WorldWideScience

Sample records for pr pbp ds

  1. Role of Penicillin-Binding Protein 2 (PBP2) in the Antibiotic Susceptibility and Cell Wall Cross-Linking of Staphylococcus aureus: Evidence for the Cooperative Functioning of PBP2, PBP4, and PBP2A

    Science.gov (United States)

    Łęski, Tomasz A.; Tomasz, Alexander

    2005-01-01

    Ceftizoxime, a beta-lactam antibiotic with high selective affinity for penicillin-binding protein 2 (PBP2) of Staphylococcus aureus, was used to select a spontaneous resistant mutant of S. aureus strain 27s. The stable resistant mutant ZOX3 had an increased ceftizoxime MIC and a decreased affinity of its PBP2 for ceftizoxime and produced peptidoglycan in which the proportion of highly cross-linked muropeptides was reduced. The pbpB gene of ZOX3 carried a single C-to-T nucleotide substitution at nucleotide 1373, causing replacement of a proline with a leucine at amino acid residue 458 of the transpeptidase domain of the protein, close to the SFN conserved motif. Experimental proof that this point mutation was responsible for the drug-resistant phenotype, and also for the decreased PBP2 affinity and reduced cell wall cross-linking, was provided by allelic replacement experiments and site-directed mutagenesis. Disruption of pbpD, the structural gene of PBP4, in either the parental strain or the mutant caused a large decrease in the highly cross-linked muropeptide components of the cell wall and in the mutant caused a massive accumulation of muropeptide monomers as well. Disruption of pbpD also caused increased sensitivity to ceftizoxime in both the parental cells and the ZOX3 mutant, while introduction of the plasmid-borne mecA gene, the genetic determinant of the beta-lactam resistance protein PBP2A, had the opposite effects. The findings provide evidence for the cooperative functioning of two native S. aureus transpeptidases (PBP2 and PBP4) and an acquired transpeptidase (PBP2A) in staphylococcal cell wall biosynthesis and susceptibility to antimicrobial agents. PMID:15716453

  2. Co-diversification of Enterococcus faecium Core Genomes and PBP5: Evidences of pbp5 Horizontal Transfer

    Science.gov (United States)

    Novais, Carla; Tedim, Ana P.; Lanza, Val F.; Freitas, Ana R.; Silveira, Eduarda; Escada, Ricardo; Roberts, Adam P.; Al-Haroni, Mohammed; Baquero, Fernando; Peixe, Luísa; Coque, Teresa M.

    2016-01-01

    Ampicillin resistance has greatly contributed to the recent dramatic increase of a cluster of human adapted Enterococcus faecium lineages (ST17, ST18, and ST78) in hospital-based infections. Changes in the chromosomal pbp5 gene have been associated with different levels of ampicillin susceptibility, leading to protein variants (designated as PBP5 C-types to keep the nomenclature used in previous works) with diverse degrees of reduction in penicillin affinity. Our goal was to use a comparative genomics approach to evaluate the relationship between the diversity of PBP5 among E. faecium isolates of different phylogenomic groups as well as to assess the pbp5 transferability among isolates of disparate clonal lineages. The analyses of 78 selected E. faecium strains as well as published E. faecium genomes, suggested that the diversity of pbp5 mirrors the phylogenomic diversification of E. faecium. The presence of identical PBP5 C-types as well as similar pbp5 genetic environments in different E. faecium lineages and clones from quite different geographical and environmental origin was also documented and would indicate their horizontal gene transfer among E. faecium populations. This was supported by experimental assays showing transfer of large (≈180–280 kb) chromosomal genetic platforms containing pbp5 alleles, ponA (transglycosilase) and other metabolic and adaptive features, from E. faecium donor isolates to suitable E. faecium recipient strains. Mutation profile analysis of PBP5 from available genomes and strains from this study suggests that the spread of PBP5 C-types might have occurred even in the absence of a significant ampicillin resistance phenotype. In summary, genetic platforms containing pbp5 sequences were stably maintained in particular E. faecium lineages, but were also able to be transferred among E. faecium clones of different origins, emphasizing the growing risk of further spread of ampicillin resistance in this nosocomial pathogen. PMID

  3. Co-diversification of Enterococcus faecium core genomes and PBP5: evidences of pbp5 horizontal transfer

    Directory of Open Access Journals (Sweden)

    Carla Novais

    2016-10-01

    Full Text Available Ampicillin resistance has greatly contributed to the recent dramatic increase of a cluster of human adapted Enterococcus faecium lineages (ST17, ST18 and ST78 in hospital-based infections. Changes in the chromosomal pbp5 gene have been associated with different levels of ampicillin susceptibility, leading to protein variants (designated as PBP5 C-types to keep the nomenclature used in previous works with diverse degrees of reduction in penicillin affinity. Our goal was to use a comparative genomics approach to evaluate the relationship between the diversity of PBP5 among E. faecium isolates of different phylogenomic groups as well as to assess the pbp5 transferability among isolates of disparate clonal lineages. The analyses of 78 selected E. faecium strains as well as published E. faecium genomes, suggested that the diversity of pbp5 mirrors the phylogenomic diversification of E. faecium. The presence of identical PBP5 C-types as well as similar pbp5 genetic environments in different E. faecium lineages and clones from quite different geographical and environmental origin was also documented and would indicate their horizontal gene transfer among E. faecium populations. This was supported by experimental assays showing transfer of large (≈180-280 kb chromosomal genetic platforms containing pbp5 alleles, ponA (transglycosilase and other metabolic and adaptive features, from E. faecium donor isolates to suitable E. faecium recipient strains. Mutation profile analysis of PBP5 from available genomes and strains from this study suggests that the spread of PBP5 C-types might have occurred even in the absence of a significant ampicillin resistance phenotype. In summary, genetic platforms containing pbp5 sequences were stably maintained in particular E. faecium lineages, but were also able to be transferred among E. faecium clones of different origins, emphasizing the growing risk of further spread of ampicillin resistance in this nosocomial pathogen.

  4. High salt stress in Bacillus subtilis: involvement of PBP4* as a peptidoglycan hydrolase.

    Science.gov (United States)

    Palomino, María Mercedes; Sanchez-Rivas, Carmen; Ruzal, Sandra M

    2009-03-01

    The study was focused on the role of the penicillin binding protein PBP4* of Bacillus subtilis during growth in high salinity rich media. Using pbpE-lacZ fusion, we found that transcription of the pbpE gene is induced in stationary phase and by increased salinity. This increase was also corroborated at the translation level for PBP4* by western blot. Furthermore, we showed that a strain harboring gene disruption in the structural gene (pbpE) for the PBP4* endopeptidase resulted in a salt-sensitive phenotype and increased sensitivity to cell envelope active antibiotics (vancomycin, penicillin and bacitracin). Since the pbpE gene seems to be part of a two-gene operon with racX, a racX::pRV300 mutant was obtained. This mutant behaved like the wild-type strain with respect to high salt. Electron microscopy showed that high salt and mutation of pbpE resulted in cell wall defects. Whole cells or purified peptidoglycan from WT cultures grown in high salt medium showed increased autolysis and susceptibility to mutanolysin. We demonstrate through zymogram analysis that PBP4* has murein hydrolyze activity. All these results support the hypothesis that peptidoglycan is modified in response to high salt and that PBP4* contributes to this modification.

  5. HEASARC SAOImage DS9

    Data.gov (United States)

    National Aeronautics and Space Administration — SAOImage DS9 is an astronomical imaging and data visualization application. DS9 supports FITS images and binary tables, multiple frame buffers, region manipulation,...

  6. Surfactant-free purification of membrane protein complexes from bacteria: application to the staphylococcal penicillin-binding protein complex PBP2/PBP2a

    Science.gov (United States)

    Paulin, Sarah; Jamshad, Mohammed; Dafforn, Timothy R.; Garcia-Lara, Jorge; Foster, Simon J.; Galley, Nicola F.; Roper, David I.; Rosado, Helena; Taylor, Peter W.

    2014-07-01

    Surfactant-mediated removal of proteins from biomembranes invariably results in partial or complete loss of function and disassembly of multi-protein complexes. We determined the capacity of styrene-co-maleic acid (SMA) co-polymer to remove components of the cell division machinery from the membrane of drug-resistant staphylococcal cells. SMA-lipid nanoparticles solubilized FtsZ-PBP2-PBP2a complexes from intact cells, demonstrating the close physical proximity of these proteins within the lipid bilayer. Exposure of bacteria to (-)-epicatechin gallate, a polyphenolic agent that abolishes β-lactam resistance in staphylococci, disrupted the association between PBP2 and PBP2a. Thus, SMA purification provides a means to remove native integral membrane protein assemblages with minimal physical disruption and shows promise as a tool for the interrogation of molecular aspects of bacterial membrane protein structure and function.

  7. Radioiododestannylation. Convenient synthesis of a stable penicillin derivative for rapid penicillin binding protein (PBP) assay

    Energy Technology Data Exchange (ETDEWEB)

    Blaszczak, L.C.; Halligan, N.G. (Lilly (Eli) and Co., Indianapolis, IN (USA). Lilly Research Labs.); Seitz, D.E. (Indiana Univ.-Purdue Univ., Indianapolis, IN (USA). School of Medicine)

    1989-04-01

    Radioiodination of p-(trimethylstannyl)penicillin V with ({sup 125}I)Na using a modification of the chloramine-T method is simple, high yielding, and site-specific. The structure and penicillin binding protein (PBP) affinity of p-({sup 125}I)-penicillin V (IPV) are similar to penicillin G and the product can be used directly without purification in the PBP assay. Because of the high degree of stability toward autoradiolysis and equivalent PBP binding affinity, IPV can be used in place of ({sup 3}H)-penicillin G or ({sup 14}C)-penicillin G for these experiments. (author).

  8. Differential Penicillin-Binding Protein 5 (PBP5) Levels in the Enterococcus faecium Clades with Different Levels of Ampicillin Resistance.

    Science.gov (United States)

    Montealegre, Maria Camila; Roh, Jung Hyeob; Rae, Meredith; Davlieva, Milya G; Singh, Kavindra V; Shamoo, Yousif; Murray, Barbara E

    2017-01-01

    Ampicillin resistance in Enterococcus faecium is a serious concern worldwide, complicating the treatment of E. faecium infections. Penicillin-binding protein 5 (PBP5) is considered the main ampicillin resistance determinant in E. faecium The three known E. faecium clades showed sequence variations in the pbp5 gene that are associated with their ampicillin resistance phenotype; however, these changes alone do not explain the array of resistance levels observed among E. faecium clinical strains. We aimed to determine if the levels of PBP5 are differentially regulated between the E. faecium clades, with the hypothesis that variations in PBP5 levels could help account for the spectrum of ampicillin MICs seen in E. faecium We studied pbp5 mRNA levels and PBP5 protein levels as well as the genetic environment upstream of pbp5 in 16 E. faecium strains that belong to the different E. faecium clades and for which the ampicillin MICs covered a wide range. Our results found that pbp5 and PBP5 levels are increased in subclade A1 and A2 ampicillin-resistant strains compared to those in clade B and subclade A2 ampicillin-susceptible strains. Furthermore, we found evidence of major clade-associated rearrangements in the region upstream of pbp5, including large DNA fragment insertions, deletions, and single nucleotide polymorphisms, that may be associated with the differential regulation of PBP5 levels between the E. faecium clades. Overall, these findings highlight the contribution of the clade background to the regulation of PBP5 abundance and point to differences in the region upstream of pbp5 as likely contributors to the differential expression of ampicillin resistance. Copyright © 2016 American Society for Microbiology.

  9. DS/EN 1997

    DEFF Research Database (Denmark)

    Sørensen, Carsten Steen; Hansen, Per Bjerregaard; Jensen, Lars Ravn

    Dette nationale anneks omhandler de punkter i DS/EN 1997-1, hvor det er tilladt at foretage nationale valg. De anførte nationale valg gælder for geotekniske konstruktioner, der opføres i Danmark. De nationale valg kan være i form af nationalt gældende værdier, valgte metoder mellem de i DS/EN 1997......-1 angivne metoder eller tilføjelse af supplerende informationer. I dette nationale anneks er kun anført punkter, hvor der er foretaget valg, der adskiller sig fra de i DS/EN 1997-1 anbefalede værdier, metoder eller lignende. Det betyder, at for de punkter, hvor der intet er anført i dette dokument, gælder...... de i DS/EN 1997-1 anbefalede værdier, metoder eller lignende....

