioides seguido por R. graveolens do que na testemunha; do parasitoide da família Eulophidae (Hymenoptera, que atacam lagartas de T. Absoluta em plantas tratadas com R. graveolens, seguido por C. langsdorffii e C. ambrosioides do que na testemunha.


    Directory of Open Access Journals (Sweden)

    Alberto Soto

    Full Text Available Tetranychus urticae es una importante plaga asociada al cultivo de fresa debido a las altas densidades poblacionales alcanzadas y a los daños ocasionados a las plantas. Los productores utilizan acaricidas en grandes volúmenes sin cumplir los periodos de carencia, ocasionando residuos tóxicos en los frutos, desarrollo de poblaciones resistentes a los productos, destrucción de organismos benéficos, intoxicación de mamíferos y contaminación del medio ambiente. Por lo tanto, es necesario generar otras alternativas de manejo de este ácaro plaga. El objetivo de este trabajo fue evaluar, mediante el análisis conjunto de la concentración letal y subletal, la acción tóxica de productos comerciales a base de nim sobre los ácaros T. urticae y Phytoseiulus macropilis. Fueron controladas poblaciones de T. urticae en plantas de fresa cuando se emplearon concentraciones correspondientes a CL95 de los productos alternativos a base de nim, y también cuando se utilizaron concentraciones inferiores. La aplicación de los productos a base de nim, Neem Pro, Organic Neem y Natuneem en la CL95 y cuando la tasa instantánea de crecimiento poblacional ri=0,1 para el predador representan una alternativa viable para el control del ácaro fitófago T. urticae.Tetranychus urticae is an important pest associated with strawberry, due to its high densities and plant damage. Farmers use acaricides in large volumes without complying with the window between the last application and harvest, resulting on toxic residues in fruits, as well as pest populations resistant to pesticides, decrement of beneficial organisms, mammalian toxicity and environmental pollution. Therefore, it is necessary to generate new alternatives for the control of this mite. The aim of this work was to evaluate the toxic effect of commercial neem-based products on the mites T. urticae and Phytoseiulus macropilis, through a combined analysis using both, lethal and sublethal concentrations

  20. Total mercury in the night shark, Carcharhinus signatus in the western equatorial Atlantic Ocean

    Directory of Open Access Journals (Sweden)

    Alexandre Gomes Ferreira


    Full Text Available Mercury is the only element capable to biomagnificate along the food chain, and carnivorous fish tend to accumulate high concentrations of this element. Total mercury in muscle tissue of Carcharhinus signatus sampled along the western equatorial Atlantic Ocean was measured by atomic emission spectrophotometry with ICP/AES. The average total mercury concentrations were consistently greater than the maximum limit for human consumption established by the Brazilian Health Ministry for carnivorous fishes (1000 µg. kg-1 w.w.. Therefore, an average consumption of 0.1 kg/day of C. signatus would result in an average daily ingestion of 174.2 µg of Hg, more than five times the 30 µg/day intake established by the World Health Organization. In the range of lengths studied, body length could not be used as an indicator of the Hg contamination degree for C. signatus. Also, sex cannot be considered a determining factor in the total mercury accumulation in C. signatus.O mercúrio (Hg é o único metal que comprovadamente biomagnifica através da cadeia alimentar, e sendo assim, espécies de peixes predadores tendem a apresentar altas concentrações deste metal. Porções de tecido muscular de C. signatus coletados na região oeste equatorial do oceano Atlântico foram submetidas a extração ácida e tiveram a concentração de mercúrio determinada com acessório gerador de vapor a frio acoplado a um ICP-AES. A concentração média de Hg apresentou valores acima do limite máximo permissível para consumo humano estabelecido pela legislação brasileira (1000 µ de peso úmido. Conseqüentemente, um consumo médio de 0,1 kg.dia-1 de C. signatus resultaria numa ingestão media de 174,2 µg de Hg, mais de cinco vezes o consumo máximo de 30 µg.dia-1 estabelecido pela Organizacao Munidal da Saúde. Dentro das classes de tamanho analisadas, o comprimento total não pode ser utilizado como indicador do grau de contaminação por mercúrio em C. signatus

  1. Nocturnal and diurnal activity of armored suckermouth catfish (Loricariidae: Pterygoplichthys associated with wintering Florida manatees (Trichechus manatus latirostris

    Directory of Open Access Journals (Sweden)

    Leo G. Nico


    entanto, jovens foram principalmente noturnos e somente a noite eles uniram-se aos adultos sobre os peixes-boi. No sistema estudado na Flórida, jovens de Pterygoplichthys geralmente permanecem escondidos durante o dia, provavelmente respondendo a presença de predadores visuais diurnos, principalmente aves. As diferenças observadas na atividade diária entre diferentes classes de tamanho são semelhantes ao descrito para certos loricariídeos que habitam cursos d'água de águas límpidas em suas áreas nativas de ocorrência.

  2. Interacciones planta-animal en la regeneración de Quercus pyrenaica: ecología y gestión

    Directory of Open Access Journals (Sweden)

    R. Perea


    Full Text Available Los rebollares de Quercus pyrenaica son formaciones casi exclusivas de la península ibérica cuya regeneración sexual se encuentra fuertemente comprometida como consecuencia de su estructura dominada por rebrotes de cepa y raíz (monte bajo. El abandono del aprovechamiento histórico de estos rebrotes (leña, carbón, etc. ha provocado que, actualmente, muchos rebollares se hayan convertido en ecosistemas degradados con exceso de espesura, puntisecado y estancamiento del crecimiento. Este trabajo trata de resumir el estado del conocimiento de las principales interacciones planta-animal en la regeneración sexual de los bosques dominados por el rebollo, con el fin de proporcionar bases científicas para una mejor gestión y conservación de estos ecosistemas. Algunas especies animales (arrendajo, ratón de campo, trepador azul juegan un papel importante en la dispersión efectiva de las bellotas, lo que contribuye a un mejor flujo génico y a la colonización de nuevos lugares. Sin embargo, la creciente densidad de ungulados silvestres (ciervo, jabalí, etc. es uno de los factores de mayor amenaza para estos bosques al reducir drásticamente el número de bellotas disponibles para la germinación y limitar el crecimiento y la supervivencia de las nuevas plántulas. Además, existen interacciones multi-tróficas (p. ej. bellota-predador-dispersor y fenómenos de facilitación (plántula-matorral que revelan la importancia de las relaciones múltiples en la regeneración de los rebollares. Finalmente, se exponen posibles medidas de gestión encaminadas a facilitar la regeneración sexual de estos sistemas de manera que pueda revertirse la actual situación de estancamiento y decaimiento de muchos rebollares.

  3. Araneofauna captured in the forest and adjacent area, in the north of Paraná, Brazil Araneofauna capturada na mata e área aberta adjacente, no norte do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Lizandra Lucy Catelli


    Full Text Available Arachnids make up an exclusive predator group. Eating habit makes the arthropods to move around in search for hunting or building traps with silk threads. In order to know the araneofauna of the Godoy’s Forest State Park, pitfall-like traps were installed inside the forest, edge and adjacent area predominantly grassy. Collections were carried out fortnightly, in the period of a year, separating what was collected during the day and during the night. One hundred and twenty-one individuals were collected, belonging to 18 families where Lycosidae and Theridiidae were the most abundant, although Lyniphiidae family has prevailed in the forest area. Young individuals prevailed. It is concluded that the highest frequency and abundance of young individuals may be directly related to its dispersal and spiders belonging to the Lycosidae, Zoridae and Theridiidae families, being able to be used as bioindicators. Os aracnídeos compõem um grupo exclusivamente predador. O hábito alimentar faz com que o artropoda locomova-se em busca da caça ou construa armadilhas com fios de seda. Buscando conhecer a araneofauna do Parque Estadual Mata dos Godoy, foram instaladas armadilhas tipo ptiffal dentro da mata, borda e área adjacente, com vegetação predominantemente formada por gramíneas. As coletas eram realizadas quinzenalmente, no período de um ano, separando o coletado em diurno e noturno. Foram coletados 121 indivíduos, pertencentes a 18 famílias, das quais as famílias Lycosidae e Theridiidae foram as mais abundantes, embora a família Lyniphiidae tenha predominado na área de mata. Houve maior freqüência de indivíduos jovens. Conclui-se que a maior freqüência e abundância de indivíduos jovens pode estar diretamente relacionada a sua dispersão e, além disso, as aranhas pertencentes as famílias Lycosidae, Zoridae e Theridiidae, podem ser utilizadas como bioindicadores.

  4. Avaliação da comunidade de macroinvertebrados aquáticos como ferramenta para o monitoramento de um reservatório na bacia do rio Pitangui, Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Ivana F Barbola


    Full Text Available Os macroinvertebrados bentônicos e nectônicos representam elementos importantes na estrutura e funcionamento dos ecossistemas aquáticos e sua distribuição é influenciada pela natureza química do substrato, composição da vegetação e profundidade da lâmina d'água. O conhecimento desta fauna contribui para a avaliação da qualidade da água e a elaboração de ações visando à conservação da biodiversidade. No presente estudo foram avaliadas diferentes medidas bióticas da comunidade de invertebrados da represa de Alagados, importante manancial da cidade de Ponta Grossa, no Paraná. Em cinco diferentes pontos de amostragem, foram coletados 18.473 exemplares de macroinvertebrados aquáticos ou semi-aquáticos, pertencentes a 46 táxons dos filos Annelida (Hirudinea e Oligochaeta, Mollusca (Gastropoda, Platyhelminthes (Turbellaria, Nematoda e Arthropoda (Arachnida, Crustacea e Insecta. Esta comunidade foi constituída predominantemente por organismos predadores (45,7% dos táxons amostrados, seguidos de coletores e/ou filtradores (23,9%; raspadores (15,2%, fragmentadores (13% e detritívoros (2,2%. De modo geral, os índices de diversidade (H' e equitabilidade (J foram significativamente baixos para os cinco locais investigados, com H' variando de 0,3301 a 1,0396. Quanto à tolerância dos organismos à poluição orgânica, alguns táxons mais sensíveis foram muito raros (Plecoptera ou em baixa frequência (Trichoptera e Ephemeroptera. Entre os grupos mais resistentes a ambientes poluídos estão os Chironomidae e os Hirudinea, ambos bastante comuns nas amostras de Alagados. Este estudo reforça a importância da análise de bioindicadores na avaliação da qualidade de água para consumo humano e também para a conservação de ecossistemas, considerando que um programa de monitoramento ambiental deve integrar medidas físicas, químicas e biológicas.

  5. Effect of Light Intensity on Initial Survival of Fat Snook (Centropomus parallelus, Pisces: Centropomidae Larvae

    Directory of Open Access Journals (Sweden)

    Vinicius Ronzani Cerqueira


    Full Text Available Different light intensities were tested during the larval rearing of fat snook (Centropomus parallelus to evaluate its influence on survival and functional swim bladder rate. Newly-hatched larvae were obtained by stripping of hormonally induced broodstock, and were stocked in 32-liter tanks at densities from 30 to 50 L-1. Four experiments were carried out testing six light intensities: 50, 100, 200, 500, 1500, and 2500 lx, and total darkness as a control. Mean survival ranged from 0.06 to 16.0% and were significantly influenced by light intensity. Complete darkness resulted in 100% mortality after one week, larvae appeared to have starved since they had empty stomachs. The species has the characteristics of a visual-feeder. Survival was the highest at 200 lx, while at 500 lx was higher than at 50, 100, and 2500 lx. Frequency of functional swim bladder ranged from 36.8 to 100%, but it was not significantly correlated with light intensity. Based on this study, a medium light intensity, 200 to 1500 lx, is recommended for rearing fat snook larvae. Extreme values must be avoided, mainly in the first two weeks after hatching.Diferentes intensidades de luz foram testadas na larvicultura do robalo peva, Centropomus parallelus, avaliando sua influência na sobrevivência e insuflação da bexiga gasosa. Larvas obtidas de desova induzida foram mantidas até 14 dias, em tanques de 32 L, com densidade inicial de 30-50 L-1. Foram utilizados o escuro total e 6 intensidades de luz: 50, 100, 200, 500, 1.500 e 2.500 lx. A sobrevivência média variou entre 0,06 e 16,0%, dependendo significativamente (P<0,05 da intensidade de luz. No escuro, as larvas morreram após uma semana, sem conteúdo no tubo digestivo, comprovando serem predadores visuais. Em 200 lx, a sobrevivência foi maior que em 500, 1.500 e 2.500 lx. Em 500 lx também foi superior a 50, 100 e 2.500 lx. A insuflação da bexiga gasosa ficou entre 36,8 e 100%, independendo da intensidade de luz

  6. Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants Flutuação populacional de ácaros na cultura do pessegueiro (Prunus persica (L. Batsch e em plantas associadas

    Directory of Open Access Journals (Sweden)

    Carla Rosana Eichelberger


    January and high predator diversity was observed on associated plants and on peach plants, indicating the existence of species mobility in peach orchard.Apesar da grande importância da cultura do pêssego [Prunus persica (L. Batsch] no Rio Grande do Sul, pouco se conhece sobre a diversidade e a flutuação populacional de ácaros considerados importantes para esta cultura. O objetivo deste trabalho foi conhecer a flutuação populacional das espécies acarinas associadas às cultivares Premier e Eldorado nos municípios de Roca Sales e Venâncio Aires, Rio Grande do Sul. O estudo foi realizado no período de julho de 2008 a junho de 2009, quando foram amostradas 15 plantas escolhidas ao acaso numa área em cada município. As plantas foram divididas em quadrantes, e de cada quadrante foi escolhido um galho de onde foram retiradas três folhas das regiões apical, mediana e basal, totalizando 180 folhas/área. Foram coletadas, mensalmente, parte de cinco plantas não cultivadas mais abundantes. O período de uma hora sob microscópio estereoscópio foi suficiente para se obter uma amostra representativa. Um total de 1.124 ácaros foi coletado pertencentes a 14 famílias e 28 espécies. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 e Mononychellus planki (McGregor, 1950 foram os ácaros fitófagos mais abundantes, enquanto Typhlodromalus aripo Deleon, 1967 e Phytoseiulus macropilis (Banks, 1904 os ácaros predadores mais comuns. O esforço amostral foi suficiente. Nos dois pomares avaliados, os índices ecológicos foram baixos, mas um pouco superiores em Premier (H' 0,56; EqJ: 0,43 quando comparados a Eldorado (H' 0,53; EqJ 0,40. Em Premier não foram observadas espécies constantes, apenas acessórias com Brevipalpus phoenicis (Geijskes, 1939, T. ludeni e T. aripo. Maior abundância foi observada em dezembro e janeiro, e maior quantidade em abril. Em Eldorado, T. ludeni e P. ulmi foram constantes. Maior abundância foi observada em novembro e dezembro, e

  7. Seletividade de inseticidas utilizados em cultura cafeeira para larvas de Cryptolaemus montrouzieri Mulsant Selectivity of insecticides used in the coffee crop to larvae of Cryptolaemus montrouzieri Mulsant

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Dias Rocha


    Full Text Available Assim como a maioria dos cultivos, em cafeeiro, a associação de inimigos naturais com produtos fitossanitários seletivos é uma importante estratégia no manejo integrado de pragas (MIP. Dessa forma, este estudo objetivou avaliar a seletividade de agrotóxicos utilizados na cultura cafeeira sobre larvas de Cryptolaemus montrouzieri Mulsant, 1853 (Coleoptera: Coccinellidae, em laboratório. Os bioensaios foram realizados em condições controladas (25±2°C, UR de 70±10% e fotofase de 12 horas. Cada bioensaio consistiu em seis tratamentos e dez repetições, sendo cada parcela composta por duas larvas. Para as comparações das médias dos tratamentos, empregou-se um esquema fatorial inteiramente ao acaso de produtos x número de instares para os diferentes instares subsequentes à aplicação. Os inseticidas utilizados e suas respectivas dosagens de aplicação, em g de i.a. L-1 foram: tiametoxam (0,5, imidacloprido (0,7, óleo mineral (13,3, endossulfam (2,63 e dimetoato (0,48. A testemunha foi composta apenas por água destilada. A aplicação dos produtos foi realizada por meio de torre de Potter. Avaliaram-se a sobrevivência dos espécimes após serem contaminados com os produtos e os efeitos dos compostos sobre os parâmetros reprodutivos do predador. Tiametoxam (0,5, imidacloprido (0,7 e endossulfam (2,63 foram os mais prejudiciais, tendo sido observados, para os dois primeiros, 100% de mortalidade de larvas de primeiro e de segundo instares um dia após a aplicação e significativa redução na sobrevivência das larvas de terceiro e quarto instares. Dimetoato (0,48 foi nocivo para larvas de primeiro instar e levemente nocivo para larvas de quarto instar. Em função da seletividade apresentada pelo óleo mineral (13,3, este pode ser recomendado em compatibilização com o predador C. montrouzieri em programas de MIP na cultura cafeeira, sem prejuízo ao desempenho do inimigo natural.As well as most of the crops, in coffee crop, the

  8. Controle de Brevipalpus phoenicis (Geijskes, 1939 e Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae em cafeeiro e o impacto sobre ácaros benéficos: II - Spirodiclofen e Azocyclotin Control of Brevipalpus phoenicis (Geijskes, 1939 and Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae in coffee plants and the impact on beneficial mites: II - Spirodiclofen and Azocyclotin

    Directory of Open Access Journals (Sweden)

    Paulo Rebelles Reis


    Full Text Available O ácaro Brevipalpus phoenicis (Geijskes é importante em cafeeiro (Coffea spp. por ser o vetor do vírus da mancha-anular, doença responsável por queda de folhas e má qualidade da bebida do café, e o ácaro-vermelho Oligonychus ilicis (McGregor por reduzir a área foliar de fotossíntese. Ácaros da família Phytoseiidae, de várias espécies, são eficientes predadores associados aos ácaros-praga. Conduziu-se este trabalho com o objetivo de estudar o controle dos ácaros-praga com spirodiclofen e azocyclotin, e o impacto sobre fitoseídeos. Em laboratório foram estudados os efeitos ovicida, tópico, residual, tópico mais residual e a seletividade fisiológica aos fitoseídeos; em casa-de-vegetação foi avaliada a persistência no controle às duas espécies de ácaros-praga; e em campo foi avaliada a eficiência apenas no controle de B. phoenicis. Os bioensaios foram realizados em arenas de folhas destacadas. O efeito ovicida foi avaliado em ovos no início e final de incubação. Os efeitos residual, tópico e tópico mais residual foram avaliados pela mortalidade de larvas, ninfas e adultos aos oito dias, e a persistência até 30 dias após a aplicação. A seletividade aos fitoseídeos foi avaliada, pelo efeito na mortalidade e reprodução de fêmeas adultas, em teste residual em superfície de vidro. Spirodiclofen e azocyclotin (SC mostraram eficiente ação ovicida, principalmente para ovos de B. phoenicis no início de incubação. Para ovos de O. ilicis, somente o spirodiclofen apresentou efeito ovicida. Em geral, os efeitos tópico e residual associados melhoraram a eficiência dos produtos no controle das fases pós-embrionárias de ambas as espécies. O spirodiclofen apresentou seletividade aos ácaros predadores, já o azocyclotin foi nocivo. Em campo, ambos os acaricidas mostram-se altamente eficientes na redução de todas as fases pós-embrionárias do ácaro B. phoenicis, principalmente nas folhas.The mite Brevipalpus

  9. Dispersão e predação de sementes de araticum no Cerrado de Mato Grosso, Brasil Dispersal and predation of araticum seeds in the Cerrado of Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Vanessa Golin