  10. Diversity of mosaic pbp2x families of penicillin-resistant Streptococcus pneumoniae from Iran and Romania.

    Science.gov (United States)

    Mousavi, Seyed Fazlollah; Pana, Marina; Feizabadi, Mohammad; Jalali, Pantea; Ghita, Maria; Denapaite, Dalia; Hakenbeck, Regine

    2017-10-02

    High rates of penicillin-resistant Streptococcus pneumoniae occur in Romania and the Iran. The mosaic structure of PBP2x was investigated in nine Iranian strains and in 15 strains from Romania to understand their evolutionary history. Mutations potentially important for β-lactam resistance were identified by comparison with related PBP2x of penicillin-sensitive reference S. mitis strains. Two main PBP2x mosaic gene families were recognized. Eight Iranian strains belonged to group 1 PBP2x with a mosaic block highly related to PBP2x of the clone Spain(23F)-1 which is widespread among international penicillin-resistant S. pneumoniae clones. A second unique PBP2x group was observed in Romanian strains; furthermore, three PBP2x represented single mosaic variants. Sequence blocks of the penicillin-sensitive S. mitis 658 were common among PBP2x of strains from both countries. Each PBP2x group contained specific signature mutations within the transpeptidase domain, documenting distinct mutational pathways for the development of penicillin resistance. Copyright © 2017 Mousavi et al.

  11. Co-diversification ofEnterococcus faeciumCore Genomes and PBP5: Evidences ofpbp5Horizontal Transfer.

    Science.gov (United States)

    Novais, Carla; Tedim, Ana P; Lanza, Val F; Freitas, Ana R; Silveira, Eduarda; Escada, Ricardo; Roberts, Adam P; Al-Haroni, Mohammed; Baquero, Fernando; Peixe, Luísa; Coque, Teresa M

    2016-01-01

    Ampicillin resistance has greatly contributed to the recent dramatic increase of a cluster of human adapted Enterococcus faecium lineages (ST17, ST18, and ST78) in hospital-based infections. Changes in the chromosomal pbp5 gene have been associated with different levels of ampicillin susceptibility, leading to protein variants (designated as PBP5 C-types to keep the nomenclature used in previous works) with diverse degrees of reduction in penicillin affinity. Our goal was to use a comparative genomics approach to evaluate the relationship between the diversity of PBP5 among E. faecium isolates of different phylogenomic groups as well as to assess the pbp5 transferability among isolates of disparate clonal lineages. The analyses of 78 selected E. faecium strains as well as published E. faecium genomes, suggested that the diversity of pbp5 mirrors the phylogenomic diversification of E. faecium . The presence of identical PBP5 C-types as well as similar pbp5 genetic environments in different E. faecium lineages and clones from quite different geographical and environmental origin was also documented and would indicate their horizontal gene transfer among E. faecium populations. This was supported by experimental assays showing transfer of large (≈180-280 kb) chromosomal genetic platforms containing pbp5 alleles, ponA (transglycosilase) and other metabolic and adaptive features, from E. faecium donor isolates to suitable E. faecium recipient strains. Mutation profile analysis of PBP5 from available genomes and strains from this study suggests that the spread of PBP5 C-types might have occurred even in the absence of a significant ampicillin resistance phenotype. In summary, genetic platforms containing pbp5 sequences were stably maintained in particular E. faecium lineages, but were also able to be transferred among E. faecium clones of different origins, emphasizing the growing risk of further spread of ampicillin resistance in this nosocomial pathogen.

  12. Compensatory evolution of pbp mutations restores the fitness cost imposed by β-lactam resistance in Streptococcus pneumoniae.

    Directory of Open Access Journals (Sweden)

    Andrea G Albarracín Orio

    2011-02-01

    Full Text Available The prevalence of antibiotic resistance genes in pathogenic bacteria is a major challenge to treating many infectious diseases. The spread of these genes is driven by the strong selection imposed by the use of antibacterial drugs. However, in the absence of drug selection, antibiotic resistance genes impose a fitness cost, which can be ameliorated by compensatory mutations. In Streptococcus pneumoniae, β-lactam resistance is caused by mutations in three penicillin-binding proteins, PBP1a, PBP2x, and PBP2b, all of which are implicated in cell wall synthesis and the cell division cycle. We found that the fitness cost and cell division defects conferred by pbp2b mutations (as determined by fitness competitive assays in vitro and in vivo and fluorescence microscopy were fully compensated by the acquisition of pbp2x and pbp1a mutations, apparently by means of an increased stability and a consequent mislocalization of these protein mutants. Thus, these compensatory combinations of pbp mutant alleles resulted in an increase in the level and spectrum of β-lactam resistance. This report describes a direct correlation between antibiotic resistance increase and fitness cost compensation, both caused by the same gene mutations acquired by horizontal transfer. The clinical origin of the pbp mutations suggests that this intergenic compensatory process is involved in the persistence of β-lactam resistance among circulating strains. We propose that this compensatory mechanism is relevant for β-lactam resistance evolution in Streptococcus pneumoniae.

  13. A novel peptidoglycan binding protein crucial for PBP1A-mediated cell wall biogenesis in Vibrio cholerae.

    Directory of Open Access Journals (Sweden)

    Tobias Dörr

    2014-06-01

    Full Text Available The bacterial cell wall, which is comprised of a mesh of polysaccharide strands crosslinked via peptide bridges (peptidoglycan, PG, is critical for maintenance of cell shape and survival. PG assembly is mediated by a variety of Penicillin Binding Proteins (PBP whose fundamental activities have been characterized in great detail; however, there is limited knowledge of the factors that modulate their activities in different environments or growth phases. In Vibrio cholerae, the cause of cholera, PG synthesis during the transition into stationary phase is primarily mediated by the bifunctional enzyme PBP1A. Here, we screened an ordered V. cholerae transposon library for mutants that are sensitive to growth inhibition by non-canonical D-amino acids (DAA, which prevent growth and maintenance of cell shape in PBP1A-deficient V. cholerae. In addition to PBP1A and its lipoprotein activator LpoA, we found that CsiV, a small periplasmic protein with no previously described function, is essential for growth in the presence of DAA. Deletion of csiV, like deletion of lpoA or the PBP1A-encoding gene mrcA, causes cells to lose their rod shape in the presence of DAA or the beta-lactam antibiotic cefsulodin, and all three mutations are synthetically lethal with deletion of mrcB, which encodes PBP1B, V. cholerae's second key bifunctional PBP. CsiV interacts with LpoA and PG but apparently not with PBP1A, supporting the hypothesis that CsiV promotes LpoA's role as an activator of PBP1A, and thereby modulates V. cholerae PG biogenesis. Finally, the requirement for CsiV in PBP1A-mediated growth of V. cholerae can be overcome either by augmenting PG synthesis or by reducing PG degradation, thereby highlighting the importance of balancing these two processes for bacterial survival.

  14. Study of the decay Bs(0)-->Ds(*)Ds(*).

    Science.gov (United States)

    Abazov, V M; Abbott, B; Abolins, M; Acharya, B S; Adams, M; Adams, T; Aguilo, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Ancu, L S; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Arnoud, Y; Arov, M; Askew, A; Asman, B; Assis Jesus, A C S; Atramentov, O; Autermann, C; Avila, C; Ay, C; Badaud, F; Baden, A; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, P; Banerjee, S; Barberis, E; Barfuss, A-F; Bargassa, P; Baringer, P; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benitez, J A; Beri, S B; Bernardi, G; Bernhard, R; Berntzon, L; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Binder, M; Biscarat, C; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Boehnlein, A; Boline, D; Bolton, T A; Borissov, G; Bos, K; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Buehler, M; Buescher, V; Burdin, S; Burke, S; Burnett, T H; Busato, E; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Caron, S; Carvalho, W; Casey, B C K; Cason, N M; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K; Chan, K M; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Christoudias, T; Cihangir, S; Claes, D; Clément, B; Clément, C; Coadou, Y; Cooke, M; Cooper, W E; Corcoran, M; Couderc, F; Cousinou, M-C; Crépé-Renaudin, S; Cutts, D; Cwiok, M; da Motta, H; Das, A; Davies, G; De, K; de Jong, P; de Jong, S J; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Déliot, F; Demarteau, M; Demina, R; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Ellison, J; Elvira, V D; Enari, Y; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Ford, M; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; Galyaev, E; Garcia, C; Garcia-Bellido, A; Gavrilov, V; Gay, P; Geist, W; Gelé, D; Gerber, C E; Gershtein, Y; Gillberg, D; Ginther, G; Gollub, N; Gómez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, Ph; Grivaz, J-F; Grohsjean, A; Grünendahl, S; Grünewald, M W; Guo, F; Guo, J; Gutierrez, G; Gutierrez, P; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Hanagaki, K; Hansson, P; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hooper, R; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jesik, R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Käfer, D; Kahn, S; Kajfasz, E; Kalinin, A M; Kalk, J M; Kalk, J R; Kappler, S; Karmanov, D; Kasper, J; Kasper, P; Katsanos, I; Kau, D; Kaur, R; Kaushik, V; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A; Kharzheev, Y M; Khatidze, D; Kim, H; Kim, T J; Kirby, M H; Klima, B; Kohli, J M; Konrath, J-P; Kopal, M; Korablev, V M; Kotcher, J; Kothari, B; Koubarovsky, A; Kozelov, A V; Krop, D; Kryemadhi, A; Kuhl, T; Kumar, A; Kunori, S; Kupco, A; Kurca, T; Kvita, J; Lam, D; Lammers, S; Landsberg, G; Lazoflores, J; Lebrun, P; Lee, W M; Leflat, A; Lehner, F; Lesne, V; Leveque, J; Lewis, P; Li, J; Li, L; Li, Q Z; Lietti, S M; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Z; Lobo, L; Lobodenko, A; Lokajicek, M; Lounis, A; Love, P; Lubatti, H J; Lynker, M; Lyon, A L; Maciel, A K A; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Makovec, N; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martin, B; McCarthy, R; Melnitchouk, A; Mendes, A; Mendoza, L; Mercadante, P G; Merkin, M; Merritt, K W; Meyer, A; Meyer, J; Michaut, M; Miettinen, H; Millet, T; Mitrevski, J; Molina, J; Mommsen, R K; Mondal, N K; Monk, J; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nilsen, H; Noeding, C; Nomerotski, A; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Ochando, C; Oguri, V; Oliveira, N; Onoprienko, D; Oshima, N; Osta, J; Otec, R; Otero y Garzón, G J; Owen, M; Padley, P; Pangilinan, M; Parashar, N; Park, S-J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Perea, P M; Peters, K; Peters, Y; Pétroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M-A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M-E; Pompos, A; Pope, B G; Popov, A V; Potter, C; Prado da Silva, W L; Prosper, H B; Protopopescu, S; Qian, J; Quadt, A; Quinn, B; Rangel, M S; Rani, K J; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F; Robinson, S; Rodrigues, R F; Royon, C; Rubinov, P; Ruchti, R; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A; Savage, G; Sawyer, L; Scanlon, T; Schaile, D; Schamberger, R D; Scheglov, Y; Schellman, H; Schieferdecker, P; Schmitt, C; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Sengupta, S; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shivpuri, R K; Shpakov, D; Siccardi, V; Sidwell, R A; Simak, V; Sirotenko, V; Skubic, P; Slattery, P; Smirnov, D; Smith, R P; Snow, G R; Snow, J; Snyder, S; Söldner-Rembold, S; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Souza, M; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, M; Ströhmer, R; Strom, D; Strovink, M; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Talby, M; Tamburello, P; Tanasijczuk, A; Taylor, W; Telford, P; Temple, J; Tiller, B; Tissandier, F; Titov, M; Tokmenin, V V; Tomoto, M; Toole, T; Torchiani, I; Trefzger, T; Trincaz-Duvoid, S; Tsybychev, D; Tuchming, B; Tully, C; Tuts, P M; Unalan, R; Uvarov, L; Uvarov, S; Uzunyan, S; Vachon, B; van den Berg, P J; van Eijk, B; Van Kooten, R; van Leeuwen, W M; Varelas, N; Varnes, E W; Vartapetian, A; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Seguier, F; Vint, P; Vlimant, J-R; Von Toerne, E; Voutilainen, M; Vreeswijk, M; Wahl, H D; Walder, J; Wang, L; Wang, M H L S; Warchol, J; Watts, G; Wayne, M; Weber, G; Weber, M; Weerts, H; Wenger, A; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Wimpenny, S J; Wobisch, M; Wood, D R; Wyatt, T R; Xie, Y; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, C; Yu, J; Yurkewicz, A; Zatserklyaniy, A; Zeitnitz, C; Zhang, D; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zutshi, V; Zverev, E G

    2007-12-14

    We report a study of the decay Bs(0)-->Ds(*)Ds(*) using a data sample corresponding to 1.3 fb(-1) of integrated luminosity collected by the D0 experiment in 2002-2006 during run II of the Fermilab Tevatron collider. One Ds(*) meson was partially reconstructed in the decay Ds-->phi mu nu, and the other Ds(*) meson was identified using the decay Ds-->phi pi where no attempt was made to distinguish Ds and Ds(*) states. For the branching fraction Br(Bs(0)-->Ds(*)Ds(*)) we obtain a 90% C.L. range [0.002,0.080] and central value 0.039(-0.017)(+0.019)(stat)(-0.015)(+0.016)(syst). This was subsequently used to make the most precise estimate of the width difference DeltaGamma(s)CP in the Bs(0)-Bs(0) system: DeltaGamma(s)CP/Gamma(s)=0.079(-0.035)(+0.038)(stat)(-0.030)(+0.031)(syst).