    Full Text Available Este estudo objetivou caracterizar plantas e frutos de araticum (Annona crassiflora, avaliar a frequência de consumo, predação e dispersão de suas sementes por animais e seus efeitos na germinação, em área de Cerrado, entre fevereiro de 2007 a junho de 2008. Baseado em armadilhas de pegadas, registrou-se a frequência de visitação (FV e o consumo de frutos por animais, além da ação de insetos em frutos caídos no solo, sob as plantas. Estrumes de antas, Tapirus terrestris, foram amostrados para verificar a frequência de ocorrência (FO e os danos causados por elas e por insetos. Para analisar a dispersão por antas, foram inseridas miçangas coloridas em frutos maduros caídos sob plantas-mãe. Posteriormente, foi medida a distância entre o local das fezes com miçanga até a planta-mãe da cor específica da miçanga. Realizou-se teste de germinação com sementes de amostras fecais e de frutos intactos. Dentre os animais que se alimentaram dos frutos, antas contribuíram com maior frequência de visitação e consumo de frutos de araticum, o qual representou 54% de frequência de ocorrência nas amostras fecais e as sementes não foram significativamente danificadas. Besouros (Scarabaeidae se alimentaram da polpa de frutos e enterraram sementes de araticum próximo da planta-mãe. Insetos curculionídeos e euritomídeos predaram as sementes de araticum nos frutos. Os danos causados nas sementes por esses insetos foram significativamente maiores que aqueles provocados pelas antas. Foram encontradas duas fezes com miçangas distantes 1,7km e 1,8km das plantas-mãe, respectivamente. A germinação das sementes foi baixa neste período de estudo, no entanto, as antas podem proteger as sementes de insetos predadores, defecando-as intactas para longas distâncias. Assim, T. terrestris é um possível dispersor, enquanto que curculionídeos e euritomídeos são possíveis predadores de sementes de araticum. Essas rela

  10. Tracking cats: problems with placing feline carnivores on δO, δD isoscapes.

    Directory of Open Access Journals (Sweden)

    Stephanie J Pietsch

    Full Text Available BACKGROUND: Several felids are endangered and threatened by the illegal wildlife trade. Establishing geographic origin of tissues of endangered species is thus crucial for wildlife crime investigations and effective conservation strategies. As shown in other species, stable isotope analysis of hydrogen and oxygen in hair (δD(h, δ(18O(h can be used as a tool for provenance determination. However, reliably predicting the spatial distribution of δD(h and δ(18O(h requires confirmation from animal tissues of known origin and a detailed understanding of the isotopic routing of dietary nutrients into felid hair. METHODOLOGY/FINDINGS: We used coupled δD(h and δ(18O(h measurements from the North American bobcat (Lynx rufus and puma (Puma concolor with precipitation-based assignment isoscapes to test the feasibility of isotopic geo-location of felidae. Hairs of felid and rabbit museum specimens from 75 sites across the United States and Canada were analyzed. Bobcat and puma lacked a significant correlation between H/O isotopes in hair and local waters, and also exhibited an isotopic decoupling of δ(18O(h and δD(h. Conversely, strong δD and δ(18O coupling was found for key prey, eastern cottontail rabbit (Sylvilagus floridanus; hair and white-tailed deer (Odocoileus virginianus; collagen, bone phosphate. CONCLUSIONS/SIGNIFICANCE: Puma and bobcat hairs do not adhere to expected pattern of H and O isotopic variation predicted by precipitation isoscapes for North America. Thus, using bulk hair, felids cannot be placed on δ(18O and δD isoscapes for use in forensic investigations. The effective application of isotopes to trace the provenance of feline carnivores is likely compromised by major controls of their diet, physiology and metabolism on hair δ(18O and δD related to body water budgets. Controlled feeding experiments, combined with single amino acid isotope analysis of diets and hair, are needed to reveal mechanisms and physiological traits

  11. Associations of passerine birds, rabbits, and ticks with Borrelia miyamotoi and Borrelia andersonii in Michigan, U.S.A.

    Directory of Open Access Journals (Sweden)

    Hamer Sarah A


    Full Text Available Abstract Background Wild birds contribute to maintenance and dissemination of vectors and microbes, including those that impact human, domestic animal, and wildlife health. Here we elucidate roles of wild passerine birds, eastern cottontail rabbits (Sylvilagus floridanus, and Ixodes dentatus ticks in enzootic cycles of two spirochetes, Borrelia miyamotoi and B. andersonii in a region of Michigan where the zoonotic pathogen B. burgdorferi co-circulates. Methods Over a four-year period, wild birds (n = 19,631 and rabbits (n = 20 were inspected for tick presence and ear tissue was obtained from rabbits. Samples were tested for Borrelia spirochetes using nested PCR of the 16S-23S rRNA intergenic spacer region (IGS and bidirectional DNA sequencing. Natural xenodiagnosis was used to implicate wildlife reservoirs. Results Ixodes dentatus, a tick that specializes on birds and rabbits and rarely bites humans, was the most common tick found, comprising 86.5% of the 12,432 ticks collected in the study. The relapsing fever group spirochete B. miyamotoi was documented for the first time in ticks removed from wild birds (0.7% minimum infection prevalence; MIP, in I. dentatus, and included two IGS strains. The majority of B. miyamotoi-positive ticks were removed from Northern Cardinals (Cardinalis cardinalis. Borrelia andersonii infected ticks removed from birds (1.6% MIP, ticks removed from rabbits (5.3% MIP, and rabbit ear biopsies (5% comprised twelve novel IGS strains. Six species of wild birds were implicated as reservoirs for B. andersonii. Frequency of I. dentatus larval and nymphal co-feeding on birds was ten times greater than expected by chance. The relatively well-studied ecology of I. scapularis and the Lyme disease pathogen provides a context for understanding how the phenology of bird ticks may impact B. miyamotoi and B. andersonii prevalence and host associations. Conclusions Given the current invasion of I. scapularis, a human biting species

  12. Tracking Cats: Problems with Placing Feline Carnivores on δ18O, δD Isoscapes (United States)

    Pietsch, Stephanie J.; Hobson, Keith A.; Wassenaar, Leonard I.; Tütken, Thomas


    Background Several felids are endangered and threatened by the illegal wildlife trade. Establishing geographic origin of tissues of endangered species is thus crucial for wildlife crime investigations and effective conservation strategies. As shown in other species, stable isotope analysis of hydrogen and oxygen in hair (δDh, δ18Oh) can be used as a tool for provenance determination. However, reliably predicting the spatial distribution of δDh and δ18Oh requires confirmation from animal tissues of known origin and a detailed understanding of the isotopic routing of dietary nutrients into felid hair. Methodology/Findings We used coupled δDh and δ18Oh measurements from the North American bobcat (Lynx rufus) and puma (Puma concolor) with precipitation-based assignment isoscapes to test the feasibility of isotopic geo-location of felidae. Hairs of felid and rabbit museum specimens from 75 sites across the United States and Canada were analyzed. Bobcat and puma lacked a significant correlation between H/O isotopes in hair and local waters, and also exhibited an isotopic decoupling of δ18Oh and δDh. Conversely, strong δD and δ18O coupling was found for key prey, eastern cottontail rabbit (Sylvilagus floridanus; hair) and white-tailed deer (Odocoileus virginianus; collagen, bone phosphate). Conclusions/Significance Puma and bobcat hairs do not adhere to expected pattern of H and O isotopic variation predicted by precipitation isoscapes for North America. Thus, using bulk hair, felids cannot be placed on δ18O and δD isoscapes for use in forensic investigations. The effective application of isotopes to trace the provenance of feline carnivores is likely compromised by major controls of their diet, physiology and metabolism on hair δ18O and δD related to body water budgets. Controlled feeding experiments, combined with single amino acid isotope analysis of diets and hair, are needed to reveal mechanisms and physiological traits explaining why felid hair does

  13. Predation, Competition, and Abiotic Disturbance: Population Dynamics of Small Mammals

    Energy Technology Data Exchange (ETDEWEB)

    Yunger, John A.; /Northern Illinois U. /Northern Illinois U.


    Predation and food availability have been implicated in annual non-cyclic fluctuations of vertebrate prey at mid-latitudes. The timing and magnitude of these factors are unclear due to a lack of large-scale field experiments, little attention to interactions, and a failure to closely link vertebrate predators with their prey. From October 1992 to January 1996, small mammal populations were censused on eight 0.6 ha plots at monthly intervals in a 32-ha prairie restoration at Fermi National Accelerator Laboratory, Illinois. Terrestrial vertebrate predators were excluded after July 1993 from four of the eight plots and canid diets monitored. Both terrestrial and avian vertebrate predators were excluded in March 1994. During 1993 small mammal densities (i.e., Microtus Pennsylvanicus, Peromyscus leucopus, and P. maniculatus) were relatively high. Following peak densities in late summer, Microtus numbers wer 2-3x greater on exclusion plots relative to controls due to preferential selection of Microtus by canids, as reflected in dits. Following an ice-storm and crash in small mammal numbers (particularly Microtus), vertebrate predator exclusion had no detectable effect on P. leucopus numbers, probably due to an abundance of alternative prey (i.e., Sylvilagus floridanus). Meadow vole numbers began to increase in Fall 1995, and a numerical effect of predator exclusion, similar to that in 1993, was observed. Predator exclusion had no detectable effect on the movements and spatial patterns of Microtus during 1993. There was a significant decrease in home range and a significant increase in home range overlap for P. leucopus on the predator exclusion plots. The change in spatial behavior may be due to interspecific competition with Microtus resulting from increased densities on exclusion plots. Thus, predators had an indirect effect on P. leucopus spatial patterns mediated through M. Pennsylvanicus. The role of food limitation was studied using natural and manipulative

  14. Mechanisms of social regulation change across colony development in an ant

    Directory of Open Access Journals (Sweden)

    Liebig Jürgen


    Full Text Available Abstract Background Mutual policing is an important mechanism for reducing conflict in cooperative groups. In societies of ants, bees, and wasps, mutual policing of worker reproduction can evolve when workers are more closely related to the queen's sons than to the sons of workers or when the costs of worker reproduction lower the inclusive fitness of workers. During colony growth, relatedness within the colony remains the same, but the costs of worker reproduction may change. The costs of worker reproduction are predicted to be greatest in incipient colonies. If the costs associated with worker reproduction outweigh the individual direct benefits to workers, policing mechanisms as found in larger colonies may be absent in incipient colonies. Results We investigated policing behaviour across colony growth in the ant Camponotus floridanus. In large colonies of this species, worker reproduction is policed by the destruction of worker-laid eggs. We found workers from incipient colonies do not exhibit policing behaviour, and instead tolerate all conspecific eggs. The change in policing behaviour is consistent with changes in egg surface hydrocarbons, which provide the informational basis for policing; eggs laid by queens from incipient colonies lack the characteristic hydrocarbons on the surface of eggs laid by queens from large colonies, making them chemically indistinguishable from worker-laid eggs. We also tested the response to fertility information in the context of queen tolerance. Workers from incipient colonies attacked foreign queens from large colonies; whereas workers from large colonies tolerated such queens. Workers from both incipient and large colonies attacked foreign queens from incipient colonies. Conclusions Our results provide novel insights into the regulation of worker reproduction in social insects at both the proximate and ultimate levels. At the proximate level, our results show that mechanisms of social regulation, such as

  15. Experimental introduction of Liolaemus lutzae (Squamata: Iguanidae in Praia das Neves, State of Espírito Santo, Brazil: a descriptive study 18 years later Introdução experimental de Liolaemus lutzae (Squamata: Iguanidae em Praia das Neves, Espírito Santo, Brasil: um estudo descritivo 18 anos depois

    Directory of Open Access Journals (Sweden)

    Ana Hermínia B. Soares


    ísticas com a da população original em Barra de Maricá, Estado do Rio de Janeiro. Também comparamos as medidas morfológicas das duas populações. Ambas fazem uso similar do microhabitat, mas há diferenças nas suas dietas. Recomendamos que a população introduzida e seus competidores potenciais, predadores e parasitos, e as características do habitat continuem a ser monitorados, para garantir que essa espécie não se torne uma ameaça à comunidade de Praia das Neves.

  16. Comportamento de predação e conversão alimentar de Podisus nigrispinus sobre a traça-do-tomateiro Predatory behavior and food conversion of Podisus nigrispinus preying on tomato leafminer

    Directory of Open Access Journals (Sweden)

    Lúcia Madalena Vivan


    Full Text Available O objetivo deste trabalho foi avaliar o efeito da predação de Tuta absoluta (Meyrick por ninfas e adultos de Podisus nigrispinus (Dallas na reprodução desse predador, em casa telada (30±5ºC, 61±23% de UR e fotoperíodo natural e em laboratório (28±1°C, 53±5% de UR e fotoperíodo de 14L:10E. Ninfas de P. nigrispinus, a partir do segundo ínstar e os adultos originados dessas ninfas, foram confinados em folhas de tomate industrial var. IPA5, com dez lagartas de terceiro ou quarto ínstares de T. absoluta. A taxa de predação do segundo ao quinto ínstar de P. nigrispinus foi de 6,2, 6,6, 8,6 e 15,5 lagartas em casa telada e de 9,1, 11,1, 8,7 e 12,9 lagartas em laboratório, respectivamente. P. nigrispinus predou, durante sua fase ninfal, um número semelhante de lagartas de T. absoluta em casa telada (38,2±1,78 e laboratório (43,1±2,19, alimentandose, em média, de 2,3 e 2,5 lagartas por dia, respectivamente, nesses dois ambientes. Fêmeas de P. nigrispinus predaram, em média, 50,8±6,1 e 50,3±10,6 lagartas no laboratório e casa telada. A conversão do alimento por fêmea de P. nigrispinus foi semelhante nos dois ambientes, tendo produzido 0,31 ovos/lagarta de T. absoluta consumida em casa telada e 0,41 ovos/lagarta em laboratório.This work aimed to determine the predatory behavior of nymphs and adults of Podisus nigrispinus (Dallas and its reproduction preying upon Tuta absoluta (Meyrick under open sided greenhouse (30±5ºC, 61±23% RH and natural photophase and laboratory (28±1°C, 53±5% RH and 14 hours of photophase conditions. Second to later instars and adults of P. nigrispinus were caged on processing tomato var. IPA5 leaves infested with ten T. absoluta third or fourth instars. P. nigrispinus from second to fifth instar preyed on 9.1, 11.1, 8.7 and 12.9 caterpillars in the laboratory and 6.2, 6.6, 8.6 and 15.5 caterpillars in the open sided greenhouse. Thus, P. nigrispinus fed on similar number of T. absoluta

  17. Diversidade e dinâmica populacional de ácaros em pomar cítrico Diversity and population dynamics of mites in citrus orchard

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva


    Full Text Available As plantas de citros hospedam diversas espécies de ácaros que causam sérios prejuízos à produção e qualidade de frutos no Brasil. Esta pesquisa teve por objetivo estudar a diversidade de ácaros e a dinâmica populacional das principais espécies de ácaros em pomar de citros, Citrus sinensis (L. Osbeck, localizado no município de Descalvado, Estado de São Paulo. Foram realizadas 14 avaliações em um período de 12 meses, de fevereiro de 2007 a fevereiro de 2008. Em cada avaliação, foram coletadas dez folhas e cinco frutos na parte interna de cada uma das 40 plantas demarcadas no pomar. Foram encontradas 34 espécies de ácaros, distribuídas em 17 famílias. As espécies mais abundantes foram: Phyllocoptruta oleivora (Ashmed (Eriophyidae, Panonychus citri (McGregor (Tetranychidae, Brevipalpus phoenicis (Geijskes (Tenuipalpidae e Fungitarsonemus sp. (Tarsonemidae. Entre os ácaros predadores, a família Phytoseiidae foi a de maior riqueza (oito espécies e abundância (1.072 indivíduos. A espécie predominante foi Euseius concordis (Chant, correspondendo a 98,3% dos ácaros desta família. Foram observadas correlações significativas entre densidades populacionais de E. concordis e dos ácaros fitófagos P. citri, B. phoenicis e P. oleivora. Também foram observadas correlações significativas entre densidades populacionais desses ácaros e fatores meteorológicos como temperatura e precipitação pluvial. Os resultados indicam que E. concordis atua como inimigo natural de P. citri, B. phoenicis e P. oleivora no pomar cítrico estudado.The citrus plants are hosts of several species of mites, which cause severe damage to production and quality of fruits in Brazil. The objective of this research was to study the diversity of mites and population dynamics of the main mite species in a citrus orchard, Citrus sinensis (L. Osbeck, in Descalvado County, State of São Paulo, Brazil. Fourteen evaluations were conducted over a period of 12

  18. História natural dos amborés e peixes-macaco (Actinopterygii, Blennioidei, Gobioidei do Parque Nacional Marinho do Arquipélago de Fernando de Noronha, sob um enfoque comportamental Natural history focus blennies and gobis behaviour (Actinopterygii, Blennioidei, Gobioidei from Fernando de Noronha Archipelago

    Directory of Open Access Journals (Sweden)

    Liana de F. Mendes


    Full Text Available Os amborês e peixes-macaco, como são popularmente conhecidos gobiídeos e bleniídeos, são elementos dominantes da fauna de pequenos peixes bentônicos e litorâneos que habitam recifes tropicais, compondo grande parte da alta diversidade das espécies de pequeno porte encontrada no Atlântico ocidental. O estudo da distribuição e história natural dos gobióides e blenióides de Fernando de Noronha foi desenvolvido através de observações de campo. Além da descrição dos hábitats preferenciais foram abordados aspectos sociais tais como, habitat preferencial, interações intra- e interespecíficas, comportamento domiciliar e territorial, e comportamento reprodutivo. A maioria das espécies em foco apresenta distribuição principalmente litorânea, são gregárias, com áreas domiciliares relativamente pequenas em torno de 2 x 2 m², pouco agressivas, tendo sido ocasionalmente registradas curtas perseguições intra- e interespecíficas. A baixa agressividade registrada, em comparação com outros peixes é provavelmente associada à adaptação à ocupação de pequenas áreas, como é o caso das poças de marés, pois um grande número de interações agressivas representaria um gasto de energia desnecessário. No geral, as espécies possuem coloração críptica, associada à evitação de predadores. Apenas nestas épocas de reprodução foi observada a intensificação da agressividade, com comportamento territorial - defesa de território incluindo mordidas e perseguições.The gobis and blenis (Gobiidae and Bleniidae are the most important group of small benthic littoral fishes in tropical reefs, representing most of the high number of small fish species found in Western Atlantic. The natural history of gobiid and bleniid fish from Fernando de Noronha was assessed by means observation sessions using both snorkelling and scuba diving. Most of these observations were aimed at social behaviour, such as intra and interespecific

  19. Whitefly population dynamics in okra plantations Dinâmica populacional de mosca-branca em quiabo

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available The control of whitefly Bemisia tabaci (Gennadius biotype B (Hemiptera: Aleyrodidae on okra (Abelmoschus esculentus L. consists primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to evaluate the spatial and temporal population dynamics of the whitefly B. tabaci biotype B on two successive A. esculentus var. "Santa Cruz" plantations. Leaf chemical composition, leaf nitrogen and potassium contents, trichome density, canopy height, plant age, predators, parasitoids, total rainfall and median temperature were evaluated and their relationships with whitefly on okra were determined. Monthly number estimates of whitefly adults, nymphs (visual inspection and eggs (magnifying lens occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence and natural enemies, mainly Encarsia sp., Chrysoperla spp. and Coccinellidae, were some of the factors that most contributed to whitefly reduction. The second okra plantation, 50 m apart from the first, was strongly attacked by whitefly, probably because of the insect migration from the first to the second plantation. No significant effects of the plant canopy on whitefly eggs and adults distribution were found. A higher number of whitefly nymphs was found on the medium part than on the bottom part.O controle da mosca-branca Bemisia tabaci (Gennadius biótipo B (Hemiptera: Aleyrodidae em quiabeiro (Abelmoschus esculentus L. consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. O objetivo deste trabalho foi compreender a dinâmica populacional, espacial e temporal da mosca-branca em dois cultivos sucessivos de quiabeiro "Santa Cruz". Avaliaram-se a composição química foliar, os níveis foliares de nitrogênio e de potássio, a densidade de tricomas, a altura de dossel, a idade de planta, predadores, parasitóides, pluviosidade total

  20. Emergência de Haematobia irritans em fezes bovinas no município de Seropédica, Rio de Janeiro Emergence of Haematobia irritans in cattle dung pats in Seropédica county, Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Douglas Marques de Macedo


    Full Text Available O presente trabalho teve como objetivo estudar a emergência de Haematobia irritans em fezes de bovinos mantidas a campo e em laboratório, além de observar a presença de outros dípteros associados às massas fecais. Foram utilizados dois grupos de fezes bovinas, um à campo e outro em laboratório, sendo cada grupo formado por cinco bolos fecais frescos de tamanho mediano (cerca de 30 cm de diâmetro, aparência opaca, cor esverdeada, presença de fina crosta externa e consistência firme. As fezes foram cobertas com gaiolas de emergência de formato piramidal, apresentando na parte superior um orifício onde foi acoplado um frasco removível; a substituição das fezes foi realizada quinzenalmente. Foram coletados um total de 355 espécimens de H. irritans, sendo 151 provenientes das gaiolas mantidas no campo e 204 em laboratório. Estas diferenças deveram-se provavelmente à menores oscilações de temperatura verificadas no laboratório do que àquelas ocorridas no campo, além da ação de artrópodes predadores, competidores e parasitóides que, provavelmente, interferiram na emergência de H. irritans nas fezes bovinas mantidas no campo. Foi observado maior número de fêmeas em comparação com machos em ambas as condições investigadas. Além de H. irritans, obteve-se outros dípteros associados às fezes bovinas, pertencentes as seguintes famílias: Aulacigastridae, Muscidae, Psychodidae, Sarcophagidae, Sepsidae, Tachinidae e Ulidiidae. Sepsidae foi a mais abundante, com 5.224 exemplares do total de 8.928 dípteros obtidos, seguida por Sarcophagidae com 2.235 espécimens coletados, Muscidae com 1.357, Aulacigastridae com 54, Psychodidae com 46, Ulidiidae com 6 e Tachinidae com 5 exemplares.This study was carried out in order to investigate the emergence of adult flies of Haematobia irritans in cattle dung maintained in the field and in the laboratory, as well as other flies associated with dung pats. Two groups of cattle dung were

  1. Domestic dogs in Atlantic forest preserves of south-eastern Brazil: a camera-trapping study on patterns of entrance and site occupancy rates Cães-domésticos em remanescentes de Mata Atlântica no sudeste do Brasil: padrões de entrada e de ocupação obtidos a partir de armadilhas fotográficas

    Directory of Open Access Journals (Sweden)

    AC. Srbek-Araujo


    .142 câmeras-dia, foram obtidos 25 registros de 16 indivíduos no interior da EBSL. Com relação ao número de registros obtidos, o cão-doméstico foi a quarta espécie mais registrada, considerando a mastofauna de maneira geral, e a primeira entre os Carnivora, estando à frente da jaguatirica e da onça-parda, os dois principais predadores terrestres presentes na EBSL. Os cães-domésticos entraram na reserva durante todo o ano, apresentando registros em quase metade dos meses de amostragem (48%, predominantemente ao longo do dia (89%. Os espécimes foram detectados em várias trilhas no interior da EBSL, principalmente em áreas próximas à borda reserva ( 0,05 em todos os casos, sugerindo uso errático e não sazonal da reserva. Os dados obtidos indicam que os cães-domésticos podem se tornar visitantes abundantes e freqüentes em pequenos remanescentes de Mata Atlântica, mesmo quando estes estão localizados em regiões com baixa densidade populacional humana. O potencial impacto do cão-doméstico sobre a fauna silvestre é discutido.