  15. Validation of β-lactam minimum inhibitory concentration predictions for pneumococcal isolates with newly encountered penicillin binding protein (PBP) sequences.

    Science.gov (United States)

    Li, Yuan; Metcalf, Benjamin J; Chochua, Sopio; Li, Zhongya; Gertz, Robert E; Walker, Hollis; Hawkins, Paulina A; Tran, Theresa; McGee, Lesley; Beall, Bernard W

    2017-08-15

    Genomic sequence-based deduction of antibiotic minimum inhibitory concentration (MIC) has great potential to enhance the speed and sensitivity of antimicrobial susceptibility testing. We previously developed a penicillin-binding protein (PBP) typing system and two methods (Random Forest (RF) and Mode MIC (MM)) that accurately predicted β-lactam MICs for pneumococcal isolates carrying a characterized PBP sequence type (phenotypic β-lactam MICs known for at least one isolate of this PBP type). This study evaluates the prediction performance for previously uncharacterized (new) PBP types and the probability of encountering new PBP types, both of which impact the overall prediction accuracy. The MM and RF methods were used to predict MICs of 4309 previously reported pneumococcal isolates in 2 datasets and the results were compared to the known broth microdilution MICs to 6 β-lactams. Based on a method that specifically evaluated predictions for new PBP types, the RF results were more accurate than MM results for new PBP types and showed percent essential agreement (MICs agree within ±1 dilution) >97%, percent category agreement (interpretive results agree) >93%, major discrepancy (sensitive isolate predicted as resistant) rate < 1.2%, and very major discrepancy (resistant isolate predicted as sensitive) rate < 1.4% for all 6 β-lactams. The identification of new PBP types over time was well approximated by a diminishingly increasing curve (Pearson's r = 0.99) and minimally impacted overall MIC prediction performance. MIC prediction using the RF method could be an accurate alternative of phenotypic susceptibility testing even in the presence of previously uncharacterized PBP types.

  16. Post-buckled precompressed (PBP) elements : A new class of flight control actuators enhancing high-speed autonomous VTOL MAVs

    NARCIS (Netherlands)

    Barrett, R.; McMurtry, R.; Vos, R.; Tiso, P.; De Breuker, R.

    2005-01-01

    This paper describes a new class of flight control actuators using Post-Buckled Precompressed (PBP) piezoelectric elements. These actuators are designed to produce significantly higher deflection and force levels than conventional piezoelectric actuator elements. Classical laminate plate theory

  17. Study of the Decay Bs0→Ds(*)Ds(*)

    Science.gov (United States)

    Abazov, V. M.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S. H.; Ahsan, M.; Alexeev, G. D.; Alkhazov, G.; Alton, A.; Alverson, G.; Alves, G. A.; Anastasoaie, M.; Ancu, L. S.; Andeen, T.; Anderson, S.; Andrieu, B.; Anzelc, M. S.; Arnoud, Y.; Arov, M.; Askew, A.; Åsman, B.; Assis Jesus, A. C. S.; Atramentov, O.; Autermann, C.; Avila, C.; Ay, C.; Badaud, F.; Baden, A.; Bagby, L.; Baldin, B.; Bandurin, D. V.; Banerjee, P.; Banerjee, S.; Barberis, E.; Barfuss, A.-F.; Bargassa, P.; Baringer, P.; Barreto, J.; Bartlett, J. F.; Bassler, U.; Bauer, D.; Beale, S.; Bean, A.; Begalli, M.; Begel, M.; Belanger-Champagne, C.; Bellantoni, L.; Bellavance, A.; Benitez, J. A.; Beri, S. B.; Bernardi, G.; Bernhard, R.; Berntzon, L.; Bertram, I.; Besançon, M.; Beuselinck, R.; Bezzubov, V. A.; Bhat, P. C.; Bhatnagar, V.; Binder, M.; Biscarat, C.; Blazey, G.; Blekman, F.; Blessing, S.; Bloch, D.; Bloom, K.; Boehnlein, A.; Boline, D.; Bolton, T. A.; Borissov, G.; Bos, K.; Bose, T.; Brandt, A.; Brock, R.; Brooijmans, G.; Bross, A.; Brown, D.; Buchanan, N. J.; Buchholz, D.; Buehler, M.; Buescher, V.; Burdin, S.; Burke, S.; Burnett, T. H.; Busato, E.; Buszello, C. P.; Butler, J. M.; Calfayan, P.; Calvet, S.; Cammin, J.; Caron, S.; Carvalho, W.; Casey, B. C. K.; Cason, N. M.; Castilla-Valdez, H.; Chakrabarti, S.; Chakraborty, D.; Chan, K.; Chan, K. M.; Chandra, A.; Charles, F.; Cheu, E.; Chevallier, F.; Cho, D. K.; Choi, S.; Choudhary, B.; Christofek, L.; Christoudias, T.; Cihangir, S.; Claes, D.; Clément, B.; Clément, C.; Coadou, Y.; Cooke, M.; Cooper, W. E.; Corcoran, M.; Couderc, F.; Cousinou, M.-C.; Crépé-Renaudin, S.; Cutts, D.; Ćwiok, M.; da Motta, H.; Das, A.; Davies, G.; de, K.; de Jong, P.; de Jong, S. J.; de La Cruz-Burelo, E.; de Oliveira Martins, C.; Degenhardt, J. D.; Déliot, F.; Demarteau, M.; Demina, R.; Denisov, D.; Denisov, S. P.; Desai, S.; Diehl, H. T.; Diesburg, M.; Dominguez, A.; Dong, H.; Dudko, L. V.; Duflot, L.; Dugad, S. R.; Duggan, D.; Duperrin, A.; Dyer, J.; Dyshkant, A.; Eads, M.; Edmunds, D.; Ellison, J.; Elvira, V. D.; Enari, Y.; Eno, S.; Ermolov, P.; Evans, H.; Evdokimov, A.; Evdokimov, V. N.; Ferapontov, A. V.; Ferbel, T.; Fiedler, F.; Filthaut, F.; Fisher, W.; Fisk, H. E.; Ford, M.; Fortner, M.; Fox, H.; Fu, S.; Fuess, S.; Gadfort, T.; Galea, C. F.; Gallas, E.; Galyaev, E.; Garcia, C.; Garcia-Bellido, A.; Gavrilov, V.; Gay, P.; Geist, W.; Gelé, D.; Gerber, C. E.; Gershtein, Y.; Gillberg, D.; Ginther, G.; Gollub, N.; Gómez, B.; Goussiou, A.; Grannis, P. D.; Greenlee, H.; Greenwood, Z. D.; Gregores, E. M.; Grenier, G.; Gris, Ph.; Grivaz, J.-F.; Grohsjean, A.; Grünendahl, S.; Grünewald, M. W.; Guo, F.; Guo, J.; Gutierrez, G.; Gutierrez, P.; Haas, A.; Hadley, N. J.; Haefner, P.; Hagopian, S.; Haley, J.; Hall, I.; Hall, R. E.; Han, L.; Hanagaki, K.; Hansson, P.; Harder, K.; Harel, A.; Harrington, R.; Hauptman, J. M.; Hauser, R.; Hays, J.; Hebbeker, T.; Hedin, D.; Hegeman, J. G.; Heinmiller, J. M.; Heinson, A. P.; Heintz, U.; Hensel, C.; Herner, K.; Hesketh, G.; Hildreth, M. D.; Hirosky, R.; Hobbs, J. D.; Hoeneisen, B.; Hoeth, H.; Hohlfeld, M.; Hong, S. J.; Hooper, R.; Houben, P.; Hu, Y.; Hubacek, Z.; Hynek, V.; Iashvili, I.; Illingworth, R.; Ito, A. S.; Jabeen, S.; Jaffré, M.; Jain, S.; Jakobs, K.; Jarvis, C.; Jesik, R.; Johns, K.; Johnson, C.; Johnson, M.; Jonckheere, A.; Jonsson, P.; Juste, A.; Käfer, D.; Kahn, S.; Kajfasz, E.; Kalinin, A. M.; Kalk, J. M.; Kalk, J. R.; Kappler, S.; Karmanov, D.; Kasper, J.; Kasper, P.; Katsanos, I.; Kau, D.; Kaur, R.; Kaushik, V.; Kehoe, R.; Kermiche, S.; Khalatyan, N.; Khanov, A.; Kharchilava, A.; Kharzheev, Y. M.; Khatidze, D.; Kim, H.; Kim, T. J.; Kirby, M. H.; Klima, B.; Kohli, J. M.; Konrath, J.-P.; Kopal, M.; Korablev, V. M.; Kotcher, J.; Kothari, B.; Koubarovsky, A.; Kozelov, A. V.; Krop, D.; Kryemadhi, A.; Kuhl, T.; Kumar, A.; Kunori, S.; Kupco, A.; Kurča, T.; Kvita, J.; Lam, D.; Lammers, S.; Landsberg, G.; Lazoflores, J.; Lebrun, P.; Lee, W. M.; Leflat, A.; Lehner, F.; Lesne, V.; Leveque, J.; Lewis, P.; Li, J.; Li, L.; Li, Q. Z.; Lietti, S. M.; Lima, J. G. R.; Lincoln, D.; Linnemann, J.; Lipaev, V. V.; Lipton, R.; Liu, Z.; Lobo, L.; Lobodenko, A.; Lokajicek, M.; Lounis, A.; Love, P.; Lubatti, H. J.; Lynker, M.; Lyon, A. L.; Maciel, A. K. A.; Madaras, R. J.; Mättig, P.; Magass, C.; Magerkurth, A.; Makovec, N.; Mal, P. K.; Malbouisson, H. B.; Malik, S.; Malyshev, V. L.; Mao, H. S.; Maravin, Y.; Martin, B.; McCarthy, R.; Melnitchouk, A.; Mendes, A.; Mendoza, L.; Mercadante, P. G.; Merkin, M.; Merritt, K. W.; Meyer, A.; Meyer, J.; Michaut, M.; Miettinen, H.; Millet, T.; Mitrevski, J.; Molina, J.; Mommsen, R. K.; Mondal, N. K.; Monk, J.; Moore, R. W.; Moulik, T.; Muanza, G. S.; Mulders, M.; Mulhearn, M.; Mundal, O.; Mundim, L.; Nagy, E.

    2007-12-01

    We report a study of the decay Bs0→Ds(*)Ds(*) using a data sample corresponding to 1.3fb-1 of integrated luminosity collected by the D0 experiment in 2002 2006 during run II of the Fermilab Tevatron collider. One Ds(*) meson was partially reconstructed in the decay Ds→ϕμν, and the other Ds(*) meson was identified using the decay Ds→ϕπ where no attempt was made to distinguish Ds and Ds* states. For the branching fraction Br(Bs0→Ds(*)Ds(*)) we obtain a 90% C.L. range [0.002,0.080] and central value 0.039-0.017+0.019(stat)-0.015+0.016(syst). This was subsequently used to make the most precise estimate of the width difference ΔΓsCP in the Bs0-B¯s0 system: ΔΓsCP/Γs=0.079-0.035+0.038(stat)-0.030+0.031(syst).

  18. Radiolabelling of penicillin-binding proteins (PBPs) in intact Pseudomonas aeruginosa cells; consequences of. beta. -lactamase activity by PBP-5

    Energy Technology Data Exchange (ETDEWEB)

    Livermore, D.M.

    1987-06-01

    The time-course of labelling of penicillin-binding proteins (PBPs) was compared for intact and sonicated cell preparations of nine Pseudomonas aeruginosa strains, all of which gave identical PBP profiles. Saturation of all the PBPs in cell-sonicates occurred within 2 min of exposure to /sup 14/(C) benzylpenicillin. PBP-5 formed an unstable penicilloyl-complex: the other PBPs formed highly stable complexes. Saturation of PBP-4 in intact cells occurred within 2 min of exposure to the antibiotic, correlating with the high affinity of this protein for penicillin. Labelling of PBPs 1a, 1b and 3 was slow but progressive, suggesting that these proteins were shielded by the permeability barrier(s) of the cell. Labelling of PBP-5 in intact cells achieved 10-20% saturation within 2-10 min of exposure to /sup 14/(C) benzylpenicillin, but did not increase subsequently. This behaviour may indicate that establishment of a steady state between the formation and breakdown of the PBP-5-penicillin complex, suggesting that PBP-5, potentiated by the permeability barrier, functions as a feeble ..beta..-lactamase. Such activity may distort the labelling of other PBPs by reducing the concentration of penicillin in the periplasm.