  2. Ecology and life history of an Amazon floodplain cichlid: the discus fish Symphysodon (Perciformes: Cichlidae

    Directory of Open Access Journals (Sweden)

    William G. R. Crampton


    Full Text Available The discus fishes of the genus Symphysodon are popular ornamental cichlids that occur in floodplain lakes and flooded forests of the lowland Amazon Basin. These habitats are characterized by extreme seasonal fluctuations in the availability of food, shelter and dissolved oxygen, and also the densities of predators and parasites. Most aspects of discus biology are influenced by these fluctuating conditions. This paper reports an autoecological study of the western Amazonian discus S. haraldi (until recently classified as S. aequifasciatus. This species feeds predominantly on algal periphyton, fine organic detritus, plant matter, and small aquatic invertebrates. At high water it forages alone or in small groups in flooded forests. At low water it forms large aggregations in fallen tree crowns along lake margins. Breeding occurs at the beginning of the flood season, ensuring that the progeny are well grown before the next low water period. Symphysodon haraldi is an iteroparous partial spawner, reaches reproductive maturity within a year, and undertakes parental care of its eggs and larvae. The timing of spawning events, and/or the rate of brood survival, may be influenced by fluctuations in the flood level, resulting in a non-unimodal distribution of size classes for the subsequent 1+ cohort.Os acarás-disco do gênero Symphysodon são peixes ornamentais comumente encontrados em lagos e florestas alagadas das planícies inundadas da Amazônia. Estes habitats são caracterizados por uma variação sazonal extrema na disponibilidade de alimento, abrigo e oxigênio dissolvido, e também pela densidade de predadores e parasitas. A maioria dos aspectos da biologia do acará-disco são influenciados por esta variabilidade de condições sazonais. Este artigo apresenta um estudo autoecológico de S. haraldi (até recentemente classificado como S. aequifasciatus da Amazônia Ocidental. Os acarás-disco alimentam-se predominantemente de perifiton, detritos

  3. Effects of liming and development of Curimbatá (Prochilodus lineatus larvae on the abundance of zooplankton in fish ponds Efeitos da calagem e desenvolvimento do Curimbatá (Prochilodus lineatus na abundância do zooplâncton em viveiros de piscicultura

    Directory of Open Access Journals (Sweden)

    Thécia Alfenas Silva Valente Paes


    correção da alcalinidade e predação tanto por peixes quanto por copépodos predadores que ocorreram a partir da quarta semana até o fim. CONCLUSÃO: O experimento corroborou a hipótese que a correção da alcalinidade da água em viveiros favorece o desenvolvimento do zooplâncton, mas também destacou-se a interação de fatores bióticos e abióticos atuando simultaneamente.

  4. Levantamento da fauna de Coleoptera que habita a carcaça de Sus scrofa L., em Curitiba, Paraná A study of the Coleoptera (Insecta fauna that inhabits Sus scrofa L. carcass in Curitiba, Paraná

    Directory of Open Access Journals (Sweden)

    Kleber Makoto Mise


    Full Text Available Este trabalho visou levantar a fauna de Coleoptera associada à carcaça de Sus scrofa L.,1758, espécie utilizada como modelo em Entomologia Forense. O acréscimo ou a substituição seqüencial das espécies de insetos pode ser utilizado para estimar o intervalo post mortem (IPM. O experimento foi realizado no Centro Politécnico (UFPR, de setembro de 2005 a setembro de 2006. A cada estação foi sacrificado um suíno de 15 kg no local, colocado em gaiola. A captura dos insetos foi realizada diariamente em bandeja posicionada abaixo da carcaça e em armadilha tipo Shannon modificada, e a cada 14 dias em cinco armadilhas do tipo pit-fall. Foram coletados 4.360 Coleoptera, pertencentes a 112 espécies de 26 famílias, 12 consideradas de importância forense. A coleta ativa realizada na bandeja foi responsável pela maior captura (2.023 espécimes, seguida pela armadilha Shannon modificada (2.016 espécimes e por último pelas do tipo pit-fall (324 espécimes. Staphylinidae foi mais coletada na bandeja e Shannon modificada, e Silphidae na armadilha pit-fall. Os principais hábitos encontrados foram predador/parasita (55%e onívoro (38,05%, com poucas espécies consideradas necrófagas (1,31%.This paper sought to assess the Coleoptera fauna associated with carcasses of Sus scrofa L., 1758, which is usually used as model in Forensic Entomology. The addition and sequential substitution of insect species could be used to estimate the post mortem interval (PMI. The present study took place in Centro Politécnico (UFPR, between september 2005 to september 2006. A pig weighting 15 kg was sacrificed each season and put inside a cage. Sampling is made daily in a tray placed below the carcass and in a Shannon modified trap, and each 14 days in five pit-fall traps. 4,360 beetles were collected, belonging to 112 species of 26 families, 12 were considered of forensic potential. The active collecting made in the tray was responsible for the largest number of

  5. Spatial and temporal distribution of benthic macroinvertebrates in a Southeastern Brazilian river Distribuição espaço-temporal de macroinvertebrados bentônicos em um rio do sudeste brasileiro

    Directory of Open Access Journals (Sweden)

    M. P. Silveira


    Full Text Available Benthic macroinvertebrate assemblages are structured according to physical and chemical parameters that define microhabitats, including food supply, shelter to escape predators, and other biological parameters that influence reproductive success. The aim of this study is to investigate spatial and temporal distribution of macroinvertebrate assemblages at the Macaé river basin, in Rio de Janeiro state, Southeastern Brazil. According to the "Habitat Assessment Field Data Sheet - High Gradient Streams" (Barbour et al., 1999, the five sampling sites are considered as a reference condition. Despite the differences in hydrological parameters (mean width, depth and discharge among sites, the physicochemical parameters and functional feeding groups' general structure were similar, except for the less impacted area, which showed more shredders. According to the Detrended Correspondence Analysis based on substrates, there is a clear distinction between pool and riffle assemblages. In fact, the riffle litter substrate had higher taxa in terms of richness and abundance, but the pool litter substrate had the greatest number of exclusive taxa. A Cluster Analysis based on sampling sites data showed that temporal variation was the main factor in structuring macroinvertebrate assemblages in the studied habitats.A fauna de macroinvertebrados bentônicos é estruturada por fatores físicos e químicos que determinam os microhábitats, incluindo a disponibilidade de alimento, a existência de refúgios contra predadores e tempestades, o sucesso reprodutivo e outros parâmetros biológicos. O objetivo deste estudo foi investigar a distribuição espaço-temporal da comunidade de macroinvertebrados bentônicos na bacia do rio Macaé, Estado do Rio de Janeiro, Brasil. De acordo com o Habitat Assessment Field Data Sheet - High Gradient Streams (Barbour et al., 1999, os cinco locais coletados são considerados como referência para propósito de biomonitoramento

  6. Assessment of beneficial role of an insectivorous bird, jungle babbler (Turdoides striatus predation, on Helicoverpa armigera infesting pigeon pea (Cajanus cajan crop Evaluación del rol benéfico de Turdoides striatus como predator de Helicoverpa armigera en el cultivo de guandul (Cajanus cajan

    Directory of Open Access Journals (Sweden)

    Bhavna Bharucha


    heavy losses. This work investigates the interactions among pigeon pea, its key pest, and their natural enemies. These relationships have implications on the pest status of individual species and on possible control strategies.Turdoides striatus es un pájaro insectívoro muy común en áreas subtropicales altamente predador de Helicoverpa armigera, un insecto perforador del fruto de varios cultivos, entre ellos Cajanus cajan (guandul. Para evaluar el rol de T. striatus en el control del insecto, en Baroda (estado de Gaujarat, India, se hicieron observaciones en campos sobre sus hábitos y frecuencia de aparición. Fueron muestreos al azar en 60 plantas con una frecuencia cada 1 - 2 minutos, durante 2 h en la mañana y un tiempo igual en la tarde. Se encontró una relación positiva entre el ataque de las larvas del perforador y la población de T. striatus. Se observó que el insecto prefiere las semillas de guandul sobre las de sorgo, un cultivo asociado incluido en los tratamientos.

  7. Programa de controle de surto de escorpião Tityus serrulatus, Lutz e Mello 1922, no município de Aparecida, SP (Scorpiones, Buthidae

    Directory of Open Access Journals (Sweden)

    Elieth Floret Spirandeli Cruz


    Full Text Available Os autores propuseram para o município de Aparecida, vale do Rio Paraíba, SP, região endêmica do Tityus serrulatus, um programa de controle do escorpionismo. Foram estudados a presença de focos do escorpião no campo e na cidade, as alterações ambientais periféricas à zona urbana e os novos ambientes de procriação e dispersão destes artrópodes. Além disso, foram avaliados os problemas básicos de infra-estrutura, tais como o acondicionamento e a coleta do lixo urbano público e domiciliar, o saneamento básico (esgotos e galerias pluviais e a situação dos terrenos baldios e as construções da zona urbana. Após estudo epidemiológico, foram propostas medidas educativas, que constaram da confecção e distribuição de folhetos, de mutirões de limpeza, de visitas domiciliares e do engajamento de professores e alunos da rede de ensino pública e privada na campanha. Nos locais onde existiam focos de alto risco, em especial nas pré-escolas, foi proposto o emprego do controle químico. Dentro das normas sanitárias vigentes para a zona urbana, foi proposto ainda, o uso de predadores naturais no combate. Os autores concluem que as ações devem ser integradas e continuadas de forma ininterrupta por vários anos e propõem ação conjunta com a campanha da dengue. A instituição de uma semana por ano dedicada ao estudo do escorpionismo nas escolas dos municípios onde ocorre o problema seria uma medida educativa que viria contribuir sobremaneira para a prevenção dos acidentes e controle do escorpionismo.A scorpion control program was proposed for the town of Aparecida (SP, an endemic region of Tityus serrulatus. Clusters of scorpions in urban and rural areas, environmental degradation of the town's outskirts and new scorpion procreation and dispersal habitats were studied. In addition, infrastructure problems such as the disposal and collection of residential and municipal refuse, sanitation (sewage and storm sewer, condition of

  8. Biological and behavior aspects of Chrysoperla externa (Hagen, 1861 on cotton plantsAspectos biológicos e comportamentais de Chrysoperla externa (Hagen, 1861 em algodoeiro

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo


    ção, efetivo de oviposição, pós-oviposição, longevidade de machos e fêmeas, capacidade diária e total de oviposição. O comportamento de pupação foi avaliado liberando-se três larvas de terceiro ínstar por planta de algodão, colocando-as no terço inferior, médio e superior. Os tratamentos foram: solo nu, folhas secas de algodoeiro, brita no 1 e brita no 1 + folhas secas. Para se avaliar o tempo de busca, larvas nos diferentes ínstares, foram liberadas no terço superior de plantas de algodão infestadas com A. gossypii, cronometrando-se o tempo em que a presa ficou exposta ao predador. As larvas de C. externa passaram por todas as fases do seu ciclo biológico e não houve influência significativa do tipo de cobertura do solo utilizada na porcentagem de pupas recuperadas, sendo todas foram significativamente superiores a solo nu. Não houve diferença significativa no tempo de busca da presa pelas larvas de C. externa.

  9. Importance of the macrofauna for the feeding of young fish species from infralittoral of Arrozal - Cananeia lagoon estuarine region (25º02'S-47º56'W: Brazil

    Directory of Open Access Journals (Sweden)

    Yoko Wakabara


    divididos em três grupos, de acordo com os hábitos tróficos: comedores de misidáceos, comedores de copépodes e "generalistas" que refletiu a variação sazonal da macrofauna. Setenta e cinco por cento das espécies de peixes predadores alimentaram-se de organismos bentônicos e bentopelágicos e vinte e cinco por cento de organismos pelágicos. Assim, no infralitoral de Cananéia - Arrozal os organismos bentônicos e bentopelágicos constituem a principal fonte alimentar de peixes jovens.

  10. Factors affecting colonization and abundance of Aphis gossypii glover (hemiptera: aphididae on okra plantations Fatores que afetam a colonização e abundância de Aphis gossypii glover (Hemiptera: Aphididae em plantações de quiabeiro

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available The control of Aphis gossypii Glover (Hemiptera: Aphididae on okra Abelmoschus esculentus (L. (Malvaceae consist primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to determine the effects of predators and parasitoids, height of canopy, plant age, leaf areas, organic compounds leaves, levels of leaf nitrogen and potassium, density of leaf trichomes, total rainfall and median temperature on attack intensity of A. gossypii on two successive A. esculentus var. Santa Cruz plantations. Monthly number estimates of A. gossypii and natural enemies (visual inspection occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence, leaf areas and natural enemies, mainly Adialytus spp., spiders and Coccinellidae, were some of the factors that most contributed to aphid reduction. A higher number of aphids was found on the bottom part than medium and apical parts of okra plants. Total rainfall can reduce the aphid population. Trichomes non-glandular or low density, organic compounds leaves and levels of N and K were not important for reducing aphid population.O controle de Aphis gossypii Glover (Hemiptera: Aphididae em quiabeiro Abelmoschus esculentus (L. (Malvaceae consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. Objetivou-se com este estudo determinar os efeitos de predadores e parasitóides, altura de dossel, idade da planta, área foliar, compostos orgânicos foliares, níveis de nitrogênio e potássio, densidade de tricomas, pluviosidade e temperatura na intensidade de ataque de A. gossypii em dois cultivos sucessivos de Abelmoschus esculentus var. Santa Cruz. Estimou-se, mensalmente, o número de A. gossypii e de inimigos naturais (inspeção visual ocorridos nas folhas (uma folha/planta localizadas nas partes basal, mediana e apical de 30 plantas/plantação. Os

  11. Ocorrência e biologia do Rhodnius neglectus Lent, 1954 em macaubeiras da periferia de Belo Horizonte, Minas Gerais Occurence and biology of Rhodnius neglectus Lent, 1954 in palm tress of suburban areas of Belo Horizonte, Minas Gerais

    Directory of Open Access Journals (Sweden)

    Liléia Diotaiuti


    Full Text Available Oitenta e uma macaubeiras (A. sclerocarpa foram derrubadas e dissecadas na periferia de Belo Horizonte, no período de abril/ 1979 a julho/1980. Foram capturados 463 exemplares de Rhodnius neglectus, com uma taxa de infestação das palmeiras de 60,5% e uma média de 9,45% triatomineos/palmeira positiva. O R. neglectus nesta região parece apresentar uma unica geração anual, com possibilidade de duas, sendo que o periodo de oviposição se relaciona com os meses quentes do ano, coincidindo com a predominância de formas jovens sobre os adultos. A observação sugere que a densidade populacional do R. neglectus no seu ecotopo natural possa estar relacionada com a disponibilidade de alimento e com a presença de predadores como o Telenomus sp., formigas, aranhas, hemipteros, escorpiões e pseudo-escorpiões. O indice global de infecção pelo Trypanosoma cruzi foi de 15,9%, indicando o R. neglectus como um importante vetor silvestre deste tripanosomatídeo cuja principal fonte e constituída por marsupiais. O R. neglectus na regiao encontra-se estreitamente associado a palmeira de macaúba, e as aves que as frequentam constituem sua principal fonte alimentar. As observações não sugerem o R.neglectus como uma espécie transmissora do T. cruzi ao homem nesta região.Eighty-one "macaubeiras" palm-trees (Acrocomia sclerocarpa from the periophery of Belo Horizonte city were cut down and dissected between April 1979 and July 1980. 60,5% of the trees were positive for R. neglectus and 463 specimens of this insect were collected, providing a mean rate of 9,45 individuals for positive palm-trees. R neglectus seems to present a single annual generation in this region, but evidence was obtained that two generations may occur. Its spawn period is related to the hot months of the year, when younger insects prevail over the adults. This observation suggests that higher population desities are related to better feeding conditions and to minor desities of

  12. Whitefly, aphids and thrips attack on cabbage Ataque de mosca-branca, pulgões e tripes em repolho

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available The objective of this work was to investigate the relationships between predators and parasitoids, leaf chemical composition, levels of leaf nitrogen and potassium, total rainfall, relative humidity, daylight and median temperature on the intensity of whitefly, aphid, and thrips attack on cabbage. Whitefly, aphids and thrips population tended to proliferate in the final stage of plant or reached a peak population about 40 days after plantation. The whitefly and thrips tended to increase with an increase in the median temperature. A dependence of Cheiracanthium inclusum and Adialytus spp. populations on whitefly and aphids populations, respectively, was observed. No significant effect was detected between K and nonacosane leaf content and aphid population. However, an increase in leaf N content was followed by a decrease of this insect population. No significant relation was observed between leaf N, K and nonacosane and whitefly and thrips populations. Highest nonacosane levels were observed in plants 40 days after transplant, and relative humidity correlated negatively with nonacosane. Natural enemies, especially the parasitoid Adialytus spp. and the spiders can be useful controlling agents of the whitefly and aphids in cabbage. Median temperature can increase whitefly and thrips populations.O objetivo deste trabalho foi investigar as relações entre predadores, parasitóides, composição química foliar, níveis de nitrogênio e de potássio foliar, pluviosidade, umidade relativa, insolação e temperatura média na intensidade de ataque de mosca-branca, pulgão e tripes em repolho. As populações de mosca-branca, pulgões e tripes tenderam a aumentar no final do cultivo ou apresentaram pico 40 dias depois do transplantio. As populações de mosca-branca e tripes tenderam a aumentar sob temperaturas mais elevadas. As populações de Cheiracanthium inclusum e Adialytus spp. dependiam das populações de mosca-branca e pulg

  13. Óleo de copaíba (Copaifera sp.: histórico, extração, aplicações industriais e propriedades medicinais Copaiba oil (Copaifera sp.: history, extraction, industrial applications and medicinal properties

    Directory of Open Access Journals (Sweden)

    F.A. Pieri


    Full Text Available Este trabalho teve como objetivo realizar uma revisão de literatura sobre o gênero Copaifera sp. Foi realizado levantamento bibliográfico do período de 1792 a 2008 utilizando bibliotecas da Universidade de São Paulo, Universidade Federal de Viçosa, Universidade Federal de Alfenas e Universidade José do Rosário Vellano, pesquisas às bases de dados SCOPUS e PubMed, além de ferramentas de busca na web. Utilizou-se para a busca palavras chave como "Copaiba", "Copaifera", "Copaíba oil" "Óleo de Copaíba". Como resultado desta pesquisa obteve-se a seleção de 63 referências incluindo livros, artigos, cadernos técnicos, resumos de congressos, teses, dissertações e patentes. Estes dados apontaram o óleo de copaíba como um exsudato produzido pelas copaibeiras como defesa contra seus predadores, que vem sendo utilizado pela medicina tradicional popular e silvícola há mais de 500 anos. Ele é extraído destas árvores através de perfurações realizadas em seus troncos. Além das inúmeras aplicações do óleo em cosméticos e outras indústrias, ainda há uma série de indicações para seu uso na medicina. Existem hoje descritas algumas dezenas de propriedades medicinais diferentes, que vem sendo em alguns casos comprovadas cientificamente, como atividade antimicrobiana, antiinflamatória, anti-neoplásica entre outras. Estudos recentes têm demonstrado também grande potencial de uso do óleo de copaíba na odontologia, na composição de cimentos endodônticos e na prevenção e combate da doença periodontal. As informações contidas neste trabalho demonstram uma grande variabilidade de aplicações do óleo de copaíba. Entretanto uma quantidade limitada de pesquisas sobre suas propriedades medicinais tem sido realizada, apresentando assim a necessidade de novas pesquisas sobre estas.The aim of this study was to conduct a literature review concerning the genus Copaifera sp. The survey involved the period from 1792 to 2008 and

  14. Sleeping sites of woolly mouse opossum Micoureus demerarae (Thomas (Didelphimorphia, Didelphidae in the Atlantic Forest of south-eastern Brazil Sítios de dormida da cuíca Micoureus demerarae (Thomas (Didelphimorphia, Didelphidaa na Floresta Atlântica do sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Edsel A. Moraes Junior


    . aculeatissimum se deve provavelmente à maior proteção contra predadores exercida pelos numerosos espinhos presentes nesta espécie.