  19. Purification and characterization of PBP4a, a new low-molecular-weight penicillin-binding protein from Bacillus subtilis.

    Science.gov (United States)

    Duez, C; Vanhove, M; Gallet, X; Bouillenne, F; Docquier, J; Brans, A; Frère, J

    2001-03-01

    Penicillin-binding protein 4a (PBP4a) from Bacillus subtilis was overproduced and purified to homogeneity. It clearly exhibits DD-carboxypeptidase and thiolesterase activities in vitro. Although highly isologous to the Actinomadura sp. strain R39 DD-peptidase (B. Granier, C. Duez, S. Lepage, S. Englebert, J. Dusart, O. Dideberg, J. van Beeumen, J. M. Frère, and J. M. Ghuysen, Biochem. J. 282:781-788, 1992), which is rapidly inactivated by many beta-lactams, PBP4a is only moderately sensitive to these compounds. The second-order rate constant (k(2)/K) for the acylation of the essential serine by benzylpenicillin is 300,000 M(-1) s(-1) for the Actinomadura sp. strain R39 peptidase, 1,400 M(-1) s(-1) for B. subtilis PBP4a, and 7,000 M(-1) s(-1) for Escherichia coli PBP4, the third member of this class of PBPs. Cephaloridine, however, efficiently inactivates PBP4a (k(2)/K = 46,000 M(-1) s(-1)). PBP4a is also much more thermostable than the R39 enzyme.

  20. 3ds Max 2012 Bible

    CERN Document Server

    Murdock, Kelly L

    2011-01-01

    Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav

  1. Identification of non-PBP2a resistance mechanisms in Staphylococcus aureus after serial passage with ceftaroline: involvement of other PBPs.

    Science.gov (United States)

    Lahiri, Sushmita D; Alm, Richard A

    2016-11-01

    Ceftaroline (the active metabolite of ceftaroline fosamil) is a cephalosporin that possesses activity against MRSA due to its differentiating high affinity for PBP2a. It is known that PBP2a sequence variations, including some outside of the transpeptidase-binding pocket, impact ceftaroline susceptibility and recent evidence suggests involvement of non-PBP2a mechanisms in ceftaroline resistance. This study evaluated the potential of ceftaroline to select for resistant Staphylococcus aureus clones during serial passage. Selection experiments were performed by up to 20 daily passages of three S. aureus isolates (two MRSA and one MSSA) in broth with increasing selective pressure. Mutants that emerged were tested for changes in ceftaroline susceptibility and genetically characterized. The MSSA isolate developed mutations in PBP2 and PBP3 that increased the ceftaroline MIC by 16-fold and increased the MICs of other β-lactams. A Glu 447 Lys substitution in the PBP2a transpeptidase pocket in one MRSA isolate elevated the ceftaroline MIC to 8 mg/L. Selective pressure in a ceftaroline-resistant MRSA isolate generated mutations in LytD, as well as changes in the pbp4 promoter previously shown to result in PBP4 overexpression, the one PBP not inhibited by ceftaroline. Elevated ceftaroline MIC was reversed when tested in combination with extremely low levels of methicillin or meropenem that could inhibit the function of PBP4. These studies demonstrate that resistance to ceftaroline can be manifested through numerous mechanisms. Further, they support a hypothesis where PBP4 can functionally provide the essential transpeptidase activity required for MRSA cell wall biogenesis when PBP2a is inhibited. © The Author 2016. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  2. Penicillin-binding protein encoded by pbp4 is involved in mediating copper stress in Listeria monocytogenes.

    Science.gov (United States)

    Parsons, Cameron; Costolo, Ben; Brown, Phillip; Kathariou, Sophia

    2017-11-01

    Listeria monocytogenes raises major food safety and public health concerns due to its potential for severe foodborne disease and persistent colonization of food processing facilities. Copper is often employed to control pathogens in agriculture and is increasingly used in healthcare facilities, but mechanisms mediating tolerance of L. monocytogenes to copper remain poorly understood. A mariner-based mutant library of L. monocytogenes 2011L-2858, implicated in the 2011 listeriosis outbreak via whole cantaloupe, was screened for growth at sublethal levels of copper yielding mutant G2B4 with decreased copper tolerance. The transposon was localized in pbp4 (lmo2229 homolog), encoding a penicillin-binding protein (PBP). In addition to reduced copper tolerance, G2B4 exhibited increased susceptibility to β-lactam antibiotics, reduced biofilm formation and reduced virulence in the Galleria mellonella model. Mutant phenotypes were fully restored upon genetic complementation of G2B4 with intact pbp4. Findings provide the first evidence for the role of a PBP in copper tolerance of L. monocytogenes and suggest that pbp4 may be a suitable target to enable the use of lower levels of copper or enhance the effectiveness of levels currently in use. Given the wide distribution of PBPs and their highly conserved nature, this could have profound impacts in regard to ecology and control of L. monocytogenes and other microorganisms. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. 75 FR 36463 - 60-Day Notice of Proposed Information Collection: Form DS-1622, DS-1843, DS-1622P, and DS-1843P...

    Science.gov (United States)

    2010-06-25

    ... Notice of Proposed Information Collection: Form DS-1622, DS-1843, DS-1622P, and DS-1843P: Medical History... the Paperwork Reduction Act of 1995. Title of Information Collection: Medical History And Examination..., including the validity of the methodology and assumptions used. Enhance the quality, utility, and clarity of...

  4. 76 FR 56271 - 30-Day Notice of Proposed Information Collection: Forms DS-1622, DS-1843, DS-1622P and DS-1843P...

    Science.gov (United States)

    2011-09-12

    ... Notice of Proposed Information Collection: Forms DS-1622, DS-1843, DS-1622P and DS-1843P: Medical History... of 1995. Title of Information Collection: Medical History and Examination for Foreign Service. OMB... proposed collection, including the validity of the methodology and assumptions used. Enhance the quality...

  5. Streptococcus pneumoniae PBP2x mid-cell localization requires the C-terminal PASTA domains and is essential for cell shape maintenance

    NARCIS (Netherlands)

    Peters, Katharina; Schweizer, Inga; Beilharz, Katrin; Stahlmann, Christoph; Veening, Jan-Willem; Hakenbeck, Regine; Denapaite, Dalia

    The transpeptidase activity of the essential penicillin-binding protein 2x (PBP2x) of Streptococcus pneumoniae is believed to be important for murein biosynthesis required for cell division. To study the molecular mechanism driving localization of PBP2x in live cells, we constructed a set of

  6. High-Level Resistance of Staphylococcus aureus to β-Lactam Antibiotics Mediated by Penicillin-Binding Protein 4 (PBP4).

    Science.gov (United States)

    Hamilton, Stephanie M; Alexander, J Andrew N; Choo, Eun Ju; Basuino, Li; da Costa, Thaina M; Severin, Anatoly; Chung, Marilyn; Aedo, Sandra; Strynadka, Natalie C J; Tomasz, Alexander; Chatterjee, Som S; Chambers, Henry F

    2017-06-01

    Penicillin-binding protein 4 (PBP4), a nonessential, low-molecular-weight penicillin-binding protein of Staphylococcus aureus, has been implicated in low-level resistance to β-lactam antibiotics, although the mechanism is unknown. Mutations in PBP4 and its promoter were identified in a laboratory-generated mutant strain, CRB, which expresses high-level resistance to β-lactams, including resistance to the new-generation cephalosporins active against methicillin-resistant strains of S. aureus These mutations did not appreciably alter the β-lactam antibiotic binding affinity of purified recombinant mutant PBP4 compared to that of wild-type PBP4. Compared to the susceptible parent strain, COLnex, the CRB strain produces a highly cross-linked cell wall peptidoglycan, indicative of increased transpeptidase activity. The pbp4 promoter mutation of CRB was associated with greatly increased amounts of PBP4 in membranes compared to those in the COLnex parent. Replacement of the native promoter of COLnex with the mutant promoter of CRB resulted in increased amounts of PBP4 in membranes and a highly cross-linked cell wall. PBP4 can be repurposed to provide essential transpeptidase activity in vivo and confer high-level resistance to β-lactam antibiotics, such as ceftobiprole and ceftaroline. Copyright © 2017 American Society for Microbiology.

  7. Discovery of new inhibitors of resistant Streptococcus pneumoniae penicillin binding protein (PBP) 2x by structure-based virtual screening.

    Science.gov (United States)

    Miguet, Laurence; Zervosen, Astrid; Gerards, Thomas; Pasha, Farhan A; Luxen, André; Distèche-Nguyen, Martine; Thomas, Aline

    2009-10-08

    Penicillin binding proteins (PBPs) are involved in the biosynthesis of the peptidoglycan layer constitutive of the bacterial envelope. They have been targeted for more than half a century by extensively derived molecular scaffolds of penicillins and cephalosporins. Streptococcus pneumoniae resists the antibiotic pressure by inducing highly mutated PBPs that can no longer bind the beta-lactam containing agents. To find inhibitors of PBP2x from Streptococcus pneumoniae (spPBP2x) with novel chemical scaffold so as to circumvent the resistance problems, a hierarchical virtual screening procedure was performed on the NCI database containing approximately 260000 compounds. The calculations involved ligand-based pharmacophore mapping studies and molecular docking simulations in a homology model of spPBP2x from the highly resistant strain 5204. A total of 160 hits were found, and 55 were available for experimental tests. Three compounds harboring two novel chemical scaffolds were identified as inhibitors of the resistant strain 5204-spPBP2x at the micromolar range.

  8. PBP1a-deficiency causes major defects in cell division, growth and biofilm formation by Streptococcus mutans.

    Directory of Open Access Journals (Sweden)

    Zezhang T Wen

    Full Text Available Streptococcus mutans, a key etiological agent of human dental caries, lives almost exclusively on the tooth surface in plaque biofilms and is known for its ability to survive and respond to various environmental insults, including low pH, and antimicrobial agents from other microbes and oral care products. In this study, a penicillin-binding protein (PBP1a-deficient mutant, strain JB467, was generated by allelic replacement mutagenesis and analyzed for the effects of such a deficiency on S. mutans' stress tolerance response and biofilm formation. Our results so far have shown that PBP1a-deficiency in S. mutans affects growth of the deficient mutant, especially at acidic and alkaline pHs. As compared to the wild-type, UA159, the PBP1a-deficient mutant, JB467, had a reduced growth rate at pH 6.2 and did not grow at all at pH 8.2. Unlike the wild-type, the inclusion of paraquat in growth medium, especially at 2 mM or above, significantly reduced the growth rate of the mutant. Acid killing assays showed that the mutant was 15-fold more sensitive to pH 2.8 than the wild-type after 30 minutes. In a hydrogen peroxide killing assay, the mutant was 16-fold more susceptible to hydrogen peroxide (0.2%, w/v after 90 minutes than the wild-type. Relative to the wild-type, the mutant also had an aberrant autolysis rate, indicative of compromises in cell envelope integrity. As analyzed using on 96-well plate model and spectrophotometry, biofilm formation by the mutant was decreased significantly, as compared to the wild-type. Consistently, Field Emission-SEM analysis also showed that the PBP1a-deficient mutant had limited capacity to form biofilms. TEM analysis showed that PBP1a mutant existed primarily in long rod-like cells and cells with multiple septa, as compared to the coccal wild-type. The results presented here highlight the importance of pbp1a in cell morphology, stress tolerance, and biofilm formation in S. mutans.

  9. Penicillin-resistant, ampicillin-susceptible Enterococcus faecalis of hospital origin: pbp4 gene polymorphism and genetic diversity.