  15. Behavior of prey links midwater and demersal piscivorous reef fishes

    Directory of Open Access Journals (Sweden)

    Peter J. Auster


    Full Text Available Pelagic and demersal guilds of piscivorous fishes are linked by a variety of biological and physical processes that mediate interactions with common prey species. Understanding the behaviors of predators and prey can provide insight into the conditions that make such linkages possible. Here we report on the behaviors of mid-water piscivorous fishes and the responses of prey that produce feeding opportunities for demersal piscivorous fishes associated with "live bottom" ledge habitats off the coast of Georgia (northwest Atlantic Ocean. Prey taxa reduced nearest neighbor distances and retreated towards the seafloor during predatory attacks by mid-water fishes. Demersal fishes subsequently attacked and consumed prey in these ephemeral high density patches. No predation by demersal fishes was observed when prey species were at background densities. If the predator-prey interactions of demersal piscivorous fishes are commonly mediated by the predatory behavior of midwater piscivorous fishes and their prey, such indirect facilitative behaviors may be important in terms of the population processes (e.g., prey consumption and growth rates of these demersal fishes.As guildas de peixes piscívoros pelágicos são conectadas às de peixes piscívoros demersais através de diversos processos biológicos e físicos que permeiam as interações com suas presas em comum. O conhecimento do comportamento de predadores e presas pode fornecer idéias a respeito das condições que tornam estes elos possíveis. Relatamos aqui os comportamentos de peixes piscívoros de meia-água e as respostas de suas presas que fornecem, assim, oportunidades alimentares para os peixes piscívoros demersais que vivem associados a fundos rochosos ao largo da costa da Geórgia (Oceano Atlântico. As presas reduziram a distância mínima entre os indivíduos e recolheram-se em direção ao fundo durante os ataques dos peixes de meia-água. Em seguida, peixes demersais atacaram e

  16. Long-term ecological research in the forests of the United States: Key lessons for its application in Chile and around the world Estudios ecológicos de largo plazo en bosques de Estados Unidos: Lecciones claves para su aplicación en Chile y otras regiones

    Directory of Open Access Journals (Sweden)



    Norteamérica ha incluido estudios de cuencas, ensayos silviculturales, establecimiento de parcelas permanentes para investigar demografía forestal, y el estudio de regímenes de perturbación y sistemas predadores/presa. El inicio de investigación de largo plazo en ecosistemas forestales de otras regiones del mundo, especialmente en latitudes correspondientes a ambos lados del ecuador, ayudará a los científicos a comprender los regímenes de perturbaciones naturales y sucesión, así como los efectos de varias estrategias del manejo forestal, y los impactos de cambio climático. Recomendaciones claves basadas en la experiencia de Norteamérica incluyen: 1 la importancia de la investigación multidisciplinaria, 2 la necesidad de invertir recursos en el manejo de bases de datos, 3 la aplicación tanto de tecnología básica como avanzada (por ejemplo, sistemas de detección de ‘eddy covariance’ para cuantificar el intercambio de carbono entre los bosques y la atmósfera, y 4 colaboración entre regiones, instituciones, y científicos individuales.

  17. Acaricidas utilizados na citricultura convencional e orgânica: manejo da leprose e populações de ácaros fitoseídeos

    Directory of Open Access Journals (Sweden)

    Daniel Júnior de Andrade


    Full Text Available O controle da leprose dos citros no Estado de São Paulo é realizado quase que exclusivamente com aplicações de acaricidas para o controle do ácaro vetor Brevipalpus phoenicis, as quais contribuem para o aumento dos custos de produção e podem afetar negativamente as populações de organismos benéficos. Portanto, o objetivo do trabalho foi avaliar, durante quatro safras, os efeitos de acaricidas indicados para o controle do ácaro B. phoenicis em citros convencional e orgânico sobre a evolução da leprose dos citros e sobre ácaros fitoseídeos. O experimento foi instalado em outubro de 2003, em pomar de laranja localizado no município de Reginópolis-SP. O delineamento experimental foi em blocos casualizados, estabelecendo-se os tratamentos, expressos em mL de p.c./100 L de água: spirodiclofen a 20 mL e cyhexatin a 50 mL (aplicados em rotação, calda sulfocálcica a 4.000 mL e testemunha sem aplicação de acaricidas. Entretanto, a rotação entre spirodiclofen e cyhexatin iniciou-se em setembro de 2006 e, anteriormente a esse período, utilizou-se somente o spirodiclofen. A cada quinze dias, foram realizados levantamentos populacionais do ácaro B. phoenicis e dos ácaros predadores Iphiseiodes zuluagai e os do gênero Euseius. O nível de controle adotado para o B. phoenicis foi de 8,3%, sendo que as aplicações dos produtos foram realizadas com pulverizador de arrasto tratorizado munido com lanças manuais. Na safra de 2007-2008, coletaram-se 10 frutos caídos devido à leprose por parcela e quantificou-se o número de lesões de leprose presentes em cada fruto. Avaliaram-se, ao término da safra de 2007-2008, a produtividade, as perdas devido à leprose, bem como a incidência e a severidade da leprose. Constatou-se que o local das lesões no fruto é mais importante para determinar sua queda do que o número de lesões presentes. Quanto mais intensa a infestação do ácaro B. phoenicis, maior é o número de lesões de

  18. Técnicas de controle de qualidade utilizadas na criação de tilápia do Nilo (Oreochromis niloticus - DOI: 10.4025/actascibiolsci.v20i0.4471 Quality control techniques used in the breeding of Nile tilapia (Oreochromis niloticus - DOI: 10.4025/actascibiolsci.v20i0.4471

    Directory of Open Access Journals (Sweden)

    Júlio Hermann Leonhardt


    Full Text Available Foram utilizados 240 alevinos de tilápia do Nilo (Oreochromis niloticus, de 45 dias, sexualmente revertidos com peso médio inicial de 1,25 ± 0,14g, distribuídos num delineamento inteiramente casualizado, durante 180 dias. Foram avaliados os efeitos da substituição de 10%, 20% e 30% da ração por levedura de destilaria alcooleira. Os resultados médios obtidos para os parâmetros limnológicos no controle da qualidade da água através de análises físico-químicas e gráficos de controle foram normais durante todo o período experimental. Os valores da temperatura média mensal revelaram estar “fora de controle estatístico”, e mostraram, através da aplicação dos índices de capacidade (Cp e Cpk, que 35,20% estão abaixo do limite inferior de especificação (LIE. A análise dos resultados obtidos, através da aplicação das técnicas de Pareto e Problema da Mochila, evidenciou a solução ótima para resolver os problemas de predadores, biometrias e doenças com a função objetivo Z* maximizada. A utilização das técnicas de controle de qualidade permite um aumento da taxa de estocagem nos tanques sem redução da taxa de crescimento individual e com obtenção de altas produções de peixes de boa qualidade.Two hundred and forty Nile tilapia fry (Oreochromis niloticus, 45 days old, sexually reverted, with initial average weight of 1.25 ± 0.14g, distributed in a totally randomized design during 180 days, were used in this experiment. Effects of substitutions of 10%, 20% and 30% of the rations by yeast obtained from alcohol distillery were evaluated. Average results obtained for the limnological parameters in water quality control by means of chemical analyses and control graphs were considered normal during the entire experimental period. Values of monthly average temperature were statistically out of control and by the application of the capacity rates (Cp and Cpk showed that 35.20% were below the lowest specification limit

  19. Reproductive success of South American terns (Sterna hirundinacea from Cardos Islands, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Hélio A.A. Fracasso


    observadas em julho de 2003, e junho de 2005 e 2006, com o sucesso reprodutivo de 50,94%, 35,96 e 53,47%, respectivamente. A ilha dos Cardos tem sido constantemente usada para a nidificação de trinta-réis do bico-vermelho da América do Sul, e a baixa predação pelo principal predador na região, a gaivota (Larus dominicanus, tornam a ilha um importante local para a conservação da espécie.

  20. Spatial distribution and diet of Cephalopholis fulva (Ephinephelidae at Trindade Island, Brazil

    Directory of Open Access Journals (Sweden)

    Flavio do Nascimento Coelho


    ência por micro-habitats de alta complexidade estrutural. Foram registrados quatro grupos de itens alimentares no conteúdo estomacal de C. fulva: Annelida, Crustacea, Teleostei e Testudinata. É feito aqui o primeiro registro de predação de juvenis da tartaruga-verde (Chelonia mydas por C. fulva. Trindade parece apresentar os maiores valores de densidade para o catuá, quando comparada a outras localidades do Brasil e Caribe. A escassez de competidores, predadores e a pressão pesqueira são possíveis fatores que podem explicar as altas densidades observadas para C. fulva na Ilha da Trindade.

  1. Functional trophic composition of the ichthyofauna of forest streams in eastern Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    Gabriel Lourenço Brejão

    écies distribuídas em seis ordens, 26 famílias e 63 gêneros, com predomínio de Characiformes, seguidos por Siluriformes. A partir de informações coligidas por observações ad libitum, as espécies foram organizadas em 18 grupos tróficos funcionais (GTFs, de acordo com duas características principais: (1 a tática alimentar observada com maior frequência; e (2 sua distribuição espacial no riacho, considerando suas dimensões lateral (margens e canal central e vertical (coluna d'água. Os GTFs mais frequentes foram Catadores noturnos de invertebrados (9 espécies, Coletores diurnos de canal (8 spp., Catadores diurnos de superfície (7 spp., e Predadores de tocaia e emboscada (6 spp.. Os GTFs aqui definidos possibilitam uma análise comparativa da estrutura e composição da ictiofauna, que representa uma abordagem alternativa ao uso da estrutura taxonômica em estudos ecológicos. A classificação da ictiofauna baseada em GTFs proposta neste trabalho é comparada com outras três classificações, propostas por Sazima (1986, Sabino & Zuanon (1998 e Casatti et al. (2001.

  2. Larval feeding behavior of the truncatus group of Thrypticus (Diptera: Dolichopodidae that breed in the aerenchyma of Pontederiaceae Comportamiento alimentario de las larvas del grupo truncatus de Thrypticus (Diptera: Dolichopodidae que se crían en el aerénquima de Pontederiaceae

    Directory of Open Access Journals (Sweden)

    M. Cristina Hernández


    -Laubach (Pontederiaceae, minando cerca de la epidermis y abriendo varios orificios al exterior. La larva de T. romus Bickel & Hernández crece en E. azurea (Sw. Kunth, formando una mina curva, corta en comparación con las otras especies. La larva de T. formosensis Bickel & Hernández se desarrolla en Pontederia cordata L. (Pontederiaceae, excavando la mina entre la epidermis y la gran celda central de los pecíolos. Por último, la larva de T. taragui Bickel & Hernández se cría en tallos sumergidos de P. subovata (Seub. in Mart. Lowden, formando una mina subepidérmica con ramificaciones hacia la estela central del tallo. No se pudieron asociar las minas correspondientes a las especies T. yanayacu, T. chanophalus y T. azuricola. No se encontraron predadores ni parásitos de larvas o pupas, se observaron casos de canibalismo entre larvas cuando el trazado de dos minas confluye. Las especies del grupo truncatus poseen un modo de alimentación sumamente específico, confinadas al aerénquima, se alimentan de la savia extraída de los orificios roídos en los haces vasculares de los pecíolos y tallos, posiblemente con levaduras simbiontes como suplemento para la nutrición. Numerosas colecciones en el campo y pruebas en el laboratorio, indican que estos insectos están asociados con plantas hospedadoras específicas dentro de la misma familia. Esta especialización sugiere una larga asociación insecto-hospedadora.

  3. Aves de fragmentos florestais em área de cultivo de cana-de-açúcar no sudeste do Brasil Birds of forest fragments in area of sugar-cane crops in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Augusto Piratelli

    Full Text Available Foi estudada a avifauna de quatro fragmentos florestais em uma área de cultivo de cana-de-açúcar na região de Campos dos Goytacazes, norte do estado do Rio de Janeiro. A dieta básica e a estrutura das guildas tróficas foi determinada. O estudo foi realizado de outubro de 2000 a julho de 2001, utilizando-se capturas com redes ornitológicas, registros visuais e auditivos e análise de fezes. Quarenta e quatro espécies foram registradas e agrupadas em oito guildas tróficas (insetívoros, granívoros, carnívoros, frugívoros, piscívoros, nectarívoros, onívoros e detritívoros. Estas espécies foram também subdivididas em guildas mais específicas, associadas a seus hábitats. Algumas espécies apenas sobrevoaram os fragmentos, como Egretta thula (Molina, 1782, enquanto outras foram consideradas residentes, como Manacus manacus (Linnaeus, 1766. Algumas, como Amazona amazonica (Linnaeus, 1766, somente utilizaram os fragmentos para repouso noturno. Espécies pequenas de sub-bosque provavelmente não se deslocaram entre fragmentos, dada a relativa grande distância entre eles. Predadores como Rupornis magnirostris (Gmelin, 1789 utilizaram tanto os fragmentos quando as áreas abertas e canaviais em seu entorno. Estes fragmentos estão em situação crítica, abrigando principalmente espécies generalistas e/ou especialistas de bordas; porém ainda são utilizados de alguma forma por espécies de interesse ecológico, como Rhynchocyclus olivaceus (Temminck, 1820 e A. amazonica.Birds of four forest fragments in areas of extensive sugar-cane plantation were studied in Campos dos Goytacazes, northern Rio de Janeiro State, Brazil, from October 2000 to July 2001. The basic diet of sampled species and their trophic guild allocation were determined. The study was carried out by means of capture with mist nets, visual and auditive records and analysis of faeces. Forty-four species were recorded and grouped in eight trophic guilds (insectivores

  4. Tafonomia y ambiente sedimentario del yacimiento de Huelago

    Directory of Open Access Journals (Sweden)

    Alberdi, M. T.


    situ. En los niveles detríticos asociados a paleocanales hay un porcentaje mayor de dientes aislados y esquirlas; y las mandíbulas y cuernas están asociadas a niveles limoso-margosos sin removilizar. Los agentes atmosféricos contribuyeron activamente a la fracturación de los huesos. La actividad de carroñeros-predadores en la superficie herbácea y encharcada del borde del lago ha sido reconocida. La gran diversidad de rumiantes, en particular los ramoneadores, indica áreas arboladas o arbustivas en los alrededores de Huélago, aunque no en el área inmediata del borde del lago. Se elaboró una matriz de datos con las variables medidas en cada resto fósil recuperado, que fue la base para el tratamiento gráfico y estadístico utilizado en el estudio del yacimiento.

  5. Altitudinal zonation among lizards of the genus Liolaemus: questions answered and unanswered questions Zonación altitudinal en lagartijas del género Liolaemus: preguntas respondidas y pendientes

    Directory of Open Access Journals (Sweden)



    temperaturas ambientales frías determinan que sólo las especies vivíparas puedan sobrevivir arriba de los 2.400 m de altura. Tres especies de Liolaemus se especializan en microhábitats de distribución restringida en el gradiente altitudinal. Liolaemus tenuis se encuentra exclusivamente en la base de árboles, los cuales se distribuyen típicamente debajo de los 1.800 m. Liolaemus leopardinus se especializa en rocas grandes que se encuentran sólo en altitudes mayores. Liolaemus monticola usa rocas pequeñas: la oviparidad determina su límite distribucional superior en dos de los tres transectos examinados, y en el tercero esta especie y su habitat rocoso virtualmente desaparecen arriba de los 1.500 m. La competencia interespecífica entre Liolaemus aparentemente no se relaciona con su distribución altitudinal. No encontramos ejemplos de distribuciones parapátricas entre pares de especies de Liolaemus con similares requerimientos de nicho. Otros investigadores han encontrado que la depredación no se correlaciona con la altitud: su papel en determinar las distribuciones altitudinales de especies depende tanto de las densidades de predadores como de las presas. Concluímos que los factores determinantes de los límites de distribución de las especies de Liolaemus varían dependiendo de sus circunstancias individuales en el tiempo y el espacio: si bien la fisiología puede ser relevante en un transecto, la disponibilidad del microhábitat preferido puede ser importante en otro

  6. Composição elementar e caracterização da fração lipídica de seis cultivares de caupi Biochemical composition and characterization of lipid fraction of six cowpea cultivars

    Directory of Open Access Journals (Sweden)

    Rolando E. R. Castellón


    Full Text Available A composição bioquímica elementar de sementes de seis cultivares de feijão de corda (Vigna unguiculata foi determinada e a fração lipídica de cada cultivar, caracterizada. Os resultados sugerem que todas as farinhas de semente compartilham composição bioquímica similar, embora as cultivares Br-14 e CE-315 difiram das Br-9 e Br-17 no teor de umidade. As frações lipídicas purificadas foram caracterizadas quanto ao teor e tipos de ácidos graxos presentes. A cultivar Br-17 possui alto conteúdo de ácido palmítico (58,2% e o menor conteúdo de ácido linoléico (6,4% enquanto a Vita 7 apresenta alto conteúdo de ácido linoléico (21,8% e relativamente baixo conteúdo de ácido palmítico (41% em uma base comparativa. Os ácidos graxos pentacosanóico e eicosanóico representam a fração lipídica menor e o primeiro não ocorre em CE-315. Os resultados sugerem que diferentes cultivares obtidas por melhoramento genético podem apresentar diferenças quantitativas e qualitativas na composição bioquímica; assim, diferenças na capacidade germinativa, resistência a predadores no campo de plantio e no armazenamento, poderiam estar relacionadas à inibição ou estímulo da expressão de genes codificadores da síntese de moléculas relevantes, que refletem diferenças de composição, como demonstrado neste trabalho.The biochemical composition of the seeds of six bean - Vigna unguiculata (Walp cultivars was determined and the lipid fraction of each of these cultivars was characterized. The results suggest that all analyzed seed flours share similar biochemical composition, although the cultivars Br-14 and CE-315 differ in relation to Br-9 and Br-17 in water content. The purified fatty acid fractions were characterized according to their lipid content. The cultivar Br-17 possesses high content of palmitic acid (58.2% and low content of linoleic acid (6.4% while Vita 7 possesses high contents of linoleic acid (21.8% and relatively low

  7. Algumas observações de laboratório sobre biologia e ecologia de Pomacea haustrum (Reeve, 1856

    Directory of Open Access Journals (Sweden)

    Carlos Tito Guimarães


    Full Text Available Observações de laboratório sobre o pilideo Pomacea haustrum (Reeve, 1856 competidor-predador de planorbineos hospedeiros intermediários da esquistossomose mansoni mostraram que: Machos e fêmeas atingem maturidade sexual após um ano de idade, copulando preferencialmente pela manhã e ovipondo à noite. O tempo gasto nestes atos é variável; no caso da oviposição ele depende do número de ovos a serem postos. Os ovos são arredondados, com diâmetro médio de 3mm e coloração rósea que vai se alterando à medida que os embriões se desenvolvem. Com um período de incubaçãod e 15 a 23 dias, condicionado pela temperatura ambiente, eles resistem até 5 a 6 dias imersos em água sem danos aos embriões; independem de luz para eclodir. Os exemplares recém-eclodido têm, em média, 2,4 por 1,7mm de altura e diâmetro, respectivamente. Criados em isolamento crescem e sobrevivem mais que quando criados em grupo. Resistem pelo menos 90 dias fora d'água, mantendo-se neste período dentro das conchas, com o opérculo hermeticamente fechado, em anidrobiose. Nesta fase, podem morrer por ataque de larvas de dípteros.Laboratory observation on the pilid Pomacea haustrum (Reeve, 1856, competitor and predator of Manson's schistosomiasis intermediate hosts, have shown that: Males and females reach sexual maturity after one year, copulating preferably in the morning and laying eggs at night. The time spent in these acts is variable; in the case of egglaying it depends on the number of eggs to be laid. The eggs are round, about 3mm in diameter, and have a pink color that changes with the development of the embryos. With an average incubation time of 15 to 23 days and conditioned by the temperature of the environment, they resist for 5 to 6 days immersed in water without damage to th embryos and they do not need light to hatch. The newly-hatched specimens have about 2.4 x 1,7 mm of height and diameter, respectively. The specimens bred alone grow more

  8. Fatores que afetam artrópodes associados a cinco acessos de ginseng-brasileiro (Pfaffia glomerata em Montes Claros, Estado de Minas Gerais = Factors affecting arthropods associated with five accessions of Brazilian ginseng (Pfaffia glomerata in Montes Claros, Brazil

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite


    Full Text Available O objetivo deste trabalho foi identificar artrópodes associados a cinco acessos ('NDS', 'COVB', 'NAT', 'ROST' e 'GSD1' de Pfaffia glomerata, bem como o efeito de clima, dossel, face foliar, tricomas e inimigos naturais sobre a entomofauna. Dos artrópodes observados, Aphis gossypii (Hemiptera: Aphididae, Diabrotica speciosa (Coleoptera: Chrysomelidae e Tetranychus ludeni (Acari: Tetranychidae apresentaram maior densidade populacional. Dos inimigos naturais observados, ácaros predadores estiveram associados ao ácaro branco Polyphagotarsonemus latus (Acari: Tarsonemidae, e um complexo de aranhas a besouros desfolhadores, pulgões e cicadelídeos. Observaram-se correlações significativas diretas múltiplas e lineares da população de A. gossypii com maior densidade de Crematogaster sp.(Hymenotera: Formicidae (protocooperação e correlação negativa com densidade de Cycloneda sanguinea (Coleoptera: Coccinelidae e a temperatura do ar. Foi observado maior ataque de ácaros T. ludeni, T. urticae (Tetranychidae e P. latus, em períodos de menor umidaderelativa. Observou-se maior densidade populacional de A. gossypii, nos acessos 'ROST' e 'NAT' e de T. ludeni ao acesso 'ROST'. O acesso 'GSD1' foi o mais danificado por besouros desfolhadores. Pulgões e ácaros preferiram alimentar-se na face abaxial das folhas apicais,enquanto D. speciosa apresentou preferência pela face adaxial do terço mediano do dossel. Tricomas (100% tectores não afetaram os artrópodes.The objective of this study was to identify arthropods associated with five accessions ('NDS', 'COVB', 'NAT', 'ROST' and 'GSD1' of Pfaffia glomerata and the effect of weather, canopy height, foliar face, trichomes, and naturals enemies over the entomofauna. The arthropods Aphis gossypii, Diabrotica speciosa, and Tetranychus ludeni had the highest population densities. Among naturals enemies, there were predator mites associated with the broad mitePolyphagotarsonemus latus, and the spiders

  9. Dieta e dispersão de sementes por Cerdocyon thous (Linnaeus (Carnívora, Canidae, em um fragmento florestal no Paraná, Brasil Diet and seed dispersal by Cerdocyon thous (Linnaeus in a forest fragment in Paraná (Carnivora, Canidae

    Directory of Open Access Journals (Sweden)

    Vlamir J. Rocha


    Full Text Available Embora o cachorro-do-mato, Cerdocyon thous (Linnaeus, 1706, seja um Canidae relativamente comum, não há muita informação sobre sua dieta e seu papel como dispersor de sementes nos diferentes habitats onde ocorre. O objetivo deste trabalho foi o de reportar a dieta de C. thous e sua importância como dispersor e/ou predador de sementes, e ainda testar a taxa de germinação de sementes após passar pelo trato digestório do animal. O estudo foi realizado em um fragmento (680 ha de Floresta Estacional Semidecidual, o Parque Estadual Mata dos Godoy, localizado na cidade de Londrina, Paraná, sul do Brasil. A metodologia consistiu de coletas de fezes de C. thous, as quais foram analisadas em laboratório para identificar os itens consumidos. Nos testes de germinação, as sementes foram dispostas para germinar em placas de Petri com algodão umedecido em água. Noventa e três amostras fecais com 219 itens de origem vegetal e animal foram registradas, sendo 36,52% contendo restos de pequenos roedores, 24,19% de gramíneas, 13,24% de aves, 10,47% de insetos, 6,39% de Syagrus romanzoffiana (Cham. Glassm., 4,6% de outros itens de origem animal e 4,54% de outros itens de origem vegetal. Ainda, C. thous dispersou nove espécies de plantas, com relevante importância para a germinação de algumas sementes que passaram pelo trato digestório do animal, exceto para S. romanzoffiana, cujas sementes não germinaram nas condições de laboratório. Conclui-se que, C. thous apresentou uma dieta generalista e oportunista, sobrevivendo em áreas degradadas e antrópicas, e agindo como dispersor de sementes nestes locais.Although the crab eating fox, Cerdocyon thous (Linnaeus, 1706, is a relatively common Canidae, there isn't much information about its diet and its role as a seed disperser in the different habitats where it occurs. The aim of this work was to report the diet of the C. thous and its importance as a seed disperser and / or a seed predator and

  10. Bioactivity of the red algae Asparagopsis taxiformis collected from the Southwestern coast of India

    Directory of Open Access Journals (Sweden)

    Aseer Manilal


    crustáceos. A fração extraída com eter de petróleo e etil acetato (2:8 apresentou o espectro de bioatividade mais forte e amplo. No ensaio anti-incrustação efetuado com com o molusco pulmonado Limnea truncatula, a fração algal ativa produziu 80% de repelência do pé em 150 mg/l, enquanto que no ensaio anticianobacteria a fração ativa inibiu 100% do crescimento de Trichodesmium sp., em 320 mg/l. A fração algal mostrou o efeito mais intenso contra peixes no nível de 60 mg/l. Em relação aos crustáceos, a toxicidade da fração ativa foi avaliada também visando encontrar compostos não tóxicos para organismos não alvo, tais como Penaeus monodon e Macrobrachium rosembergii. Foi visto que a fração ativa da coluna mostrou menor toxicidade para estas espécies. Os componentes químicos da fração ativa foram identificados por meio dos sistemas cromatográficos, tais como TLC, fase reversa do HPLC e GC-MS. O perfil geral de atividade aponta que a fração ativa da coluna para A. taxiformis pode conter metabolitos bioativos sinérgicos que podem ser utilizados para o controle de organismos incrustantes, explosão algal e peixes herbiboros/predadores em tanques de aquicultura.

  11. Diet of the American mink Mustela vison and its potential impact on the native fauna of Navarino Island, Cape Horn Biosphere Reserve, Chile Dieta del visón norteamericano Mustela vison y su impacto potencial sobre la fauna nativa de Isla Navarino, Reserva de Biosfera Cabo de Hornos, Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available Invasive exotic species of mammalian predators represent a major cause of vertebrate animal extinctions on islands, particularly those that lack native mammalian carnivores. In 2001, the American mink (Mustela vison was recorded for the first time on Navarino Island, in the Cape Horn Biosphere Reserve (55° S in Chile, representing the southernmost population of mink worldwide. In order to assess its potential impact on native fauna, we studied its diet on Navarino Island, as part of an integrative management program on invasive species. Over a three-year period (2005-2007 we collected 512 scats in semi-aquatic habitats: marine coasts, riparian and lake shores. Overall, the main prey was mammals (37 % biomass, and birds (36 %, followed by fish (24 %. Over the spring and summer, mink consumed significantly more birds, whereas mammals constituted the main prey over the autumn and winter when migratory birds had left the area. Among birds, the mink preyed mainly on adult Passeriformes, followed by Anseriformes and Pelecaniformes, caught as chicks. Among mammals, the exotic muskrat (Ondatra zibethicus was the most important prey, and together with the native rodent Abrothrix xanthorhinus it accounted for 78 % of the biomass intake. For an integrated management of invasive exotic mammal species on Navarino Island and in the Cape Horn Biosphere Reserve it is important to further research interactions established here among the various introduced mammals, and to initiate immediate control of the mink population in its initial stage of invasion.Las especies exóticas de mamíferos carnívoros invasores constituyen una de las principales causas de extinciones de vertebrados en islas, particularmente en aquellas que carecen de predadores mamíferos nativos. En 2001, el visón norteamericano (Mustela vison fue registrado por primera vez en Isla Navarino en la Reserva de Biosfera Cabo de Hornos (55° S en Chile, representando la población de visones m

  12. Vertical distribution of paracalanus crassirostris (copepoda, calanoidea: analysis by the general linear model

    Directory of Open Access Journals (Sweden)

    Ana Milstein


    íduos desta especie de qualquer estádio é diferentemente afetada durante o ano pela hora, profundidade, interação hora-profundidade, e fatores ambientais. Esses efeitos seriam mais marcados no verão. A maior ou menor ocorrência de organismos numa dada hora parece depender mais da dinamica do sistema de correntes (mares que do comportamento dos animais. Todos os estádios apresentaram-se distribuídos na coluna de agua e não mostraram migrações verticais marcadas como parte do seu comportamento normal. Os fatores ambientais em conjunto mostraram-se importantes na distribuição deste organismo, especialmente no verão. Bjornberg & Wilbur (1968 e Sameoto (1975 relacionaram o comportamento migrador pouco marcado ou ausente com o nível trofico que os planctontes costeiros ocupam. Os primeiros autores assinalaram a presença de partículas finas em todas as profundidades em aguas rasas, e a migraçao pouco definida de copepodos filtradores provenientes desse tipo de ãgua; o segundo autor distinguiu, em aguas pouco p?ofundas também, uma comunidade formada por predadores e uma comunidade de presas formada por copepodos nao migradores. Os resultados do presente trabalho apoiam essas idéias, mostrando a falta de migraçao em todos os estádios de um copêpodo que e, durante toda a sua vida, filtrador de partículas finas.

  13. Habitat diversity and benthic functional trophic groups at Serra do Cipó, Southeast Brazil Diversidade de habitats e grupos tróficos funcionais na Serra do Cipó, sudeste do Brasil

    Directory of Open Access Journals (Sweden)



    Doce e engloba uma série de córregos e rios, com características ecológicas ainda bem preservadas e águas de boa qualidade. Foram amostrados os rios Cipó, Peixe e Preto do Itambé, além dos córregos Indaiá e Capão da Mata ao longo de 26 estações amostrais. As amostras foram coletadas nos períodos de chuva (fevereiro e seca (outubro de 1998, utilizando-se "Kicking nets" com malha de 0,125 mm. Os resultados evidenciaram que o grupo dos coletores (Baetidae, Leptophlebiidae e Leptohyphidae foi o mais abundante, seguido pelos coletores-predadores (Hydrophilidae, Ceratopogonidae, Chironomidae-Tanypodinae e detritívoros-herbívoros (Oligochaeta. A avaliação da diversidade de habitats permitiu caracterizar a vegetação ripária, juntamente com as macrófitas aquáticas, como os substratos contendo a maior riqueza de grupos tróficos funcionais, por oferecerem maior diversidade de habitats. Os resultados sugerem que a utilização de grupos tróficos funcionais, juntamente com a avaliação de habitats, constituem eficientes ferramentas na avaliação da diversidade da macrofauna bentônica em ecossitemas lóticos de altitude.

  14. Araucaria araucana and the Austral parakeet: pre-dispersal seed predation on a masting species El pehuén y la cachaña: depredación predispersión de una especie "masting"

    Directory of Open Access Journals (Sweden)



    pero no fue diferente entre sitios. En el año de baja producción de conos, la depredación aumentó durante la temporada, observándose la máxima depredación luego del pico de caída de semillas. La cachaña manipula las semillas con diferente eficiencia en años de alta y baja producción de conos, dejando caer menos semillas parcialmente dañadas en años de baja producción. Se discuten estos resultados en el contexto de la hipótesis sobre saciedad de predadores.

  15. Mites (Arachnida, Acari on Citrus sinensis L. Osbeck orange trees in the state of Amazonas, Northern Brazil Ácarofauna de Citrus sinensis L. Osbeck no estado do Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Teiamar da Encarnação Bobot


    para descrever a abundância e a distribuição das espécies mais importantes. O tamanho e a idade dos pomares variaram de 3.360 a 88.0080 m² e de sete a 25 anos, respectivamente. Nos 14 períodos de coleta, folhas, galhos e frutos foram coletados de uma árvore em cada pomar. No total, 3.360 folhas, 672 galhos e 1.344 frutos foram coletados de 168 árvores. Os ácaros foram extraídos dos frutos manualmente e pelo método de lavagem nas folhas e galhos. Identificamos espécies pragas com potencial de causar danos econômicos. Registramos 14 espécies de fitófagos em quatro famílias (Eriophyidae, Tarsonemidae, Tenuipalpidae, and Tetranychidae. Brevipalpus phoenicis (Geijskes 1939 (Tenuipalpidae e Phyllocoptruta oleivora (Ashm., 1879 (Eriophyidae, as duas espécies fitófagas mais abundantes em outras regiões, foram dominantes, mostrando que a cultura de citros local é suscetível à infestação. Registramos 11 espécies de predadores das famílias Phytoseiidae e Ascidae, compreendendo 10% da população total. Phytoseiidae foi a família mais diversa, com 10 espécies. Foram discutidos aspectos da variação temporal e utilização de hábitat das espécies mais abundantes. Estudos de longo prazo, envolvendo a aplicação de acaricidas e avaliações da comunidade de ácaros, são necessários para um melhor manejo dos pomares, levando-se em consideração a fenologia das pragas-chave.

  16. Biogeography and comparative cytogenetics between two populations of Hoplias malabaricus (Bloch, 1794 (Ostariophysi: Erythrinidae from coastal basins in the State of Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Uedson Pereira Jacobina


    Full Text Available The species Hoplias malabaricus is a predator fish found in nearly all cis-Andean basins. From a cytogenetic point of view, this species comprises, at least, seven differentiated karyomorphs. Several localities have been formerly analyzed in Brazil, however, some regions, such as Bahia State, remain underrepresented. Recently, the Brazilian Environment Ministry classified both Itapicuru and Contas river basins (entirely located within Bahia territory as priority conservation areas, whose biodiversity status lacks enough information. Therefore, the goal of the present work was to characterize, cytogenetically, populations of H. malabaricus from both basins, by using conventional staining, Ag-NOR and C-banding techniques. All specimens presented a diploid number of 2n = 40 with metacentric/submetacentric chromosomes, without differences between sexes, thereby representing the so-called "karyomorph F". The first metacentric pair presented a remarkably larger size in relation to the other pairs. The NORs were multiple, comprising the terminal region on long arms of two chromosomal pairs in both populations. However, the C-banding pattern was somewhat distinguishable between samples. Although sharing heterochromatic blocks at centromeric region of all chromosomes, the population from Itapicuru River basin appeared to have some more conspicuous blocks than those observed in the population from Contas River basin. The similar karyotype observed in both populations suggests a common geological history between them. The present results represent an advance in the knowledge about the cytogenetic pattern of H. malabaricus populations from poorly studied basins.A espécie Hoplias malabaricus é um predador que ocorre em praticamente todas as bacias cis-andinas. Sob o ponto de vista citogenético, ela compreende, pelo menos, sete cariomorfos diferenciáveis. Várias localidades já foram previamente analisadas no Brasil, porém, algumas regiões, como o

  17. Reprodução de Nycticorax nycticorax (Linnaeus no litoral de Santa Catarina, Brasil Reproduction of the Nycticorax nycticorax (Linnaeus in the Santa Catarina's coast, Brazil

    Directory of Open Access Journals (Sweden)

    Joaquim O. Branco


    Full Text Available O savacu Nycticorax nycticorax (Linnaeus, 1758 é uma espécie de hábitos crepusculares e noturnos, com ampla distribuição geográfica. Sua biologia reprodutiva tem sido intensivamente estudada nos países de ocorrência, entretanto, no Brasil, é comumente citada nos levantamentos de ornitólogos, mas não existem informações disponíveis sobre seu ciclo de vida. Esse trabalho objetiva contribuir para o conhecimento da biologia reprodutiva dessa espécie no litoral catarinense. As amostragens foram realizadas nos anos de 2000 a 2002 na Ilha dos Pássaros e de 2002 na Ilha dos Lobos, Santa Catarina. As maiores abundâncias de exemplares e ninhos com ovos ocorreram em outubro, sendo que o comprimento médio dos ovos variou entre 5,02 ± 0,23 a 5,07 ± 0,21 cm e o volume 31,71 ± 2,64 a 35,92 ± 3,47 cm³ e as maiores freqüências de filhotes em novembro, culminando o abandono da colônia em meados de janeiro. Foram identificados sete itens nos regurgitos dos filhotes, sendo que os peixes marinhos representaram 44,4% da massa total. O principal predador na colônia foi o urubu-comum, que atuou sobre os ovos no início da temporada e os filhotes no final.The black-crowned night heron N. nycticorax (Linnaeus, 1758 is a aquatic bird with twilight and night habits, with wide geographical distribution. His reproductive biology has been studied intensively at the occurrence countries, however, in Brazil, it is mentioned commonly in the ornithologists' risings, but available information don't exist on his life cycle. This work aims to contribute for the knowledge of the reproductive biology of that species in the Santa Catarina coast. The samplings were accomplished in the years from 2000 to 2002 in the Ilha dos Pássaros and of 2002 in the Ilha dos Lobos, Santa Catarina. The largest abundances of individuals and nests with eggs happened in October, and the medium length of the eggs varied between 5.02 ± 0.23 to 5.07 ± 0.21 cm and the volume 31

  18. Níveis de mercúrio total em peixes de água doce de pisciculturas paulistas Mercury levels in freshwater fishes from piscicultures estabilished in São Paulo State

    Directory of Open Access Journals (Sweden)

    Marcelo A. Morgano


    Full Text Available Avaliou-se os níveis de mercúrio total em amostras de peixes de água doce, procedentes de pesqueiros e pisciculturas de 39 regiões do estado de São Paulo. As espécies de peixes estudadas foram: pacu (Piaractus mesopotamicus, tilápia (Oreochromis niloticus, piauçu (Leoporinum sp, matrinxã (Brycon cephalus, tambaqui (Colossoma macropomum e carpa (Cyprinus carpis. Foram avaliadas três metodologias de digestão de amostras para a determinação de mercúrio total, variando-se o volume de mistura sulfonítrica utilizada e a concentração do permanganato de potássio, sendo que o uso de 10mL de mistura sulfonítrica e solução de permanganato de potássio a 7% (m/v na digestão da amostra foi a que forneceu as recuperações mais altas (96%, precisão de 1% e limite de quantificação de 0,3µg/kg. Após a validação do método, foram realizadas as determinações de teor de mercúrio total em 293 amostras de pescado, usando a técnica de espectrometria de emissão com fonte de plasma acoplado em gerador de hidretos. Os níveis médios de mercúrio encontrados variaram entre: tambaqui (0,0003-0,012mg/kg, carpa (0,063mg/kg, matrinxã (0,0003-0,074mg/kg, pacu (0,0003-0,078mg/kg, piauçu (0,0003-0,183mg/kg e tilápia (0,0003-0,217mg/kg. Os resultados mostraram que nenhuma das amostras procedentes das diferentes regiões e diferentes pesque-pagues, apresentaram níveis de mercúrio total acima do permitido pela legislação brasileira, que é de 0,5mg/kg para pescado não-predador.In this work, the levels of mercury were evaluated in samples of freshwater fish, coming from fishing-grounds and piscicultures of 39 regions of São Paulo State. The species of fish studied were: pacu (Piaractus mesopotamicus, tilápia (Oreochromis niloticus, piauçu (Leoporinum sp, matrinxã (Brycon cephalus, tambaqui (Colossoma macropomum and carpa (Cyprinus carpis. Three digestion methodologies of sample were evaluated for the mercury determination, with

  19. Feeding ecology of Lutjanus analis (Teleostei: Lutjanidae from Abrolhos Bank, Eastern Brazil

    Directory of Open Access Journals (Sweden)

    Matheus Oliveira Freitas


    é o menor nível taxonômico possível e avaliados através dos métodos de frequência de ocorrência e volumétrico. Variações no consumo das presas foram avaliadas através do método de escalonamento multidimensional não-métrico e métodos de análise de similaridade e percentagem de similaridade. Diferenças significativas na dieta foram observadas entre as classes de tamanho, porém estas não foram detectadas entre as estações do ano. Considerando as classes de tamanho, os itens consumidos apresentaram importantes variações: os juvenis (50,1 cm CT consumiram basicamente peixes, principalmente Anguiliformes. Lutjanus analis é um importante predador recifal generalista, que consome um amplo espectro de presas, apresentando mudanças ontogênicas na dieta. Esse lutjanídeo desempenha um importante papel na ecologia trófica dos recifes de corais do Banco dos Abrolhos.