    Science.gov (United States)

    Conceição, Natália; da Silva, Lucas Emanuel Pinheiro; Darini, Ana Lúcia da Costa; Pitondo-Silva, André; de Oliveira, Adriana Gonçalves

    2014-12-01

    Despite the spread of penicillin-resistant, ampicillin-susceptible Enterococcus faecalis (PRASEF) isolates in diverse countries, the mechanisms leading to this unusual resistance phenotype have not yet been investigated. The aim of this study was to evaluate whether polymorphism in the pbp4 gene is associated with penicillin resistance in PRASEF isolates and to determine their genetic diversity. E. faecalis isolates were recovered from different clinical specimens of hospitalized patients from February 2006 to June 2010. The β-lactam minimal inhibitory concentrations (MICs) were determined by E-test®. The PCR-amplified pbp4 gene was sequenced with an automated sequencer. The genetic diversities of the isolates were established by PFGE (pulsed-field gel electrophoresis) and MLST (multilocus sequencing typing). Seventeen non-producing β-lactamase PRASEF and 10 penicillin-susceptible, ampicillin-susceptible E. faecalis (PSASEF) strains were analyzed. A single-amino-acid substitution (Asp-573→Glu) in the penicillin-binding domain was significantly found in all PRASEF isolates by sequencing of the pbp4 gene but not in the penicillin-susceptible isolates. In contrast to the PSASEF isolates, a majority of the PRASEFs had similar PFGE profiles. Six representative PRASEF isolates were resolved by MLST into ST9 and ST524 and belong to the globally dispersed clonal complex 9 (CC9). In conclusion, it appears quite likely that the amino acid alteration (Asp-573→Glu) found in the PBP4 of the Brazilian PRASEF isolates may account for their reduced susceptibility to penicillin, although other resistance mechanisms remain to be investigated. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Beam Dynamics Simulation of Photocathode RF Electron Gun at the PBP-CMU Linac Laboratory

    Science.gov (United States)

    Buakor, K.; Rimjaem, S.

    2017-09-01

    Photocathode radio-frequency (RF) electron guns are widely used at many particle accelerator laboratories due to high quality of produced electron beams. By using a short-pulse laser to induce the photoemission process, the electrons are emitted with low energy spread. Moreover, the photocathode RF guns are not suffered from the electron back bombardment effect, which can cause the limited electron current and accelerated energy. In this research, we aim to develop the photocathode RF gun for the linac-based THz radiation source. Its design is based on the existing gun at the PBP-CMU Linac Laboratory. The gun consists of a one and a half cell S-band standing-wave RF cavities with a maximum electric field of about 60 MV/m at the centre of the full cell. We study the beam dynamics of electrons traveling through the electromagnetic field inside the RF gun by using the particle tracking program ASTRA. The laser properties i.e. transverse size and injecting phase are optimized to obtain low transverse emittance. In addition, the solenoid magnet is applied for beam focusing and emittance compensation. The proper solenoid magnetic field is then investigated to find the optimum value for proper emittance conservation condition.

  11. PBP-2 Negative Methicillin Resistant Staphylococcus schleiferi Bacteremia from a Prostate Abscess: An Unusual Occurrence

    Directory of Open Access Journals (Sweden)

    Chandni Merchant

    2016-01-01

    Full Text Available Staphylococcus schleiferi subsp. schleiferi is a coagulase-negative Staphylococcus which has been described as a pathogen responsible for various nosocomial infections including bacteremia, brain abscess, and infection of intravenous pacemakers. Recently, such bacteria have been described to be found typically on skin and mucosal surfaces. It is also believed to be a part of the preaxillary human flora and more frequently found in men. It is very similar in its pathogenicity with Staphylococcus aureus group and expresses a fibronectin binding protein. Literature on this pathogen reveals that it commonly causes otitis among dogs because of its location in the auditory meatus of canines. Also, it has strong association with pyoderma in dogs. The prime concern with this organism is the antibiotic resistance and relapse even after appropriate treatment. Very rarely, if any, cases have been reported about prostatic abscess (PA with this microbe. Our patient had a history of recurrent UTIs and subsequent PA resulting in S. schleiferi bacteremia in contrast to gram negative bacteremia commonly associated with UTI. This organism was found to be resistant to methicillin, in spite of being negative for PBP2, which is a rare phenomenon and needs further studies.

  12. Contribution of PBP3 Substitutions and TEM-1, TEM-15, and ROB-1 Beta-Lactamases to Cefotaxime Resistance in Haemophilus influenzae and Haemophilus parainfluenzae.

    Science.gov (United States)

    Søndergaard, Annette; Nørskov-Lauritsen, Niels

    2016-06-01

    To investigate the relative contributions of naturally occurring penicillin-binding protein 3 (PBP3) substitutions, and TEM-1, TEM-15, and ROB-1 beta-lactamases on resistance to a third-generation cephalosporin in Haemophilus influenzae and Haemophilus parainfluenzae. The minimum inhibitory concentration (MIC) of cefotaxime (CTX) was assessed after transformation with PCR-amplified ftsI genes expressing altered PBP3 and/or small plasmids encoding beta-lactamases into an isogenic environment of H. influenzae and H. parainfluenzae. Group III PBP3, comprising substitutions N526K, S385T, and L389F, conferred CTX resistance to H. influenzae according to EUCAST interpretative criteria. Group III-like PBP3, comprising substitutions N526H and S385T, increased the CTX MIC of H. parainfluenzae ninefold, but the level did not transgress the resistance breakpoint. Production of TEM-15 beta-lactamase conferred CTX resistance on both H. influenzae and H. parainfluenzae. A nitrocefin hydrolysis assay showed TEM-15 to be a less efficient enzyme compared to TEM-1. TEM-15 and PBP3 substitutions impose an additive effect on resistance to third-generation cephalosporins in both H. influenzae and H. parainfluenzae. The effect of PBP3 substitutions on beta-lactam resistance in H. parainfluenzae can be addressed by transfer of ftsI genes in vitro.

  13. Effects of two novel amino acid substitutions on the penicillin binding properties of the PBP5 C‑terminal from Enterococcus faecium.

    Science.gov (United States)

    Zhou, Chengjiang; Niu, Haiying; Yu, Hui; Zhou, Lishe; Wang, Zhanli

    2015-10-01

    The low‑affinity penicillin‑binding protein (PBP)5 is responsible for resistance to β‑lactam antibiotics in Enterococcus faecium. (E. faecium). In order to evaluate more fully the potential of this species for the development of resistance to β-lactam antibiotics, the present study aimed to examine the extent of penicillin-binding protein (PBP) variations in a collection of clinical E. faecium isolates. In the present study, the C‑terminal domain of PBP5 (PBP5‑CD) of 13 penicillin‑resistant clinical isolates of E. faecium were sequenced and the correlation between penicillin resistance and particular amino acid changes were analyzed. The present study identified for the first time, to the best of our knowledge, two novel substitutions (Tyr460Phe and Ala462Thr or Val462Thr) of E. faecium PBP5‑CD. The covalent interaction between penicillin and PBP5‑CD was also investigated using homology modeling and molecular docking methods. The theoretical calculation revealed that Phe460 and Thr462 were involved in penicillin binding, suggesting that substitutions at these positions exert effects on the affinity for penicillin, and this increased affinity translates into lower resistance in vitro.

  14. Mastering Autodesk 3ds Max 2013

    CERN Document Server

    Harper, Jeffrey

    2012-01-01

    Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides

  15. Um caso de Nefrite de shunt associada a elevação transitória de anticorpos anti-dsDNA

    Directory of Open Access Journals (Sweden)

    Marta Soares

    2014-09-01

    The authors present the case of a NS with positivity for both PR3-ANCA and for anti-dsDNA in which there was no manifestation of autoimmune disease and the resolution of the infection led to the gradual decline of autoantibodies. To our knowledge this is the first report of a NS with transient elevation of anti-dsDNA.

  16. Production of D$^{**}_{s}$ mesons in hadronic Z decays

    CERN Document Server

    Heister, A.; Barate, R.; De Bonis, I.; Decamp, D.; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Boix, G.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Hansen, J.B.; Harvey, J.; Hutchcroft, D.E.; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schneider, O.; Sguazzoni, G.; Tejessy, W.; Teubert, F.; Valassi, A.; Videau, I.; Ward, J.; Badaud, F.; Falvard, A.; Gay, P.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Spagnolo, P.; Halley, A.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Thompson, A.S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C.K.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Pearson, M.R.; Robertson, N.A.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Lefrancois, J.; Veillet, J.J.; Yuan, C.; Bagliesi, Giuseppe; Boccali, T.; Foa, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Misiejuk, A.; Strong, J.A.; Teixeira-Dias, P.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Konstantinidis, N.; Litke, A.M.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Ngac, A.; Prange, G.; Sieler, U.; Giannini, G.; Rothberg, J.; Armstrong, S.R.; Berkelman, Karl; Cranmer, K.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Pan, Y.B.; von Wimmersperg-Toeller, J.H.; Wiedenmann, W.; Wu, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.; Dissertori, G.

    2002-01-01

    The production rates of the orbitally excited Ds** mesons, Ds1 and Ds2*, are measured with the 4.1 million hadronic Z decays recorded by the ALEPH detector during 1991--1995. The Ds** mesons are reconstructed in the decay modes Ds1+ -> D*+ K0, Ds1+ -> D*0 K+ and Ds2*+ -> D0 K+. The production rate of the Ds1 is measured to be n(Z->Ds1+-)=(0.52+-0.09+-0.06)%, under the assumption that the two considered decay modes of the Ds1 saturate the branching ratio. The production rate of the Ds2* is determined to be n(Z->Ds2*+-)=(0.83+-0.29+0.07-0.13)%, assuming that the branching fraction of the decay Ds2*+ -> D0 K+ is 45%. The production rates in Z->cc and Z->bbar decays are measured separately.

  17. The labelling of antibody anti-PBP2a with {sup 99m}Tc; Estudo de marcacao do anticorpo monoclonal anti-PBP2a com {sup 99m}Tc

    Energy Technology Data Exchange (ETDEWEB)

    Mororo, Janio da Silva

    2012-07-01

    Staphylococcus aureus is a major cause of life-threatening infections such as bacteraemia and endocarditis. Unfortunately, many strains of this bacterial species have become resistant to certain antibiotics, including methicillin and amoxicillin. These strains are known as methicillin-resistant S. aureus (MRSA). The penicillin binding protein 2a (PBP2a) is the enzyme responsible for conferring resistance p-lactams antibiotics for MRSA, being one promising molecule for therapy with mAb. However, besides the therapy, the methods of diagnosis are also inefficient because the diagnosis currently takes several days to produce a reliable result. Taking into account, the objective of this research was radiolabeling one anti-PBP2a mAb developed by Bio-Manguinhos/FioCruz-RJ, utilizing {sup 99m}Tc, for in situ diagnostic of the infectious caused by MRSA. First, anti-PBP2a mAb was reduced utilizing 2-mecaptoethanol (2-ME) for generate sulphydryl groups (-SH) and after to be labeled with {sup 99m}Tc. In this work, were utilized two techniques of direct method: Method 1, using tartrate and gentisic acid reagents, acting like transchelant and stabilizer agents, respectively; and Method 2, using one commercial kit of MDP. Besides the radiolabeling, the mAb reduced and mAb labeled with {sup 99m}Tc were submitted to immunoreactivity analysis, with SDS-PAGE non-reducing, Immunoblotting, ELISA and neutralization assay in vitro methods. The quantity produced of sulphydryl groups by mAb was satisfactory, approximately 5 per mAb, utilizing 6.500:1 of 2-ME:mAb molar ratio. The better labeling method was Method 2, with labeling yield of 73.5%, and showed a good stability after 2 hours (73.2%). The better formulation was: 0.5 mg of mAb anti- PBP2a, 10 {mu}U of MDP kit, after resuspended with 5 mL of saline, and 75.48 MBq (2.04 mCi) of {sup 99m}Tc, reacting by 15 minutes. The labeled mAb maintained the immunoreactivity, utilizing immunologic and in vitro experiments. (author)

  18. Quantitative Global Proteomics of Yeast PBP1 Deletion Mutants and Their Stress Responses Identifies Glucose Metabolism, Mitochondrial, and Stress Granule Changes.

    Science.gov (United States)

    Seidel, Gunnar; Meierhofer, David; Şen, Nesli-Ece; Guenther, Anika; Krobitsch, Sylvia; Auburger, Georg

    2017-02-03

    The yeast protein PBP1 is implicated in very diverse pathways. Intriguingly, its deletion mitigates the toxicity of human neurodegeneration factors. Here, we performed label-free quantitative global proteomics to identify crucial downstream factors, either without stress or under cell stress conditions (heat and NaN3). Compared to the wildtype BY4741 strain, PBP1 deletion always triggered downregulation of the key bioenergetics enzyme KGD2 and the prion protein RNQ1 as well as upregulation of the leucine biosynthesis enzyme LEU1. Without stress, enrichment of stress response factors was consistently detected for both deletion mutants; upon stress, these factors were more pronounced. The selective analysis of components of stress granules and P-bodies revealed a prominent downregulation of GIS2. Our yeast data are in good agreement with a global proteomics and metabolomics publication that the PBP1 ortholog ATAXIN-2 (ATXN2) knockout (KO) in mouse results in mitochondrial deficits in leucine/fatty acid catabolism and bioenergetics, with an obesity phenotype. Furthermore, our data provide the completely novel insight that PBP1 mutations in stress periods involve GIS2, a plausible scenario in view of previous data that both PBP1 and GIS2 relocalize from ribosomes to stress granules, interact with poly(A)-binding protein in translation regulation and prevent mitochondrial precursor overaccumulation stress (mPOS). This may be relevant for human diseases like spinocerebellar ataxias, amyotrophic lateral sclerosis, and the metabolic syndrome.