  20. Diet of the ichthyofauna associated with marginal vegetation of a mangrove forest in southeastern Brazil Dieta da ictiofauna associada à vegetação marginal de um mangue no sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Michéle de O. D. A. Corrêa


    vegetal e cinco de origem animal. Os crustáceos predominaram na dieta da maioria das espécies, seja na forma de fragmentos não identificados ou discriminados em oito grupos. O predomínio de espécies utilizando essencialmente uma única fonte alimentar (crustáceos, principalmente Ostracoda e Tanaidacea e a existência de variação sazonal na dieta de algumas espécies ficaram bem evidentes na análise de amplitude do nicho alimentar, com um predomínio de espécies especialistas. No mangue do Rio da Fazenda, a vegetação marginal submersa foi utilizada pela ictiofauna como local de forrageamento e, principalmente, como cobertura para espécies que buscavam alimento no substrato do fundo. Estas espécies podem estar utilizando a vegetação como proteção contra predadores aéreos e aquáticos, ou mesmo contra o arraste no período de mudança das marés. Na área de estudo, a grande diversidade de crustáceos constituiu uma importante fonte de alimento para a maioria das espécies, as quais ajustaram sua dieta em função de variações sazonais na oferta e em função das interações com outras espécies.

  1. Effect of Carbon dioxide (CO2 on mortality and reproduction of Anagasta kuehniella (Zeller 1879, in mass rearing, aiming at the production of Trichogramma spp.

    Directory of Open Access Journals (Sweden)



    Full Text Available Eggs of Anagasta kuehniella (Zeller 1879 are widely used for mass rearing of Trichogramma spp. and other parasitoids and predators, largely commercialized in many countries. The aim of this study is to evaluate the effect of carbon dioxide (CO2 originated from larval metabolism on the biological parameters of A. kuehniella. For that purpose, we assess the production of carbon dioxide (CO2 per rearing tray of A. kuehniella and the effect of CO2 on the viability of egg-to-adult period and oviposition of A. kuehniella. Results allow to estimate that a rearing tray, containing 10,000 larvae between the 4th and 5th instars, produces an average of 30.67 mL of CO2 per hour. The highest egg production of A. kuehniella was obtained when the larvae were kept in rooms with lower concentration of CO2 (1,200 parts per million - ppm, producing 23% more eggs than in rooms with higher CO2 concentrations. In rooms with high density of trays (70 trays/room, CO2 concentration exceeded 4,400 ppm. The viability of the egg-to-adult period was not influenced by carbon dioxide.Ovos de Anagasta kuehniella (Zeller, 1879 são muito utilizados para a criação massal de Trichogramma spp. e de outros parasitóides e predadores, sendo comercializados em muitos países. O objetivo deste trabalho foi avaliar o efeito do dióxido de carbono (CO2, proveniente do metabolismo larval, em parâmetros biológicos de A. kuehniella, principalmente na postura. Para que este objetivo fosse atingido, foram avaliados a produção de dióxido de carbono (CO2 por bandeja de criação de A. kuehniella e o efeito do CO2 na viabilidade do período ovo-adulto e na postura de A. kuehniella. Por meio dos resultados obtidos pôde-se estimar que uma bandeja de criação, com lagartas entre o 4° e 5° ínstares, inoculada com 10.000 lagartas produz, em média, 30,67 ml de CO2 por hora. A maior produção de ovos de A. kuehniella foi obtida quando as lagartas foram mantidas em salas com concentra

  2. Capacidade Predatória de Euborellia annulipes (Lucas, 1847 sobre Spodoptera frugiperda (Smith, 1797 = Predatory Capacity of Euborellia annulipes (Lucas, 1847 on Spodoptera frugiperda (Smith, 1797

    Directory of Open Access Journals (Sweden)

    Aldeni Barbosa da Silva


    Full Text Available Estudou-se a Capacidade Predatória de Euborellia annulipes sobre Spodoptera frugiperda em laboratório. O estudo foi conduzido no Laboratório de Entomologia do Setor de Fitossanidade da Universidade Federal da Paraíba (UFPB à temperatura de 25 ± 1ºC, umidade relativa de 70 + 10% e fotofase de 12h. Notou-se consumo crescente de ovos,podendo ser observado consumo diário médio de 11,06, 49,02, 122,7, 148,09 e 374,9 ovos, do 1° ao 5° instar, respectivamente. A capacidade predatória sobre lagartas de 1° instar de S. frugiperda aumentou de acordo com o seu desenvolvimento, com aumento de,aproximadamente, 14,3 vezes do 1° ao 5° instar, nos dez dias de consumo, sendo que, o 4° e o 5° instares apresentaram consumo diário médio de 25,5 e 26,6, respectivamente, bem superior em comparação aos demais instares; o maior consumo de lagartas de 2º instar pelopredador, ocorreu no 4º e 5º instar, que apresentaram consumo diário médio de 12,8 e 15,1, respectivamente. Verifica-se que E. annulipes demonstra ser predador potencial de ovos e lagartas de S. frugiperda, chegando um adulto a consumir 1.481,2; 89,20 e 48,6 ovos e lagartasde 1º e 2º instares, respectivamente, nos dez dias de consumo.The predatory capacity of Euborellia annulipes on Spodopterafrugiperda was studied in a laboratory setting. The study was conducted in the Laboratory of Entomology of the Division of Plant Protection, Federal University of Paraíba (UFPB at a temperature of 25 ± 1°C, relative humidity of 70 + 10% and a 12-hour photophase. Thestudy detected growing egg intake, with an average daily consumption of 11.06, 49.02, 122.7, 148.09 and 374.9 eggs, from the first to the fifth instars, respectively. A predatory capacity of fist-instar larvae of S. frugiperda increased in line with its development, with an increase of approximately 14.3 times from the first to the fifth instar, in the 10 days of consumption, whereas the fourth and fifth instars presented an

  3. Relationships between water transparency and abundance of Cynodontidae species in the Bananal floodplain, Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Cesar Enrique de Melo


    Full Text Available The Cerrado in the Central Brazil is currently one of the most threatened ecosystems in the world. As a result, the aquatic habitats in this biome also undergo great impacts. Alterations related to land-use change increase sediment loadings in rivers, streams and lakes, resulting in sedimentation and decrease in water transparency. Water transparency determines underwater visibility conditions, and as a consequence fish assemblages respond to spatial and temporal changes in this variable. This work aimed to examine the influence of transparency on the abundance and distribution of Cynodontidae species, a visually oriented predatory fish group. Fish sampling was conducted in 15 sites located between Mortes and Araguaia rivers in the Bananal floodplain, Mato Grosso State. Regression analysis between relative abundance of Cynodontidae (in number of individuals and biomass and water transparency showed a positive and highly significant correlation, indicating that this group shows species-specific habitat affinities for clearer waters. These results suggest that the increase in water turbidity in this region can affect the patterns of abundance and distribution of the Cynodontidae species, as well as other visually oriented fishes.O cerrado do Brasil Central é atualmente um dos ecossistemas mais ameaçados do mundo. Em consequência, os ambientes aquáticos desse bioma também sofrem grandes impactos. Alterações relacionadas a mudanças no uso da terra aumentam a descarga de sedimentos em rios, córregos e lagos, resultando em processos de assoreamento e diminuição da transparência da água. A transparência da água determina as condições de visibilidade subaquáticas, e em consequência os peixes respondem às variações espaciais e temporais desta variável. O objetivo deste trabalho foi verificar a influência da transparência da água na abundância e distribuição de peixes da família Cynodontidae, um grupo de peixes predadores que

  4. Chrysoperla externa (Neuroptera: Chrysopidae and Utetheisa ornatrix (Lepidoptera: Arctiidae on organically grown Crotalaria juncea (Fabaceae Chrysoperla externa (Neuroptera: Chrysopidae e Utetheisa ornatrix (Lepidoptera: Arctiidae sobre Crotalaria juncea (Fabaceae cultivada organicamente

    Directory of Open Access Journals (Sweden)

    M.A. Costa


    . externa e U. ornatrix sobre cultivo orgânico de C. juncea na EMBRAPA Milho e Sorgo, em Sete Lagoas, Minas Gerais, Brasil. Chrysoperla externa e U. ornatrix foram mais abundantes nos estádios vegetativo e de florescimento de C. juncea, respectivamente, com lagartas desse desfolhador se alimentando sobre folhas e sementes dessa planta. A duração dos estágios/estádios, sobrevivência, fecundidade de vida e oviposição mostraram que ramos de C. juncea é um alimento adequado para U. ornatrix. A abundância de adultos e larvas de C. externa foi menor nas fases de floração e vagens de C. juncea, respectivamente, quando posturas de U. ornatrix estiveram presentes, provavelmente devido à toxicidade de ovos dessa presa a esse predador. Durante esses estádios, C. externa pode ser criado com hospedeiros alternativos, e, quando cultivos de C. juncea são escassos, uma dieta artificial deve ser usada para criação desse desfolhador em laboratório, para pesquisas biológicas e desenvolvimento de táticas de controle biológico.

  5. Avaliação das comunidades de nematóides do solo em agroecossistemas orgânicos = Evaluation of nematodes communities in organic agricultural system

    Directory of Open Access Journals (Sweden)

    Eduardo Ariel Mondino


    Full Text Available Este estudo teve como objetivo avaliar os efeitos de diferentes sistemas agrícolas na comunidade de nematóides de uma área do Sistema Intergrado de Produção Agroecológica (SIPA de Seropédica, Estado do Rio de Janeiro. Os tratamentos consistiram nos seguintes cultivos: 1- abacaxi; 2-feijão; 3- consórcio milho/feijão; 4- araruta; 5- pastosujo e 6- capoeira. Os parâmetros avaliados foram: Abundância relativa, Grupos tróficos, índices de Shannon, Dominância, Equitatividade, IM, IM2-5, e a Análise faunística dos nematóides. A abundância relativa dos nematóides flutuou entre 0,02 e 0,59, o número de gêneros variou entre 4 e 14 e a riqueza acumulada foi de 21 gêneros. 79% dos nematóides encontrados foram fitófagos, 14,5% bacteriófagos, 4,7% onívoros-predadores e 1,1% micófagos. Os índices que avaliaram a comunidade de nematóides permitiram estabelecêloscomo bioindicadores da qualidade dos sistemas de cultivos. O sistema araruta apresentou as melhores condições agroecológicas devido aos valores elevados dos índices de Shannon, Equitatividade, IM, IM2-5 e altos valores de IS.This study had the objective to evaluate the effects of different agricultural systems in the community of nematodes in an area of the organic farm in Seropédica, Rio de Janeiro State. The treatments consisted of the following cultivations: 1 - pineapple; 2-bean; 3 -consortium corn/bean; 4 - araruta; 5 - pasture and 6 - capoeira. The appraised parameters were: Relative abundance, trophic group, index of Shannon, Dominance, Equitativity, MI, MI2-5, and the faunistic analysis of the nematodes. The relative abundance floated between0.02 and 0.59, the number of genus varied between 4 and 14 and the accumulated wealth it was of 21 genus. 79% of the nematodes are plant feeders, 14.5% bacterial-feeders, 4.7% omnivorous-predators and 1.1% fungal-feeders. The indices that evaluated the nematodes community allowed establishing them as bioindicators of the

  6. Reproductive success of four species of Eugenia L. (Myrtaceae Successo reprodutivo de quatro espécies de Eugenia L. (Myrtaceae

    Directory of Open Access Journals (Sweden)

    André Luiz Gomes da Silva


    Full Text Available Eugenia uniflora,E. punicifolia,E. neonitida and E. rotundifolia are perennial species, usually shrubs, which occur in the restinga of the Grumari Natural Municipal Park, in western Rio de Janeiro, Brazil. They have Papaver-type pollen-flowers that are hermaphrodite, polystemonous and pollinated mainly by bees. An assessment of the breeding systems showed that only E. uniflora and E. punicifolia are self-compatible. The fruit/flower, seed/ovule and seed/fruit ratios were calculated for each species. Fruit and seed predators were identified and predation rates were estimated. Total reproductive success for each species in the restinga was extremely low. In order to have one viable seed free from herbivore attack at the end of the reproductive process, the species would need to produce 312.5 E. uniflora, 9090.9 E. neonitida, 11111.1 E. punicifolia and 19230.8 E. rotundifolia flowers. In short, the reproductive success of the four species is affected by pollination efficiency, low seed/ ovule ratios and mainly, high predation rates. Mass flowering strategy in these species can minimize low reproductive efficiency, thus ensuring the maintenance of population dynamics.Eugenia uniflora, E. punicifolia,E. neonitida e E. rotundifolia são espécies perenes, geralmente de porte arbustivo, que ocorrem na restinga do Parque Municipal Natural de Grumari, região oeste do Município do Rio de Janeiro, Brasil. Possuem flores-pólen do tipo Papaver, hermafroditas, polistêmones e polinizadas por abelhas. O sistema reprodutivo de cada espécie foi avaliado e os resultados mostraram que apenas E. uniflora e E. punicifolia são auto-compatíveis. De cada espécie foi avaliado o sistema de reprodução, as taxas fruto/flor, semente/óvulo e semente/fruto, além das taxas de predação de frutos e sementes e identificação dos seus agentes predadores. Com estes dados foram obtidos a taxa de fecundidade e o sucesso reprodutivo total de cada espécie. O sucesso

  7. Aspectos biológicos de Chrysoperla raimundoi Freitas & Penny (Neuroptera, Chrysopidae Biological aspects of Chrysoperla raimundoi Freitas & Penny (Neuroptera, Chrysopidae

    Directory of Open Access Journals (Sweden)

    Taís Carmona Lavagnini


    Full Text Available Os crisopídeos são importantes predadores e são encontrados em diversos agroecossistemas. A temperatura é um dos fatores determinantes para o desenvolvimento dos insetos, sendo que existe um gradiente de variação aceitável para cada espécie. Portanto, objetivou-se com este estudo verificar a influência de diferentes temperaturas sobre o desenvolvimento embrionário e pós-embrionário de C. raimundoi assim como verificar as conseqüências nas diferentes gerações. As fases jovens foram criadas em três ambientes com temperaturas constantes de 19,0, 25,0 e 31,0ºC e em um ambiente externo sem controle dos fatores abióticos. Foram observados a duração do período embrionário, do primeiro, segundo e terceiro ínstares, a duração do período larval, pupal e ovo-adulto, assim como, a sobrevivência em cada estágio, estádio e a porcentagem de emergência. O desenvolvimento embrionário e pós-embrionário diferiu entre as gerações F2 e F4. Quanto à influência de diferentes temperaturas para a geração F2, os indivíduos criados a 31,0ºC demonstraram redução na taxa de desenvolvimento com relação aos outros dois ambientes. Para a geração F4, observou-se que as diferentes temperaturas influenciaram no desenvolvimento, sendo que a 19,0ºC houve prolongamento do mesmo.The green lacewings are important predators and are found in several agroecosystems. The temperature is one of the decisive factors for the development of insects, and there is an acceptable variation gradient for each species. Therefore, the purpose of this study was not only to check the influence of different temperatures on the embryonic and post-embryonic development of Chrysoperla raimundoi, as well as check the consequences in the different generations. The immature stages were reared at four different environmental conditions, three of them with constant temperatures (19,0, 25,0 e 31,0ºC and the fourth rearing place was external to the laboratory

  8. Un modelo trófico preliminar del ecosistema pelágico del norte de Chile (18°20’S-24°00’S A preliminary trophic model of the pelagic ecosystem in northern Chile (18°20’S-24°00’S

    Directory of Open Access Journals (Sweden)

    Marianela Medina


    Full Text Available Se construye un modelo ecotrófico con balance de masa para cuantificar los flujos de energía/materia e interacciones tróficas en la trama trófica del ecosistema pelágico del norte de Chile, en el año 1989. El modelo incluye 13 grupos funcionales, siendo la mayoría de ellos recursos pesqueros, aunque considera especies de la fauna acompañante de la pesquería industrial de cerco, fitoplancton, zooplancton, detritos y predadores tope. Se utiliza el modelo y paquete computacional Ecopath con Ecosim versión 5.1. Los parámetros de entrada para el área de estudio (18°20’S a 24°00’S y desde la costa hasta 60 mn al oeste, equivalente a 35.000 km² se obtuvieron desde literatura especializada y desde otros modelos aplicados a ecosistemas de surgencia. Los resultados indican que los flujos totales, que son una estimación del tamaño del ecosistema, alcanzan a 38.674 ton·km-2·año-1, mientras que la producción primaria estimada se calcula en 13.452 ton·km-2·año-1. El nivel trófico promedio de la pesquería del norte de Chile fue de 2,7, lo que refleja que las capturas se sostienen en especies de niveles trófico bajo, principalmente sardina (Sardinops sagax. La eficiencia de transferencia media de energía fue de 9,8%, valor que está dentro del rango característico de 10% calculado para ecosistemas marinos. Este ecosistema puede caracterizarse como un sistema que está alejado de la madurez, baja eficiencia de transferencia de energía, cadenas tróficas cortas y un bajo reciclaje de materia, lo que es consistente con lo informado para los principales ecosistemas de surgencias del mundoAn ecotrophic model was constructed to assess energy flows in the pelagic food web off northern Chile (18º20’S - 24º00’S; from the coast to 60 nm west; encompassing 35,000 km² in 1989. Required input parameters were obtained from the literature and other models applied to upwelling ecosystems. The model considered 13 functional groups

  9. Colonização de Pomacea haustrum (Reeve, 1856 em localidade com esquistossomose mansoni: Baldim, MG (Brasil. (Prosobranchia, Pilidae Colonization of Pomacea haustrum (Reeve, 1856 at localility with Schistosomiasis mansoni: Baldim, MG (Brazil

    Directory of Open Access Journals (Sweden)