  19. Introducing Autodesk 3ds Max 2011

    CERN Document Server

    Derakhshani, Dariush

    2010-01-01

    An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c

  20. Archive of digitized analog boomer seismic-reflection data collected during U.S. Geological Survey cruises Erda 90-1_HC, Erda 90-1_PBP, and Erda 91-3 in Mississippi Sound, June 1990 and September 1991

    Science.gov (United States)

    Bosse, Stephen T.; Flocks, James G.; Forde, Arnell S.

    2017-01-01

    The U.S. Geological Survey Coastal and Marine Geology Program has actively collected geophysical and sedimentological data in the northern Gulf of Mexico for several decades, including shallow subsurface data in the form of high-resolution seismic-reflection profiles (HRSP). Prior to the mid-1990s most HRSP data were collected in analog format as paper rolls of continuous profiles up to 25 meters long. As part of the National Geological and Geophysical Data Preservation Program, scientists at the U.S. Geological Survey St. Petersburg Coastal and Marine Science Center are converting the analog paper records to digital format using a large-format continuous scanner.This data release serves as an archive of seismic profiles with headers, converted SEG-Y files, navigation data, and trackline shapefiles for digitized boomer seismic data collected from the Research Vessel (R/V) Erda during two cruises in 1990 and 1991 (Figure 1). The Erda 90-1 geophysical cruise was conducted in two legs. The first leg included seismic data collected from the Hancock County region of the Mississippi Sound (Erda 90-1_HC) from June 4 to June 6, 1990. The second leg included seismic data collected from the Petit Bois Pass area of Mississippi Sound (Erda 90-1_PBP) from June 8 to June 9, 1990. The Erda 91-3 cruise occurred between September 12 and September 23, 1991 and surveyed the Mississippi Sound region just west of Horn Island, Mississippi. Additional project and data rescue details are included in the associated USGS Data Series 1047.Bosse, S.T., Flocks, J.G., and Forde, A.S., 2017, Digitized analog boomer seismic-reflection data collected during U.S. Geological Survey cruises Erda 90-1_HC, Erda 90-1_PBP, and Erda 91-3 in Mississippi Sound, June 1990 and September 1991: U.S. Geological Survey Data Series 1047, https://doi.org/10.3133/ds1047.

  1. Chinook Abundance - Linear Features [ds181

    Data.gov (United States)

    California Department of Resources — The dataset 'ds181_Chinook_ln' is a product of the CalFish Adult Salmonid Abundance Database. Data in this shapefile are collected from stream sections or reaches...

  2. Stream Habitat Reach Summary - NCWAP [ds158

    Data.gov (United States)

    California Department of Resources — The Stream Habitat - NCWAP - Reach Summary [ds158] shapefile contains in-stream habitat survey data summarized to the stream reach level. It is a derivative of the...

  3. DS-Connect: The Down Syndrome Registry

    Science.gov (United States)

    ... Read the Research Review Policy Contact Us DS-Connect® is a powerful resource where people with Down syndrome and their families can: Connect with researchers and health care providers. Express interest ...

  4. Measurement of the Ds l(+)ve branching fractions and the decay constant fDs+

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Y.; Huang, Z. L.; Hussain, T.; Andersson, W. Ikegami; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. W.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kiese, P.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kupsc, A.; Koehn, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Y. B.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, M.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. N.; Zhang, Y. T.; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

    2016-01-01

    Using 482 pb(-1) of e(+) e(-) collision data collected at a center-of-mass energy of root s = 4.009 GeV with the BESIII detector, we measure the branching fractions of the decays D-s(+) -> u(+)v(u) and D-s(+) -> tau(+)v(tau). By constraining the ratio of decay rates of Ds(+) to tau(+)v(u) and to

  5. Evaluation of polymorphisms in pbp4 gene and genetic diversity in penicillin-resistant, ampicillin-susceptible Enterococcus faecalis from hospitals in different states in Brazil.

    Science.gov (United States)

    Infante, Victor Hugo Pacagnelli; Conceição, Natália; de Oliveira, Adriana Gonçalves; Darini, Ana Lúcia da Costa

    2016-04-01

    The aim of the present study was to verify whether penicillin-resistant, ampicillin-susceptible Enterococcus faecalis (PRASEF) occurred in Brazil prior to the beginning of the 21st century, and to verify whether ampicillin susceptibility can predict susceptibility to other β-lactams in E. faecalis with this inconsistent phenotype. The presence of polymorphisms in the pbp4 gene and genetic diversity among the isolates were investigated. Of 21 PRASEF analyzed, 5 (23.8%) and 4 (19.0%) were imipenem and piperacillin resistant simultaneously by disk diffusion and broth dilution respectively, contradicting the current internationally accepted standards of susceptibility testing. Sequencing of pbp4 gene revealed an amino acid substitution (Asp-573→Glu) in all PRASEF isolates but not in the penicillin-susceptible, ampicillin-susceptible E. faecalis. Most PRASEF (90.5%) had related pulsed-field gel electrophoresis profiles, but were different from other PRASEF described to date. Results demonstrate that penicillin-resistant, ampicillin-susceptible phenotype was already a reality in the 1990s in E. faecalis isolates in different Brazilian states, and some of these isolates were also imipenem- and piperacillin-resistant; therefore, internationally accepted susceptibility criteria cannot be applied to these isolates. According to pbp4 gene sequencing, this study suggests that a specific amino acid substitution in pbp4 gene found in all PRASEF analyzed is associated with penicillin resistance. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  6. Positive parity $D_s$ mesons

    CERN Document Server

    Leskovec, Luka; Mohler, Daniel; Prelovsek, Sasa; Woloshyn, R M

    2015-01-01

    We study the positive parity charmed strange mesons using lattice QCD, the only reliable ab initio method to study QCD at low energies. Especially the experimentally observed $D_{s0}^*(2317)$ and $D_{s1}(2460)$ have challenged theory for quite some time. The dynamical lattice QCD simulations are performed at two distinct pion masses, $m_{\\pi}$ = 266 MeV and 156 MeV, using both $\\bar{c}s$ as well as $DK$ and $D^*K$ scattering operators in the construction of the correlation matrix in order to take into the account threshold effects. While the $J^P = 0^+$ channel benefited most from the inclusion of scattering operators, it was also crucial for the case of the $D_{s1}(2460)$. Using the L\\"uscher method, which relates the finite volume spectrum to the infinite volume scattering matrix, we were able to determine the near threshold behavior of the scattering amplitude. From it we extracted the binding momenta and the masses of the below-threshold bound states $D_{s0}^*(2317)$ and $D_{s1}(2460)$ by determining the ...

  7. Positive Parity $D_s$ Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Leskovec, Luka [Stefan Inst., Ljubljana; Lang, C. B. [Graz U.; Mohler, Daniel [Fermilab; Prelovsek, Sasa [Stefan Inst., Ljubljana; Woloshyn, R. M. [TRIUMF

    2015-11-12

    We study the positive parity charmed strange mesons using lattice QCD, the only reliable ab initio method to study QCD at low energies. Especially the experimentally observed $D_{s0}^*(2317)$ and $D_{s1}(2460)$ have challenged theory for quite some time. The dynamical lattice QCD simulations are performed at two distinct pion masses, $m_{\\pi}$ = 266 MeV and 156 MeV, using both $\\bar{c}s$ as well as $DK$ and $D^*K$ scattering operators in the construction of the correlation matrix in order to take into the account threshold effects. While the $J^P = 0^+$ channel benefited most from the inclusion of scattering operators, it was also crucial for the case of the $D_{s1}(2460)$. Using the L\\"uscher method, which relates the finite volume spectrum to the infinite volume scattering matrix, we were able to determine the near threshold behavior of the scattering amplitude. From it we extracted the binding momenta and the masses of the below-threshold bound states $D_{s0}^*(2317)$ and $D_{s1}(2460)$ by determining the pole positions of the scattering amplitudes. Our results compare well with experiment, resolving a long standing discrepancy between theory and experiment.

  8. The Lepidoptera Odorant Binding Protein gene family: Gene gain and loss within the GOBP/PBP complex of moths and butterflies.

    Science.gov (United States)

    Vogt, Richard G; Große-Wilde, Ewald; Zhou, Jing-Jiang

    2015-07-01

    Butterflies and moths differ significantly in their daily activities: butterflies are diurnal while moths are largely nocturnal or crepuscular. This life history difference is presumably reflected in their sensory biology, and especially the balance between the use of chemical versus visual signals. Odorant Binding Proteins (OBP) are a class of insect proteins, at least some of which are thought to orchestrate the transfer of odor molecules within an olfactory sensillum (olfactory organ), between the air and odor receptor proteins (ORs) on the olfactory neurons. A Lepidoptera specific subclass of OBPs are the GOBPs and PBPs; these were the first OBPs studied and have well documented associations with olfactory sensilla. We have used the available genomes of two moths, Manduca sexta and Bombyx mori, and two butterflies, Danaus plexippus and Heliconius melpomene, to characterize the GOBP/PBP genes, attempting to identify gene orthologs and document specific gene gain and loss. First, we identified the full repertoire of OBPs in the M. sexta genome, and compared these with the full repertoire of OBPs from the other three lepidopteran genomes, the OBPs of Drosophila melanogaster and select OBPs from other Lepidoptera. We also evaluated the tissue specific expression of the M. sexta OBPs using an available RNAseq databases. In the four lepidopteran species, GOBP2 and all PBPs reside in single gene clusters; in two species GOBP1 is documented to be nearby, about 100 kb from the cluster; all GOBP/PBP genes share a common gene structure indicating a common origin. As such, the GOBP/PBP genes form a gene complex. Our findings suggest that (1) the lepidopteran GOBP/PBP complex is a monophyletic lineage with origins deep within Lepidoptera phylogeny, (2) within this lineage PBP gene evolution is much more dynamic than GOBP gene evolution, and (3) butterflies may have lost a PBP gene that plays an important role in moth pheromone detection, correlating with a shift from

  9. Structure-Activity Relationships of Different β-Lactam Antibiotics against a Soluble Form of Enterococcus faecium PBP5, a Type II Bacterial Transpeptidase

    Science.gov (United States)

    Hujer, Andrea M.; Kania, Malgosia; Gerken, Thomas; Anderson, Vernon E.; Buynak, John D.; Ge, Xiaoxia; Caspers, Patrick; Page, Malcolm G. P.; Rice, Louis B.; Bonomo, Robert A.

    2005-01-01

    Penicillin-binding proteins (PBPs) catalyze the essential reactions in the biosynthesis of cell wall peptidoglycan from glycopeptide precursors. β-Lactam antibiotics normally interfere with this process by reacting covalently with the active site serine to form a stable acyl-enzyme. The design of novel β-lactams active against penicillin-susceptible and penicillin-resistant organisms will require a better understanding of the molecular details of this reaction. To that end, we compared the affinities of different β-lactam antibiotics to a modified soluble form of a resistant Enterococcus faecium PBP5 (Δ1-36 rPBP5). The soluble protein, Δ1-36 rPBP5, was expressed in Escherichia coli and purified, and the NH2-terminal protein sequence was verified by amino acid sequencing. Using β-lactams with different R1 side chains, we show that azlocillin has greater affinity for Δ1-36 rPBP5 than piperacillin and ampicillin (apparent Ki = 7 ± 0.3 μM, compared to 36 ± 3 and 51 ± 10 μM, respectively). Azlocillin also exhibits the most rapid acylation rate (apparent k2 = 15 ± 4 M−1 s−1). Meropenem demonstrates an affinity for Δ1-36 rPBP5 comparable to that of ampicillin (apparent Ki = 51 ± 15 μM) but is slower at acylating (apparent k2 = 0.14 ± 0.02 M−1 s−1). This characterization defines important structure-activity relationships for this clinically relevant type II transpeptidase, shows that the rate of formation of the acyl-enzyme is an essential factor determining the efficacy of a β-lactam, and suggests that the specific side chain interactions of β-lactams could be modified to improve inactivation of resistant PBPs. PMID:15673741

  10. Multicenter Evaluation of a Modified Cefoxitin Disk Diffusion Method and PBP2a Testing To Predict mecA-Mediated Oxacillin Resistance in Atypical Staphylococcus aureus.

    Science.gov (United States)

    Miller, Shelley A; Karichu, James; Kohner, Peggy; Cole, Nicolynn; Hindler, Janet A; Patel, Robin; Richter, Sandra; Humphries, Romney M

    2017-02-01

    Phenotypic variants of Staphylococcus aureus that display small colonies, reduced pigmentation, and decreased hemolysis and/or coagulase activity are periodically isolated by the clinical laboratory. Antimicrobial susceptibility testing (AST) of these isolates is complicated, because many do not grow on routine AST media, including Mueller-Hinton agar (MHA) and cation-adjusted Mueller-Hinton broth. This multicenter study evaluated cefoxitin disk diffusion for 37 atypical S. aureus isolates (156 readings) with MHA supplemented with 5% sheep's blood (BMHA), using mecA PCR as the reference standard. The correlation of two commercial PBP2a assays with mecA PCR was also assessed. Ten isolates were negative and 27 positive for mecA No major errors for cefoxitin were observed, but 19.5% very major errors (VMEs) were observed at 24 h of incubation, and 17.2% VMEs were observed at 48 h. The proportions of VMEs ranged from 14.7 to 23.0% at 24 h, and from 13.3 to 17.6% at 48 h, across three testing laboratories. PBP2a tests were performed from growth on BMHA and blood agar plates (BAP), with and without cefoxitin disk induction. The Alere PBP2a SA culture colony test sensitivities for mecA were 90.0% with uninduced growth and 97.4% with induced growth from BMHA. On BAP, sensitivity was 96.0% with induced growth. The sensitivities of the Oxoid PBP2' latex agglutination test were 85.7% with uninduced growth and 93.9% with induced growth from BMHA and 95.9% with induced growth on BAP. On the basis of these data, we recommend that laboratories perform only mecA PCR and/or PBP2a tests when requested to perform AST on atypical isolates of S. aureus. Copyright © 2017 American Society for Microbiology.

  11. Observation of neutrino induced diffractive $D_s^{*+}$ production and subsequent decay $D_s^{*+} \\to D_s^+ \\to \\tau^+ \\to \\mu^+$

    CERN Document Server

    Annis, P; Artamonov, S A; Barbuto, E; Di Bartolomeo, A; Bonekämper, D; Bozza, C; Brooijmans, G; Brunner, J; Bülte, A; Buontempo, S; Capone, A; Cassol, F; Catanesi, M G; Chikawa, M; Cocco, A G; Cussans, D G; D'Ambrosio, N; Van Dantzig, R; De Lellis, G; De Pedis, D; Di Capua, E; Dore, U; El-Aidi, R; Ereditato, A; Favart, D; Ferreira, R; Fiorillo, G; Frekers, D; Goldberg, J; Gorbunov, P; Grégoire, G; Grella, G; Hara, T; Hérin, J; Hoshino, K; Iovane, G; Ishi, Y; De Jong, M; Kawamura, T; Kayis, A; Kazuno, M; Khovanskii, V D; Kodama, K; Komatsu, M; Konijn, J; Kotaka, Y; Kozaki, T; Litmaath, M; Loverre, P F; Ludovici, L; Meinhard, H; Melzer, O; Messina, M; Migliozzi, P; Miyanishi, M; Muciaccia, M T; Nakamura, K; Nakamura, M; Nakano, T; Niu, E; Niu, K; Niwa, K; Obayashi, Y; Ogawa, S; Okusawa, T; Oldeman, R G C; Onengüt, G; Øverås, H; Palladino, Vittorio; Panman, J; Papadopoulos, I M; Park, I G; Pesen, E; Piredda, G; Van der Poel, C A F J; Radicioni, E; Ricciardi, S; Righini, P; Romano, G; Rondeshagen, D; Rosa, G; Saltzberg, D; Saitta, B; Santacesaria, R; Sato, O; Sato, Y; Satta, A; Shamanov, V V; Shibuya, H; Simone, S; Song, J S; Sorrentino, S; Strolin, P; Tezuka, I; Tioukov, V; Tolun, P; Toshito, T; Tsenov, R V; Uiterwijk, J W E; Ushida, N; Van der Donckt, M; Van de Vyver, B L; Vilain, P; Visschers, J L; Vivolo, L; Weinheimer, C; Wilquet, G; Winter, Klaus; Wolff, T; Wong, H; Yoon, C S; Zeyrek, M T; Zucchelli, P

    1998-01-01

    We report on the first direct observation of a neutrino induced charged-current interaction with two subsequent decays of short-lived particles close to the interaction vertex. This rare double- kink signature in the CHORUS emulsion target is interpreted as a $D_s^{*+}$ production followed by the decay chain $D_s^{*+} \\rightarrow D_s^+ \\gamma, D_s^+ \\rightarrow \\tau^+ \

  12. Autodesk 3ds Max 2013 essentials

    CERN Document Server

    Derakhshani, Dariush

    2012-01-01

    A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.

  13. Autodesk 3ds Max 2012 Essentials

    CERN Document Server

    Derakhshani, Randi L

    2011-01-01

    Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,

  14. Autodesk 3ds Max 2014 bible

    CERN Document Server

    Murdock, Kelly L

    2013-01-01

    A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty

  15. Leptonic decays of the $D_s$ meson

    CERN Document Server

    Heister, A.; Barate, R.; De Bonis, I.; Decamp, D.; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Boix, G.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Drevermann, H.; Forty, R.W.; Frank, M.; Gianotti, F.; Greening, T.C.; Hansen, J.B.; Harvey, J.; Hutchcroft, D.E.; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schneider, O.; Sguazzoni, G.; Tejessy, W.; Teubert, F.; Valassi, A.; Videau, I.; Ward, J.; Badaud, F.; Falvard, A.; Gay, P.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Spagnolo, P.; Halley, A.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Thompson, A.S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C.K.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Pearson, M.R.; Robertson, N.A.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Settles, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Lefrancois, J.; Veillet, J.J.; Yuan, C.; Bagliesi, Giuseppe; Boccali, T.; Foa, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Misiejuk, A.; Strong, J.A.; Teixeira-Dias, P.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Konstantinidis, N.; Litke, A.M.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Ngac, A.; Prange, G.; Sieler, U.; Giannini, G.; He, H.; Putz, J.; Rothberg, J.; Armstrong, S.R.; Berkelman, Karl; Cranmer, K.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Pan, Y.B.; von Wimmersperg-Toeller, J.H.; Wiedenmann, W.; Wu, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.; Dissertori, G.

    2002-01-01

    The purely leptonic decays Ds -> tau nu and Ds -> mu nu are studied in a sample of four million hadronic Z decays collected with the ALEPH detector at the LEP e+e- collider from 1991 to 1995. The branching fractions are extracted from a combination of two analyses, one optimized to select Ds -> tau nu decays with tau -> e nu nubar or mu nu nubar, and the other optimized for Ds-> mu nu decays. The results are used to evaluate the Ds decay constant, within the Standard Model: fDs = [285 +- 19(stat) +- 40 (syst)] MeV.

  16. Inhibition of penicillin-binding protein 2a (PBP2a) in methicillin resistant Staphylococcus aureus (MRSA) by combination of ampicillin and a bioactive fraction from Duabanga grandiflora.

    Science.gov (United States)

    Santiago, Carolina; Pang, Ee Leen; Lim, Kuan-Hon; Loh, Hwei-San; Ting, Kang Nee

    2015-06-10

    The inhibition of penicillin-binding protein 2a (PBP2a) is a promising solution in overcoming resistance of methicillin resistance Staphylococcus aureus (MRSA). A potential approach in achieving this is by combining natural product with currently available antibiotics to restore the activity as well as to amplify the therapeutic ability of the drugs. We studied inhibition effects of a bioactive fraction, F-10 (isolated from the leaves of Duabanga grandiflora) alone and in combination with a beta-lactam drug, ampicillin on MRSA growth and expression of PBP2a. Additionally, phytochemical analysis was conducted on F-10 to identify the classes of phytochemicals present. Fractionation of the ethyl acetate leaf extract was achieved by successive column chromatography which eventually led to isolation of an active fraction, F-10. Both extract and F-10 were analyzed for the presence of major classes of phytochemicals in addition to obtaining a high performance liquid chromatography (HPLC) profile to reveal the complexity of the fraction F-10. Broth microdilution method was employed to determine minimum inhibitory concentration (MIC) of the extract and fractions against MRSA. Evaluation of synergistic activity of the active fraction with ampicillin was determined using checkerboard methodand kinetic growth experiments. Effect of combination treatments on expression of PBP2a, a protein that confers resistance to beta-lactam antibiotics, was elucidated with the Western blot assay. MIC of F-10 against MRSA was 750 mg/L which showed an improved activity by 4-fold compared to its crude extract (MIC = 3000 mg/L). Phytochemical analysis revealed occurrence of tannins, saponin, flavonoids, sterols, and glycosides in F10 fraction. In FIC index interpretation, the most synergistic activity was achieved for combinations of 1/64 × MIC ampicillin + 1/4 × MIC F-10. The combination also evidently inhibited MRSA growth in kinetic growth curve assay. As a result of this synergistic

  17. Results concerning the decay Ds+/--->η'π+/-

    Science.gov (United States)

    Alvarez, M. P.; Barate, R.; Bloch, D.; Bonamy, P.; Borgeaud, P.; Burchell, M.; Burmeister, H.; Brunet, J. M.; Calvino, F.; Cattaneo, M.; Crespo, J. M.; D'Almagne, B.; David, M.; Diciaccio, L.; Dixon, J.; Druet, P.; Duane, A.; Engel, J. P.; Ferrer, A.; Filippas, T. A.; Fokitis, E.; Forty, R. W.; Foucault, P.; Gazis, E. N.; Gerber, J. P.; Giomataris, Y.; Hofmokl, T.; Katsoufis, E. C.; Koratzinos, M.; Krafft, C.; Lefievre, B.; Lemoigne, Y.; Lopez, A.; Lui, W. K.; Magneville, C.; Maltezos, A.; McEwen, J. G.; Pattison, B.; Poutot, D.; Primout, M.; Rahmani, H.; Seez, C.; Six, J.; Strub, R.; Treille, D.; Triscos, P.; Tristram, G.; Villet, G.; Volte, A.; Wayne, M.; Websdale, D. M.; Wormser, G.; Zolnierowski, Y.

    1991-02-01

    A search for the decay Ds+-->η'π+η'-->ϱγ has been performed by the NA14/2 photoproduction experiment at CERN. A signal compatible with the Ds+ has been observed, leading to a ratio of branching fractions of Br(Ds+-->η'π+)/Br(Ds+-->φπ+)=2.5+/-1.0-0.4+1.5. A value of Br(D+-->η'π+)/Br(D+-->K-π+π+)<0.1 is set at 90% CL.

  18. Substitutions in PBP3 confer resistance to both ampicillin and extended-spectrum cephalosporins in Haemophilus parainfluenzae as revealed by site-directed mutagenesis and gene recombinants

    DEFF Research Database (Denmark)

    Wienholtz, Nanna H; Ciechanowski, Aynur Barut; Nørskov-Lauritsen, Niels

    2017-01-01

    using site-directed mutagenesis. Recombinants were also generated using PCR-amplified ftsI from clinical strains encoding multiple amino acid substitutions. MICs of ampicillin, cefuroxime, cefotaxime and ceftriaxone were determined using Etest ® . Results: Transformation of a susceptible strain with fts......I from clinical strains encoding four substitutions in the transpeptidase region of PBP3 conferred resistance to ampicillin, but not to cephalosporins. Introduction of ftsI from a clinical strain encoding eight substitutions conferred resistance to ampicillin, cefotaxime and ceftriaxone. MICs....../H/S in combination with V511A were resistant to ampicillin. Substitution S385T increased the MICs of third-generation cephalosporins if V511A was also present. Conclusions: Substitutions in PBP3 are sufficient to confer resistance to both ampicillin and third-generation cephalosporins in H. parainfluenzae...

  19. Autism and behavior in adult patients with Dravet syndrome (DS)

    NARCIS (Netherlands)

    Berkvens, J.J.; Veugen, I.; Veendrick-Meekes, M.J.; Snoeijen-Schouwenaars, F.M.; Schelhaas, H.J.; Willemsen, M.H.; Tan, I.Y.; Aldenkamp, A.P.

    2015-01-01

    INTRODUCTION: Autism and behavioral characteristics in adults with Dravet syndrome (DS) have rarely been systematically studied. METHOD: Three scales were used to assess the outcomes of DS in adulthood in terms of autism and behavior. All the adult patients with DS, nine male and four female, aged

  20. Avances y limitaciones en el uso de los dsRNA como estrategias de control y prevención de enfermedades virales en sistemas acuícolas/Progress and limitations of dsRNA strategies in the control of viral diseases in aquaculture

    National Research Council Canada - National Science Library

    Ljubomir Papic; Katherine García; Jaime Romero

    2015-01-01

    ... de peces activando mecanismos de defensa inmune innata. La definición de un adecuado sistema de suministro para asegurar el ingreso de los dsRNA a la célula objetivo ha resultado en pruebas medianamente exitosas. Sin embargo, el cómo suministrar el dsRNA para asegurar el ingreso al organismo en su hábitat natural, se presenta como la pr...