    Roberto Milward-de-Andrade


    Full Text Available Na localidade de Baldim, MG, Brasil, foram introduzidos, em agosto de 1972, 5.421 exemplares de Pomacea haustrum (Prosobranchia, Pilidae em 5 córregos e 2 valas, nos quais predominavam Biomphalaria glabrata (Say, 1818 e, secundariamente, B. straminea (Dunker, 1848. Entre 1968 e 1971, os índices de infecção da espécie B. glabrata por Schistosoma mansoni oscilaram de 2,1% a 11,9%. Em nenhum momento foram capturados B. straminea liberando cercárias daquele trematódeo. Após a introdução do pilídeo, apenas uma única vez detectou-se 2 (0,8% B. glabrata positivas. Observou-se decréscimo populacional de planorbineos e aumento de densidade de pomácea até 20,0 e 121,6 exemplares/m² em córregos e valas, respectivamente. A estimativa da densidade de F. haustrum foi feita através do método dos "quadrats". Foram coletados, de junho de 1968 a julho de 1972, 65,2% (1.526 dos planorbíneos. Porém, após a introdução do predador-competidor, foram registrados os seguintes dados: 1976, 15% (352; em 1977, 16,1% (377 e, em 1978, apenas 3,7% (87 do total dos exemplares capturados. As pomáceas, transferidas do ambiente lenítico (Sete Lagoas, MG, adaptaram-se às coleções lóticas de Baldim e foram capazes de substituir as populações originais de B. glabrata em vários biótopos, ou tornaram-se, pelo menos, dominantes, sem danos visíveis para os novos ecossistemas. Acredita-se que em outras situações análogas, Pomacea haustrum (Reeve, 1956 - e, por extensão, P. lineata (Spix, 1827, P. canaliculata (Lamark, 1822 e outras do mesmo táxon - poderão ser utilizadas, com sucesso, no controle biológico dos hospedeiros intermediários de Schistosoma mansoni.In the region of Baldim, MG (Brazil - a well-known Schistosoma mansoni endemic area where transmission control had already been unsuccessfully attempted through molluscicide, sanitary education and clinical treatment - 5,421 specimens of Pomacea haustrum (Prosobranchia, Pilidae were

  10. Spatial and temporal dynamics of coffee-leaf-miner and predatory wasps in organic coffee field in formation Dinâmica espacial e temporal do bicho-mineiro do cafeeiro e da vespa predadora em plantação de café orgânico em formação

    Directory of Open Access Journals (Sweden)

    João Domingos Scalon


    café são suscetíveis ao ataque de mais de 850 tipos de fungos e insetos. Entre essas pragas, a mais importante em todo Brasil é o bicho mineiro do cafeeiro [Leucoptera coffeella (Guérin-Mèneville & Perrottet, 1842 (Lepidoptera: Lyonetiidae]. Estima-se que a perda no rendimento devido à infestação do bicho mineiro pode chegar a 80% em plantações onde não existe controle da praga. Embora o controle químico seja eficaz para combatê-la, ele acarreta um aumento no custo da produção e constitui um risco para o meio ambiente. O conhecimento da dinâmica espacial-temporal do bicho-mineiro e da vespa predadora (Hymenoptera: Vespidae pode fornecer informações valiosas para o controle biológico da praga. Uma maneira de investigar o sincronismo espacial-temporal entre presa e predador é calcular algum índice para análise de completa aleatoriedade espacial e compará-lo ao longo do tempo. Este artigo sugere o uso do índice de Morisita, juntamente com o método bootstrap, em uma sequência temporal para caracterizar a dinâmica espacial-temporal do bicho-mineiro e da vespa predadora em um hectare de uma plantação orgânica de café. Os resultados revelaram que o bicho-mineiro e a vespa predadora apresentaram um comportamento sazonal com um sincronismo temporal. Além disso, observou-se que minas novas e predadas apresentavam agrupamentos durante a estação mais seca do ano. Existem poucas evidências de interação espaço-temporal entre minas predadas e vespas predadoras.

  11. Acaricidas utilizados na citricultura convencional e orgânica: manejo da leprose e populações de ácaros fitoseídeos

    Directory of Open Access Journals (Sweden)

    Daniel Júnior de Andrade


    Full Text Available O controle da leprose dos citros no Estado de São Paulo é realizado quase que exclusivamente com aplicações de acaricidas para o controle do ácaro vetor Brevipalpus phoenicis, as quais contribuem para o aumento dos custos de produção e podem afetar negativamente as populações de organismos benéficos. Portanto, o objetivo do trabalho foi avaliar, durante quatro safras, os efeitos de acaricidas indicados para o controle do ácaro B. phoenicis em citros convencional e orgânico sobre a evolução da leprose dos citros e sobre ácaros fitoseídeos. O experimento foi instalado em outubro de 2003, em pomar de laranja localizado no município de Reginópolis-SP. O delineamento experimental foi em blocos casualizados, estabelecendo-se os tratamentos, expressos em mL de p.c./100 L de água: spirodiclofen a 20 mL e cyhexatin a 50 mL (aplicados em rotação, calda sulfocálcica a 4.000 mL e testemunha sem aplicação de acaricidas. Entretanto, a rotação entre spirodiclofen e cyhexatin iniciou-se em setembro de 2006 e, anteriormente a esse período, utilizou-se somente o spirodiclofen. A cada quinze dias, foram realizados levantamentos populacionais do ácaro B. phoenicis e dos ácaros predadores Iphiseiodes zuluagai e os do gênero Euseius. O nível de controle adotado para o B. phoenicis foi de 8,3%, sendo que as aplicações dos produtos foram realizadas com pulverizador de arrasto tratorizado munido com lanças manuais. Na safra de 2007-2008, coletaram-se 10 frutos caídos devido à leprose por parcela e quantificou-se o número de lesões de leprose presentes em cada fruto. Avaliaram-se, ao término da safra de 2007-2008, a produtividade, as perdas devido à leprose, bem como a incidência e a severidade da leprose. Constatou-se que o local das lesões no fruto é mais importante para determinar sua queda do que o número de lesões presentes. Quanto mais intensa a infestação do ácaro B. phoenicis, maior é o número de lesões de

  12. Evaluación de la actividad entomopatogénica de hongos obtenidos del Páramo de Guerrero (Finca Puente de Tierra Zipaquirá, Colombia

    Directory of Open Access Journals (Sweden)

    Sánchez Nieves Jimena


    Full Text Available El estudio y conservación de enemigos naturales en agroecosistemas conlleva a largo plazo a la regulación de
    insectos plaga, proporcionando un ambiente apropiado para incrementar la abundancia y eficacia de predadores
    y parásitos. El control biológico constituye una estrategia efectiva dentro de programas de manejo integrado de plagas y enfermedades (MIPE, garantizando control a bajo costo y con un mínimo o inexistente impacto ambiental. El objetivo del presente estudio fue aislar, determinar y evaluar la actividad entomopatógena de hongos obtenidos de suelos (en dos profundidades: 0-20 y 20-40 cm de bosque, cultivos de papa y zonas de descanso, en la finca Puente de Tierra, páramo de Guerrero; utilizando larvas de Galleria mellonella (insecto cebo para su aislamiento y adultos de Tecia solanivora (Povolny para los bioensayos de actividad, calculando tiempos de letalidad 50 y 90. La mayoría de los aislamientos de hongos patógenos y no patógenos se obtuvieron a partir del bosque (no intervenido, en la profundidad de 0-20 cm. En el bioensayo, se observaron resultados positivos para los géneros Fusarium, Paecilomyces y Cordyceps, los cuales son ampliamente reconocidos como entomopatógenos (Lacey, 1997, confirmando su potencial como controladores biológicos de plagas asociadas a cultivos de papa en la zona de estudio. El cultivo de papa involucra prácticas agrícolas y de manejo postcosecha dentro de las cuales, esta involucrado el uso de plaguicidas , el cual representa casi el 20% de los costos totales de la producción del cultivo, siendo por tradición la principal alternativa de control ante los problemas fitosanitarios (Rodríguez, 1996. No obstante, el empleo simultáneo de estrategias de
    control biológico es de gran importancia dentro del contexto de MIPE. Los hongos juegan un papel muy importante en la regulación de poblaciones de insectos, debido a que existen algunos con gran potencial para el control de

  13. Populações de aranhas errantes do gênero Ctenus em fragmentos florestais na Amazônia Central Populations of Ctenus wandering spiders in Amazonian forest fragments

    Directory of Open Access Journals (Sweden)

    Luiz Augusto Macedo Mestre


    Full Text Available Ctenus é um gênero de aranhas errantes abundante em florestas tropicais da América do Sul e da África e está se tornando um organismo modelo para compreensão da biologia de predadores na fauna de serapilheira. Avaliamos os efeitos da fragmentação florestal sobre quatro espécies de aranhas errantes do gênero Ctenus (C. amphora, C. crulsi, C. manauara e C. villasboasi, baseado nas variações das densidades e nos tamanhos de adultos em fragmentos de tamanhos diferentes, nas bordas destes e nas florestas secundárias próximas. Este estudo foi realizado de fevereiro a julho de 1999, em floresta tropical úmida de terra firme ao norte de Manaus - AM. As áreas incluíram três locais de mata secundária, quatro fragmentos de 1 ha, três de 10 ha, dois de 100 ha e quatro reservas em floresta contínua (maior que 10.000 ha. As aranhas foram capturadas manualmente, mensuradas e contadas em transectos de 250x5 m ou 500x5 m em áreas de platô, no interior e nas bordas dos fragmentos. Houve predomínio significativo de fêmeas em duas espécies (C. amphora- 74% e C. crulsi- 65%; dimorfismo sexual de tamanho em três espécies (C. amphora, C. crulsi e C. manauara e variação temporal da abundância significativa para as quatro espécies. Estes resultados corroboraram e complementaram tendências de estudos anteriores e permitem uma interpretação mais completa sobre a ecologia destas espécies. Não observamos diferenças de abundância das aranhas entre centro e bordas e entre reservas de diferentes tamanhos. O efeito de borda ou do tamanho do fragmento sobre o tamanho de aranhas Ctenus neste estudo foi bem menor que as variações anteriormente observadas entre habitats diferentes no interior da floresta. Comparações com um estudo posterior a este, mostram que efeito da fragmentação nesta escala sobre estas aranhas diminui com a regeneração da floresta ao redor dos fragmentos, indicando uma rápida resposta do grupo para estas modifica

  14. Feeding ecology of stream-dwelling fishes from a coastal stream in the Southeast of Brazil

    Directory of Open Access Journals (Sweden)

    Rosana Mazzoni


    ência alimentar ao longo do desenvolvimento ontogenético e alternaram entre onívoros / carnívoros para onívoros / herbívoros e entre onívoros / carnívoros para onívoros, respectivamente; essas alterações foram acompanhadas por alterações ontogenéticas do Coeficiente Intestinal (CI. Não foram registradas diferenças relacionadas à ontogenia tanto para o CI como para as categorias de alimento consumidas por Hoplias malabaricus mas, dentro da categoria animal, foram observadas diferenças significativas para o tamanho das presas consumidas, bem como correlação positiva entre o tamanho do peixe (predador e o tamanho da presa. Foi ainda observado que os itens alimentares (dentro da categoria animal consumidos pelos adultos de Pimelodella lateristriga foram principalmente baseados em artrópodes alóctones, enquanto os jovens consumiram na mesma intensidade artrópodes alóctones e autóctones; tanto os jovens como os adultos de Mimagoniates microlepis se alimentaram principalmente de artrópodes alóctones. Os valores médios do CI de P. lateristriga e M. microlepis não variaram ao longo do crescimento do corpo. Apesar do consumo das diferentes categorias tróficas não ter sido registrado para todas as espécies estudadas, as alterações da estratégia de exploração dos recursos foi a regra entre essas espécies, exceto para M. microlepis. Dessa forma, sugerimos que M. microlepis é uma espécie conservadora, no que se refere a estratégia de forrageamento e que as alterações nas estratégias tróficas das outras quatro espécies podem ser explicadas pelas alterações morfológicas e maturacionais, particularmente pela habilidade na capacidade exploratória e/ou locomotora.

  15. Caracterização morfológica e classificação da superfície foliar de pimentas quanto à presença de tricomas e domácias Morphological characterization and surface classification of chili pepper leaves considering trichomes and domatia

    Directory of Open Access Journals (Sweden)

    Cláudia Helena C Matos


    Full Text Available O conhecimento das características morfológicas das plantas é de grande relevância para o estudo das interações entre plantas, herbívoros e inimigos naturais. Variações nessas características são determinantes na ocorrência, abundância e diversidade de organismos que exploram esse habitat. Caracterizou-se a superfície foliar de quatro espécies de pimentas do gênero Capsicum e elaborou-se uma proposta de classificação das folhas com base nos critérios de presença ou ausência, densidade e distribuição de tricomas para domácias, visando a utilização dessas informações em estudos de resistência de plantas a artrópodes. A contagem dos tricomas foi feita em uma área de 5 cm²,no terço médio das folhas, sendo contabilizados os tricomas do limbo, das nervuras e das domácias. As espécies de pimenta diferiram significativamente quanto à densidade de domácias e tricomas presentes na nervura e no limbo de suas folhas. Também foi observada diferença significativa na densidade total de tricomas/cm² e no número de tricomas por domácia. Das quatro espécies de pimenta avaliadas, apenas C. baccatum var. pendulum (pimenta com ardume variedade dedo-de-moça não possui domácias nem tricomas em qualquer região de suas folhas. A maior densidade de domácias foi observada em C. baccatum var. praetermissum, espécie em que se observou as maiores densidades de tricomas em todas as regiões da folha e a única com densidade significativa de tricomas no limbo. As variações quanto à presença, distribuição e densidade de tricomas e domácias podem ser determinantes na ocorrência de ácaros predadores e fitófagos nas plantas. Com base na caracterização efetuada foi proposta uma escala de classificação da superfície foliar das plantas, variando de 1 a 5, em função do número e da densidade de tricomas e domácias observados.The knowledge of morphological characteristics of plant leaves is important to study the

  16. Testing the ecomorphological hypothesis in a headwater riffles fish assemblage of the rio São Francisco, southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Lilian Casatti


    ecological data about the analyzed fish species in their natural environment seems to be strong evidence in favor of the proposed predictive capabilities of the ecomorphological hypothesis.A ecomorfologia de 14 espécies de peixes residentes em um trecho de corredeiras do curso superior do rio São Francisco, sudeste do Brasil, foi analisada e combinada com dados de comportamento alimentar e dieta, previamente obtidos por nós. Os três principais agrupamentos ecomorfológicos de espécies identificados refletem a ocupação espacial de micro-hábitats da seguinte forma: a caracídeos nectônicos com corpos comprimidos, olhos laterais e nadadeiras peitorais laterais, com hábitos noturnos e oportunistas alimentares (Astyanax rivularis, Bryconamericus stramineus e Bryconamericus sp.; b nectobentônicos com corpos fusiformes e nadadeiras peitorais expandidas, que incluem os caracidiíneos predadores de espreita que se alimentam principalmente de larvas aquáticas bentônicas de insetos (Characidium fasciatum e Characidium zebra, parodontídeos pastadores de epilíton (Apareiodon ibitiensis e Parodon hilarii e bagres especuladores de substratos que se alimentam principalmente de larvas aquáticas de insetos (Cetopsorhamdia iheringi, Imparfinis minutus, Rhamdia quelen e Trichomycterus sp.; c bentônicos com corpos deprimidos, lábios modificados em discos orais suctorias, olhos dorsais e nadadeiras peitorais amplas, representados pelos cascudos perifitívoros (Hisonotus sp., Harttia sp. e Hypostomus garmani. Correlação entre dieta e morfologia geral não foi significative em nossa análise, a não ser quando o conjunto analisado incluiu apenas as espécies nectônicas e bentônicas, indicando que a ausência de correlação entre esses fatores é mais pronunciada no grupo de espécies nectobentônicas. A constatação do caso ineqüívoco de convergência morfológica entre os Characidiinae e Parodontidae nectobentônicos é um claro exemplo de como a integração da informa

  17. Liquidambar para produção de madeira no sul e sudeste do Brasil Sweetgum for wood production in the South and Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Jarbas Yukio Shimizu


    Full Text Available O liquidambar é uma espécie de ampla distribuição natural, abrangendo as regiões leste e sudeste dos  Estados Unidos, avançando para o sul, pelo México, até América Central. As propriedades medicinais de sua seiva são conhecidas desde a época da civilização Azteca. Nos Estados Unidos, esta é a espécie folhosa de maior área plantada para fins de produção de  madeira. Ela cresce bem em diversos tipos de solo,  inclusive em aluviões sujeitos a inundações. Uma  conseqüência da extensão da sua área de distribuição  natural é a ampla variação nos caracteres fenológicos e de crescimento observada em plantios. As procedências mais do norte tendem a cessar os  processos de crescimento mais cedo e a iniciar mais tardiamente do que as do sul. Essas variações refletem, diretamente, no padrão de crescimento entre as diferentes origens  da semente. Experimentos em vários sítios têm  demonstrado o seu alto potencial para produção de  madeira nas pequenas propriedades rurais brasileiras.  As procedências mais do sul (América Central  demonstraram maior produtividade do que as da  América do Norte; as procedências mais promissoras  apresentaram produtividade semelhante à dos  eucaliptos de rápido crescimento, da ordem de 40  m3/ha.ano. Sua madeira é indicada para múltiplos  usos como matéria-prima para celulose, dormentes,  madeira serrada para embalagens, estrados, móveis e até como lenha. Porém, um de seus usos mais  valorizados é o na produção de lâminas para chapas compensadas. No entanto, o seu cultivo deve ser acompanhado de cuidados especiais devido à natureza  invasiva desta espécie. No Brasil, ela produz grande  quantidade de semente, com grande probabilidade de germinar e se estabelecer espontaneamente no  terreno. Um fator decisivo para esta ameaça é a  ausência de predadores naturais como pássaros e  roedores que, na sua área de ocorrência natural,  coexistem em

  18. Caracterización de la meso y macrofauna edáfica en sistemas de cultivo del Sudeste Bonaerense Characterization of the meso and macrofauna of a Southeastern Buenos Aires province soil under different cropping systems

    Directory of Open Access Journals (Sweden)

    Antonio H Gizzi


    Full Text Available Los objetivos de este estudio fueron: i. determinar la composición taxonómica y la abundancia relativa de la meso y macrofauna y de sus grupos tróficos en suelos del sudeste de la provincia de Buenos Aires, ii. evaluar la densidad de los organismos que integran dichas comunidades y iii. estudiar el efecto de los sistemas de cultivo (combinación entre sistema de labranza y rotación y la fertilización sobre la meso y macrofauna. Se utilizaron cuatro sistemas de cultivo: LC50 [(50% pastura - 50% agricultura bajo labranza convencional (LC], SD50 [(50% pastura - 50% agricultura bajo siembra directa (SD], LC75 (25% pastura - 75% agricultura bajo LC, SD75 (25% pastura - 75% agricultura bajo SD y cuatro dosis de fertilización nitrogenada (0, 60, 120 y 180 kg de N ha-1. En el año 2000, en LC50 y en SD50 se sembró una pastura (P, la que en 2001 tenía un año de implantada. En el 2000, en LC75 y en SD75 se sembró maíz y en el 2001, soja. Dentro de la mesofauna, la mayoría de los individuos fueron enquitreidos, que en el primer año no presentaron diferencias entre LC y SD, mientras que en el segundo, los mayores porcentajes se observaron en P cuando ésta tenía más de un año de implantada. En la macrofauna predominaron oligoquetos megadrilos, isópodos y miriápodos y en P en ambos años los isópodos y miriápodos fueron dominantes. En el primer año, las densidades de la meso y macrofauna no mostraron diferencias significativas (p>0,003 entre sistemas de cultivo, sin embargo, fueron mayores en los cultivos bajo SD. En el segundo año, las densidades fueron significativamente mayores (p0,003 entre los sistemas de cultivo y las dosis de fertilización. A pesar de no haberse observado diferencias significativas (p>0,003 entre los sistemas en el primer año, los cuatro grupos fueron más abundantes en P y SD que en LC. En el segundo año, los detritívoros, los predadores y los omnívoros fueron significativamente más abundantes en P que en

  19. Dieta natural do siri-azul Callinectes sapidus (Decapoda, Portunidae na região estuarina da Lagoa dos Patos, Rio Grande, Rio Grande do Sul, Brasil Natural diet of the blue crab Callinectes sapidus (Decapoda, Portunidae in the Patos Lagoon estuary area, Rio Grande, Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Alexandre Oliveir

    Full Text Available Na região estuarina da Lagoa dos Patos, o siri-azul Callinectes sapidus Rathbun, 1869 é o mais abundante dentre as espécies do gênero. Apesar do siri-azul exercer influência sobre as comunidades bentônicas, por ser considerado um predador do topo da cadeia alimentar, não existem muitos estudos sobre aspectos ecológicos, inclusive sobre a composição e variabilidade sazonal de sua dieta natural, neste estuário. O objetivo principal deste estudo foi investigar a composição da dieta do siri-azul, evidenciando possíveis relações com a comunidade bentônica da região estuarina da Lagoa dos Patos. O período de estudo foi de março de 2003 a março de 2004, com coletas bimestrais. Os organismos foram coletados com auxílio de rede de arrasto de fundo, com malha de 13 mm entre nós opostos. Ainda em campo os animais foram fixados em formol 10%. Após a coleta os animais foram separados quanto ao sexo, medidos (largura e comprimento da carapaça - cm e pesados (peso - g. Após a triagem, os animais foram dissecados e os intestinos retirados e pesados. As análises dos conteúdos alimentares dos siris demonstraram que os hábitos alimentares são diversificados, constituindo-se principalmente de invertebrados bentônicos. O item encontrado com maior freqüência foi Detrito, seguido pelo molusco filtrador Erodona mactroides Bosc, 1802 (Erodonidae. Crustáceos da classe Ostracoda e grãos de areia foram importantes componentes dos conteúdos dos intestinos anteriores, sendo que areia não foi considerada como item alimentar, propriamente dito. Também foram encontradas cerdas e mandíbulas de poliquetos, além de sementes das macrófitas Ruppia maritima L. (Potamogatonaceae e Zannichellia palustris L. (Potamogatonaceae. Este estudo serve como subsídio para medidas de proteção e conservação da população do siri-azul, bem como caracteriza relações tróficas com comunidades bentônicas do estuário da Lagoa dos Patos.The Southern

  20. Live coral predation by parrotfishes (Perciformes: Scaridae in the Abrolhos Bank, eastern Brazil, with comments on the classification of species into functional groups

    Directory of Open Access Journals (Sweden)

    Ronaldo B. Francini-Filho


    : Scaridae representam um grupo funcional crítico em recifes de corais uma vez que a intensa atividade de herbivoria que desempenham ajuda a evitar a exclusão de corais por algas. Apesar de alimentarem-se preferencialmente de algas e detrito, algumas espécies de budiões também consomem corais vivos, causando efeitos negativos aos corais, os quais podem superar os benefícios decorrentes da remoção de algas. As espécies de budiões diferem acentuadamente em sua morfologia bucal, atividade de forrageio e potencial de escavação do substrato, sendo tipicamente divididas em três grupos funcionais: podadores, raspadores e escavadores. O reconhecimento das espécies nesses grupos funcionais ajuda a entender seus efeitos relativos em termos de bioerosão, condição e sobrevivência de corais, alteração do hábitat e dinâmica do ecossistema. No presente estudo nós registramos a predação de corais vivos pelos budiões endêmicos do Brasil Scarus trispinosus e Sparisoma amplum no maior complexo coralíneo do Atlântico Sul (Banco dos Abrolhos, leste do Brasil e comentamos sobre a classificação dessas espécies em grupos funcionais com base em observações comportamentais. Scarus trispinosus e Sp. amplum alocaram 0.8% e 8.1% de suas mordidas a corais vivos respectivamente. Sparisoma amplum apresentou menores taxas alimentares, menor número de mordidas em seqüência e maior tamanho de mordidas que Sc. trispinosus. A taxa de mordidas e o número de mordidas em seqüência correlacionaram-se negativamente com o tamanho corporal para Sc. trispinosus, mas não para Sp. amplum. Nossos resultados indicam que Sp. amplum pode ser reconhecida como uma espécie primariamente escavadora, além do mais especializado budião predador de corais no Brasil, ao passo que Sc. trispinosus pode ser reconhecida como uma espécie raspadora ou escavadora, dependendo de seu tamanho corporal. Essa classificação funcional é similar àquela aplicada a suposta espécie irmã de Sc

  1. Controle de Brevipalpus phoenicis (Geijskes, 1939 E Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae em cafeeiro e o impacto sobre ácaros benéficos: I - abamectin e emamectin Control of Brevipalpus phoenicis (Geijskes, 1939 and Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae in coffee plants and the impact on beneficial mites: I - Abamectin and emamectin

    Directory of Open Access Journals (Sweden)

    Paulo Rebelles Reis


    Full Text Available O ácaro Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae é importante em cafeeiro (Coffea spp., por ser o vetor do vírus da mancha-anular, responsável por queda de folhas e má qualidade da bebida do café, e o ácaro-vermelho, Oligonychus ilicis (McGregor, 1917 (Acari: Tetranychidae, por reduzir a área foliar de fotossíntese. Alguns ácaros da família Phytoseiidae são eficientes predadores associados aos ácaros-praga. Com este trabalho teve-se como objetivo estudar o controle dos ácaros-praga e o impacto do abamectin e emamectin sobre fitoseídeos. Em laboratório, foram estudados os efeitos ovicida, tópico, residual, tópico mais residual aos ácaros-praga e a seletividade fisiológica aos fitoseídeos. Em semicampo, foi estudada a persistência dos produtos no controle dos ácaros-praga. O efeito ovicida foi avaliado em ovos no início e fim de incubação; os efeitos residual, tópico e tópico mais residual foram avaliados pela mortalidade de larvas, ninfas e adultos após 48 horas da aplicação, enquanto a persistência foi avaliada pela mortalidade até 30 dias após a pulverização. A seletividade aos ácaros fitoseídeos foi avaliada pelo efeito total às fêmeas adultas, em teste residual em superfície de vidro. Pelos resultados, verificou-se que abamectin e emamectin não possuem ação ovicida, para ambas as espécies de ácaros-praga estudadas. Considerando o efeito tópico mais residual, o abamectin e emamectin foram altamente eficientes no controle de larvas, ninfas e adultos de B. phoenicis; apenas abamectin foi eficiente no controle de O. ilicis. Abamectin foi levemente a moderadamente nocivo e emamectin mostrou-se inócuo a levemente nocivo aos fitoseídeos. Devido à eficiência de controle e seletividade a fitoseídeos, conclui-se que abamectin e emamectin podem ser utilizados em programas de manejo integrado do ácaro B. phoenicis, e abamectin para o manejo de B. phoenicis e O. ilicis em cafeeiro

  2. Indicadores de qualidade de solos de área de mineração e metalurgia de chumbo: II - Mesofauna e plantas Soil quality indicators in lead mining and metalurgy area: II - Mesofauna and plants

    Directory of Open Access Journals (Sweden)

    Yara Jurema Barros


    riqueza de grupos de organismos e ocorrência de representantes dos grupos Pseudoscorpiones, Mollusca e Isopoda apenas nesse solo. Os grupos Aracnídeos e Psocoptera também foram considerados bons indicadores ambientais, com incremento de suas populações nos solos com maiores teores de metais pesados (solos 2, 3 e 5, possivelmente devido à menor ocorrência de organismos competidores/predadores desses grupos. Os teores de metais pesados nos indivíduos do grupo Formicidae tiveram relação direta com os teores de Pb extraídos com HNO3 0,5 mol L-1 no solo. Quanto ao acúmulo de metais pesados nas plantas coletadas na área, com exceção do solo 1, todas as espécies encontravam-se sob efeito fitotóxico para Pb e Zn, o que sugere a proibição de pastejo na área.The influence of soil management or the contaminant application to the soil, usually induce to a quicker response in the soil mesofauna than in other pedogenic properties; these organisms are therefore good environmental quality indicators. The aim of this study was to identify and quantify the organisms groups of the soil mesofauna and determine Pb and Zn contents in plants in the mining and metallurgy plant in Adrianópolis (PR,to originate biological indicators of the quality of these solis. At the selected locations the following contamination forms were analized: site 1 - reference (native wood; site 2 - residue incorporated in the profile; sites 3 and 6 - close to the chimneys of the plant, with potential import of particulate matter; site 5 - great waste volume covering the soil. Berlese funnels were utilized to collect samples from the 0 to 5 cm layer (20 funnels x 5 sites x 1 layer x 4 times = 400 samples. After the separation of the mesofauna, the organisms were selected and identified. Ants samples were microwave digested with concentrated HNO3 and the Pb, Cu, Ni and Zn contents were determined by inductively coupled plasma - atomic emission Spectrometry (ICP-AES. Plants from Poaceae family were


    Directory of Open Access Journals (Sweden)



    Full Text Available Os nematoides são organismos amplamente distribuídos nos ecossistemas terrestres e aquáticos, possuindo abundante diversidade de espécies parasitas de animais, de plantas, ou simplesmente compondo a biota com consumidores de bactérias e nutrientes no meio onde se encontram. Algumas espécies de nematoides de “vida livre” que não são predadores nem parasitas podem ser facilmente mantidos ou cultivados em laboratório, possibilitando seu uso e manipulação em pesquisa. Comumente, os ensaios toxicológicos são produzidos utilizando-se organismos teste que respondam às alterações impostas ao meio, ou seja, expressam o efeito deletério por compostos químicos sintéticos. Algumas espécies utilizadas podem ser aquáticas ou terrestres, como os microcrustáceos, ouriços do mar, peixes, algas e minhocas, etc. Os nematoides de vida livre, apesar de serem organismos aquáticos vivem intimamente ligados às partículas de solo e, não há, até o momento padrões estabelecidos para que esta espécie seja utilizada em rotinas nos testes ecotoxicológicos, uma vez que possuem características essenciais típicas de bioindicadores, como o ciclo de vida curto e respostas rápidas a mudanças no ambiente. Substâncias de referência para testes toxicológicos devem apresentar meia vida longa e estável, estar disponível na forma pura, apresentar uma boa curva dose-resposta para o organismo, ser constante em solução aquosa e mostrar-se com baixo risco a saúde humana. As mais utilizadas são o Sulfato de Zinco, Sulfato de Cobre, Cloreto de Potássio, Cloreto de Cádmio, Cloreto de Sódio, Dodecil/Lauril Sulfato de Sódio e Dicromato de Potássio. Dessa forma, o objetivo deste trabalho foi avaliar a mortalidade de nematoides para selecionar compostos químicos a serem padronizados para uso como controle positivo em ensaios toxicológicos utilizando nematoides como organismos alvo. Diluições seriadas entre 0,001 e 10.000 ppm foram testadas

  4. Macrofauna edáfica em estádios sucessionais de Floresta Estacional Semidecidual e pastagem mista em Pinheiral (RJ: Rio de Janeiro State Soil macrofauna in three succession stages of a seasonal semidecidous forest and a mixed pasture in Pinheiral

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Gabriel Menezes


    Full Text Available Entre os diferentes tipos de organismos da macrofauna do solo, distribuídos em diversos tipos de habitats, com variados hábitos alimentares e ciclos de vida, alguns são capazes de responder rapidamente às alterações ambientais e, por isso, considerados bons indicadores do funcionamento dos ecossistemas. O presente trabalho teve como objetivo avaliar o efeito dos seguintes estádios sucessionais de Floresta Estacional Semidecidual Submontana do domínio ecológico da Mata Atlântica: floresta secundária estádio inicial (FSEI, floresta secundária estádio médio (FSEM, floresta secundária estádio avançado (FSEA e uma área de pasto misto manejado (PMM sobre a densidade, diversidade e composição da comunidade da macrofauna edáfica em duas épocas do ano, no município de Pinheiral (RJ. Para amostragem da macrofauna, foram retiradas oito amostras da serapilheira e da camada superficial (0-10 cm do solo pelo método recomendado pelo programa Tropical Soil Biology and Fertility (TSBF, com adaptações. Predominaram Isoptera, Formicidae e Oligochaeta em FSEI, FSEM e FSEA e Formicidae e Oligochaeta em PMM. Não houve diferença significativa na densidade da macrofauna edáfica entre as áreas. Os maiores valores dos estimadores de diversidade utilizados (equabilidade de Pielou, riqueza total e média foram encontrados em FSEA. Os valores de riqueza total mostraram aumento gradual de acordo com o estádio de sucessão, desde PMM até FSEI. Constatou-se maior número de indivíduos no solo do que na serapilheira em todas as áreas de floresta, nas duas épocas. Pela análise de componentes principais (ACP realizada para os períodos seco e chuvoso, foi possível identificar maiores diferenças na composição das comunidades entre os estádios sucessionais para o período chuvoso. Nesta época, os estádios FSEM e FSEA estiveram associados a uma maior diversidade de invertebrados saprófagos e predadores do que PMM e FSEI, demonstrando

  5. Terrestrial arthropods from tree canopies in the Pantanal of Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Marinêz Isaac Marques


    divergens Pohl (Vochysiaceae. Três indivíduos foram amostrados durante dois períodos sazonais, um durante a cheia (árvore A: fevereiro utilizando-se o método de pulverização com inseticida e dois durante a seca (árvore B: setembro, C: outubro, empregando-se a termonebulização. Um total de 15744 artrópodes (183,2±38,9 individuos/m² foram obtidos em 86m² de área representando 20 ordens taxonômicas, 87,1% Insecta e 12,9% Arachnida. O grupo dominante foi Hymenoptera (48,5%; 88,9 individuos/m², a maioria Formicidae (44,5%; 81,4 individuos/m², seguido por Coleoptera (14,0%; 25,5 individuos/m² e Araneae (10,2%; 19,5 individuos/m², que representaram 62,5% do total coletado. Com relação a freqüência, 14 de todas as ordens (70% ocorreram nas tres árvores. Dermaptera, Isoptera, Neuroptera, Odonata, Plecoptera e Trichoptera foram coletadas em uma única árvore. Foram obtidos 2197 Coleoptera adultos (25,5±11,3 indivíduos/m², sendo 99% assinalados para 32 famílias e 256 morfoespécies. Nitidulidae (17,9%; 4,6 indivíduos/m², Anobiidae (16,7%; 4,3 indivíduos/m², Curculionidae (13,2%; 3,4 indivíduos/m² e Meloidae (11,4%; 2,9 indivíduos/m² foram dominantes. Os Coleoptera adultos associados à copa de V. divergens indicam dominancia de herbívoros (37,8% do total coletado, 127 spp. e predadores (35,2%, 82 spp., seguidos por saprófagos (16,2%, 32 spp. e fungívoros (10,8%, 15 spp.. A influência do pulso de inundação sobre a comunidade de artrópodes arbóreos associados à V. divergens é indicada pela variação sazonal nos grupos avaliados, gerando mudanças em sua estrutura e composição ao longo dos períodos sazonais.

  6. Directory of Open Access Journals (Sweden)

    Michele de Faveri Gimenes


    éticas. Os peixes foram amostrados de fevereiro/2000 a março/2001 e de fevereiro/2003 a março/2004 nas lagoas Sinhá Mariana e Chacororé, Pantanal Matogrossense. Peixe foi o principal alimento, porém camarões e insetos também foram consumidos. A dieta de P. ternetzi foi significativamente diferente entre as lagoas, mas não diferiu entre os períodos de cheia e seca. Na lagoa Mariana, Psectrogaster curviventris foi a presa mais consumida em ambos os períodos. Na lagoa Chacororé, peixes dominaram a dieta (principalmente Astyanax spp., Leporinus spp. and Schizodon borellii na cheia, e camarão e Eigenmannia spp. na seca. Uma correlação de Spearman mostrou que não existe correlação entre a abundância das espécies de peixes capturadas e suas abundâncias na dieta de P. ternetzi na lagoa Mariana, e que há uma correlação negativa na lagoa Chacororé, embora algumas presas importantes na dieta tenham sido numericamente importantes nas capturas. Embora tenha consumido camarões e insetos, P. ternetzi foi piscívora desde imatura. A correlação entre os itens alimentares e as classes de tamanho de P. ternetzi (Correlação de Pearson evidenciou que as mudanças no uso do alimento durante a ontogenia estiveram associadas ao incremento no consumo de P. curviventris na lagoa Mariana, e de S. borellii na lagoa Chacororé, acompanhando o aumento de tamanho do predador. Assim, os resultados sugerem que vários fatores podem estar envolvidos no uso dos recursos alimentares por P. ternetzi, entre eles, a abundância, o tamanho e as características morfológicas das presas.

  7. Micromamíferos del Pleistoceno Superior del yacimiento de PRERESA en el valle del Manzanares y su contribución a la reconstrucción paleoambiental de la cuenca de Madrid durante el Pleistoceno

    Directory of Open Access Journals (Sweden)

    Sesé, C.


    ubica el yacimiento, excepto Cricetulus (Allocricetus bursae que se extinguió en la Península Ibérica al final del Pleistoceno Superior. Las observaciones realizadas sobre el material indican que la acumulación de restos de micromamíferos en el yacimiento es debida, en su mayor parte, a la acción de predadores, muy posiblemente a egagrópilas de aves rapaces. La asociación de micromamíferos de PRERESA indica unas condiciones de clima templado con cierta humedad y un desarrollo de la vegetación con algunas zonas boscosas y fundamentalmente áreas abiertas pero con vegetación arbustiva, herbácea, praderas secas y húmedas, y ribereña. En una comparación de los micromamíferos del yacimiento de PRERESA con los de los yacimientos del Pleistoceno Medio de Áridos 1 y Valdocarros, los datos indican que en los tramos bajos de los ríos Manzanares y Jarama hubo unas condiciones climáticas y paisajísticas similares en los momentos que representan estos yacimientos (Pleistoceno Medio avanzado y primer tercio del Pleistoceno Superior. Sin embargo, y al igual que sucede en la actualidad, estas condiciones fueron algo diferentes en el valle del Lozoya en la Sierra de Guadarrama durante el primer tercio del Pleistoceno Superior, según indica la asociación de micromamíferos de la Cueva del Camino (Pinilla del Valle, Madrid, que sugiere un clima relativamente más húmedo y un medio con una mayor variedad de biotopos. La asociación de micromamíferos del Pleistoceno Superior de PRERESA, en el tramo bajo del Manzanares, comparada con la de la Cueva del Camino que tiene una cronología similar, y con otras del Norte de Madrid del Pleistoceno Superior, pone de manifiesto según nuestras observaciones una diferenciación biogeográfica y paleoclimática ya durante este periodo entre unas y otras, de las que la zona limitante serían más o menos las estribaciones meridionales y centro-orientales del Sistema Central.

  8. Programa de Pós-Graduação em Geologia - Dissertações Defendidas 1998 - Mestrado - Instituto de Geociências - Universidade Federal do Rio de Janeiro

    Directory of Open Access Journals (Sweden)


    álise de difratometria de raios-x revelou dominância de calcita e traços de quartzo. A análise através de raios-x de fluorescência indicou composição diferente entre os elementos químicos contidos no sedimento circundante e nos coprólitos, também por este procedimento, verificou-se marcante similaridade com elementos químicos presentes nas fezes de animais atuais, caracterizando a identidade biológica do material fossilizado. A ocorrência de bioturbações produzidas por atividade coprófoga em algumas amostras está associada à deposição dos excrementos fósseis durante momentos de maior umidade neste paleoambiente. Este fato revela aspectos sobre interações tróficas da paleofauna da localidade de Pinheiros. 109 Anuário do Instituto de Geociências - UFRJ Volume 21 / 1998 O fato das diferentes formas de coprólitos corresponderem à mesma quantidade de fósseis de herbívoros (presas e carnívoros ou omnívoros (predadores sugere, assim como observado atualmente, um comportamento gregário da paleobiota, cujo mecanismo de controle do nível trófico alimentar. Provavelmente se estruturava no mesmo padrão, onde grandes manadas de herbívoros são acompanhadas por um número menos de carnívoros. Nome: Rozanda Guedes da Silva Costa Título: Complexo Geo-Ambiental do Gericinó-Mendanha e Áreas Circunvizinhas - Zona Oeste do Município do Rio de Janeiro Orientadores: Franklin dos Santos Antunes e Josilda Rodrigues da Silva de Moura Resumo: Nesta pesquisa são indicados e avaliados os impactos ambientais do maciço do Mendanha e áreas circunvizinhas na zona oeste do município do Rio de Janeiro, decorrentes da ocupação sem o planejamento o uso do solo, ocasionando degradações. Usou-se o solo, como unidade fundamental de análise integrativa da avaliação e espacialização ambiental. Sendo o geoprocessamento integrado a este estudo, pois é um instrumento importante para o monitoramento e avaliações ambientais. A integração dos mapas e as excurs