  1. 76 FR 58074 - 30-Day Notice of Proposed Information Collection: DS-7001 and DS-7005, DOS-Sponsored Academic...

    Science.gov (United States)

    2011-09-19

    ... Notice of Proposed Information Collection: DS-7001 and DS- 7005, DOS-Sponsored Academic Exchange Program... the Paperwork Reduction Act of 1995. Title of Information Collection: DOS-Sponsored Academic Exchange..., DS-7005. Respondents: Applicants for the Academic Exchange Program. Estimated Number of Respondents...

  2. Structure of large dsDNA viruses.

    Science.gov (United States)

    Klose, Thomas; Rossmann, Michael G

    2014-07-01

    Nucleocytoplasmic large dsDNA viruses (NCLDVs) encompass an ever-increasing group of large eukaryotic viruses, infecting a wide variety of organisms. The set of core genes shared by all these viruses includes a major capsid protein with a double jelly-roll fold forming an icosahedral capsid, which surrounds a double layer membrane that contains the viral genome. Furthermore, some of these viruses, such as the members of the Mimiviridae and Phycodnaviridae have a unique vertex that is used during infection to transport DNA into the host.

  3. Measurement of the branching fractions of Ds+→η′X and Ds+→η′ρ+ in e+e−→Ds+Ds−

    Directory of Open Access Journals (Sweden)

    M. Ablikim

    2015-11-01

    Full Text Available We study Ds+ decays to final states involving the η′ with a 482 pb−1 data sample collected at s=4.009 GeV with the BESIII detector at the BEPCII collider. We measure the branching fractions B(Ds+→η′X=(8.8±1.8±0.5% and B(Ds+→η′ρ+=(5.8±1.4±0.4% where the first uncertainty is statistical and the second is systematic. In addition, we estimate an upper limit on the non-resonant branching ratio B(Ds+→η′π+π0<5.1% at the 90% confidence level. Our results are consistent with CLEO's recent measurements and help to resolve the disagreement between the theoretical prediction and CLEO's previous measurement of B(Ds+→η′ρ+.

  4. Data Analysis Details (DS): SE41_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available tware without cut off value and peaks are extracted from the text files by PowerFT ...SE41_DS1 PowerGet analysis for detection of all peaks Raw data files are converted to text file by MSGet sof

  5. Data Analysis Details (DS): SE40_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available tware without cut off value and peaks are extracted from the text files by PowerFT ...SE40_DS1 PowerGet analysis for detection of all peaks Raw data files are converted to text file by MSGet sof

  6. Data Analysis Details (DS): SE25_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE25_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  7. Data Analysis Details (DS): SE16_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE16_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  8. Data Analysis Details (DS): SE8_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE8_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Powe

  9. Data Analysis Details (DS): SE26_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE26_DS1 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  10. Data Analysis Details (DS): SE13_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE13_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  11. Data Analysis Details (DS): SE10_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE10_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  12. Data Analysis Details (DS): SE9_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE9_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Powe

  13. Data Analysis Details (DS): SE27_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE27_DS1 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  14. Data Analysis Details (DS): SE11_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE11_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  15. Data Analysis Details (DS): SE17_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE17_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  16. Data Analysis Details (DS): SE12_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE12_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  17. Data Analysis Details (DS): SE4_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE4_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Powe

  18. Data Analysis Details (DS): SE5_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE5_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Powe

  19. Data Analysis Details (DS): SE14_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE14_DS3 PowerGet analysis for detection of all peaks (C3) Raw data files are converted to text... file by MSGet software without cut off value and peaks are extracted from the text files by Pow

  20. Data Analysis Details (DS): SE37_DS4 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE37_DS4 Labeled peak search by ShiftedIonsFinder The candidate labeled peaks were ...n unlabeled sample using ShiftedIonsFinder. The prepared basic sample and shifted samples were imported to ShiftedIonsFinde...sing the Join function. The exported file from ShiftedIonsFinder was arranged by Excel. ...

  1. Data Analysis Details (DS): SE37_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE37_DS3 Peak alignment and database search Peaks were aligned using PowerMatch. After editing the data manu...ally, common peaks among SE37_S01_M1_D1, SE37_S02_M1_D1, and SE37_S03_M1_D1 were se

  2. Data Analysis Details (DS): SE37_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE37_DS1 Peak extraction for unlabeled data In order to reduce noise peaks, the peaks were extract...t a cutoff value, and peaks were extracted from the text files by PowerFT with parameters (intensity cut off

  3. Data Analysis Details (DS): SE15_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE15_DS3 PowerGet analysis for detection of all peaks (C5) Raw data files are conve...erFT with parameters (intensity cut off in peak detection=30000, margin of ion grouping in peak detection=5, peak selection filter is default). ...

  4. Data Analysis Details (DS): SE7_DS2 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE7_DS2 PowerGet analysis for detection of all peaks (B4) Raw data files are conver...rFT with parameters (intensity cut off in peak detection=20000, margin of ion grouping in peak detection=5,

  5. Data Analysis Details (DS): SE6_DS2 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE6_DS2 PowerGet analysis for detection of all peaks (B4) Raw data files are conver...rFT with parameters (intensity cut off in peak detection=20000, margin of ion grouping in peak detection=5,

  6. Data Analysis Details (DS): SE7_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE7_DS3 PowerGet analysis for detection of all peaks (C4) Raw data files are conver...rFT with parameters (intensity cut off in peak detection=20000, margin of ion grouping in peak detection=5,

  7. Data Analysis Details (DS): SE15_DS2 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE15_DS2 PowerGet analysis for detection of all peaks (B5) Raw data files are conve...erFT with parameters (intensity cut off in peak detection=30000, margin of ion grouping in peak detection=5,

  8. Data Analysis Details (DS): SE6_DS3 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE6_DS3 PowerGet analysis for detection of all peaks (C4) Raw data files are conver...rFT with parameters (intensity cut off in peak detection=20000, margin of ion grouping in peak detection=5,

  9. Data Analysis Details (DS): SE19_DS1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE19_DS1 Identification of triacylglycerols with 2D maps Two-dimensional (2D) maps were constructed for effe...ctive profiling of triacylglycerols (TAGs), and individual structures of TAGs were correctly identified by the elution profile and MS/MS. ...

  10. Measurements of branching fractions of leptonic and hadronic Ds+ meson decays and extraction of the Ds+ meson decay constant

    CERN Document Server

    Zupanc, A; Aihara, H; Arinstein, K; Asner, D M; Aushev, T; Bakich, A M; Bala, A; Bhuyan, B; Bonvicini, G; Bozek, A; Bračko, M; Brodzicka, J; Browder, T E; Chang, M -C; Chang, P; Chekelian, V; Chen, A; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Dalseno, J; Danilov, M; Doležal, Z; Drásal, Z; Dutta, D; Eidelman, S; Farhat, H; Fast, J E; Ferber, T; Gaur, V; Gabyshev, N; Ganguly, S; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; Horii, Y; Hoshi, Y; Hou, W -S; Hsiung, Y B; Hyun, H J; Iijima, T; Inami, K; Ishikawa, A; Itoh, R; Iwasaki, Y; Iwashita, T; Jaegle, I; Julius, T; Kato, E; Kawai, H; Kawasaki, T; Kichimi, H; Kiesling, C; Kim, D Y; Kim, H O; Kim, J B; Kim, J H; Kim, M J; Kim, Y J; Kinoshita, K; Klucar, J; Ko, B R; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kumita, T; Kuzmin, A; Kwon, Y -J; Lange, J S; Lee, S -H; Li, J; Libby, J; Liu, Z Q; Liventsev, D; Lukin, P; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mussa, R; Nakano, E; Nakao, M; Nedelkovska, E; Nisar, N K; Nishida, S; Nitoh, O; Ogawa, S; Okuno, S; Pakhlova, G; Park, C W; Park, H; Park, H K; Pedlar, T K; Pestotnik, R; Petrič, M; Piilonen, L E; Prim, M; Ritter, M; Röhrken, M; Rostomyan, A; Ryu, S; Sahoo, H; Saito, T; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Schwartz, A J; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Solovieva, E; Starič, M; Steder, M; Sumiyoshi, T; Tamponi, U; Tanida, K; Tatishvili, G; Teramoto, Y; Trabelsi, K; Tsuboyama, T; Uchida, M; Uglov, T; Uno, S; Usov, Y; Vahsen, S E; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vorobyev, V; Wagner, M N; Wang, C H; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Won, E; Yamashita, Y; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V

    2013-01-01

    We present measurements of absolute branching fractions of hadronic and leptonic Ds+ decays to K- K+ pi+, anti-K0 K+, eta pi+, mu+ nu_mu and tau+ nu_tau and report a search for the leptonic Ds+ to e+ nu_e decays. The results are obtained from a large data sample collected at or near the Y(4S) and Y(5S) resonances with the Belle detector at the KEKB asymmetric-energy e+e- collider. The branching fractions of hadronic decays are measured to be Br(Ds+ -> K- K+ pi+) = (5.06 +- 0.15 +- 0.21)%, Br(Ds+ -> anti-K0 K+) = (2.95 +- 0.11 +- 0.09)%, and Br(Ds+ -> eta pi+) = (1.82 +- 0.14 +- 0.07)%, where the first and second uncertainties are statistical and systematic, respectively. The branching fractions of leptonic decays are measured to be Br(Ds+ -> mu+ nu_mu) = (0.531 +- 0.028 +- 0.020)%, and Br(Ds+ -> tau+ nu_tau) = (5.70 +- 0.21 +0.31-0.30)%, which are combined to determine the Ds+ meson decay constant f_Ds = (255.5 +- 4.2 +- 5.1) MeV. We find no significant signal for Ds+ -> e+ nu_e decays and set an upper limit ...

  11. $B_{s}^{0} \\rightarrow D_{s}^{+(*)} D_{s}^{-(*)}$ decays in LHCb

    CERN Multimedia

    Pritchard, A

    2014-01-01

    The decay of a $B_{s}^{0}$ meson to two oppositely charged $D_{s}$ mesons is one that is postulated to be almost exclusively CP even. Measuring the properties of this decay can therefore give important information about the behaviour of the $B_{s}^{0}$ system. This poster presents two of these measurements, made by LHCb, using data from run 1 of the LHC.

  12. A fluorescence sedimentation assay for dsDNA antibodies

    DEFF Research Database (Denmark)

    Duus, K; Draborg, A H; Güven, E

    2017-01-01

    on precipitation with polyethylene glycol (PEG) and fluorescence of EvaGreen intercalated in dsDNA as detection principle. As dsDNA antibodies are quantified using fluorescence, the disadvantages of working with radioactivity are eliminated. The Fluoro-Farr assay was developed and validated, and the diagnostic...

  13. Dynamics of dsRNA mycoviruses in black Aspergillus population.

    NARCIS (Netherlands)

    Diepeningen, van A.D.; Debets, A.J.M.; Hoekstra, R.F.

    2006-01-01

    Approximately 10% of all examined 668 representatives of black Aspergillus species, independent of worldwide location, were infected with double-stranded RNA (dsRNA) mycoviruses. These isometric viruses (25-40 nm diameter) contained a variety of often multiple segments of different dsRNA sizes

  14. Dynamics of dsRNA mycoviruses in black Aspergillus populations

    NARCIS (Netherlands)

    van Diepeningen, Anne D; Debets, Alfons J M; Hoekstra, Rolf F

    Approximately 10% of all examined 668 representatives of black Aspergillus species, independent of worldwide location, were infected with double-stranded RNA (dsRNA) mycoviruses. These isometric viruses (25-40 nm diameter) contained a variety of often multiple segments of different dsRNA sizes

  15. Crystallographic observation of pH-induced conformational changes in the Amyelois transitella pheromone-binding protein AtraPBP1.

    Directory of Open Access Journals (Sweden)

    Eric di Luccio

    Full Text Available The navel orangeworm, Amyelois transitella is a major agricultural pest causing large losses in a variety of tree crops. Control of this insect pest may be achieved by interfering with olfactory pathways to block detection of female-produced sex pheromones and consequently, disrupt mating. The first component of this pathway is the pheromone-binding protein AtraPBP1, which recognizes the pheromone and presents it to the odorant receptor housed in a sensory neuron of the male antennae. Release of the ligand depends on a pH-induced conformational change associated with the acidity of the membrane surface. To characterize this conformational change and to understand how pheromones bind, we have determined the high resolution crystal structures of AtraPBP1 in complex with two main constituents of the sex pheromone, i.e., (11Z,13Z-hexadecadienal and (11Z,13Z-hexadecadienol. Comparison with the structure of the unliganded form demonstrates a large ∼90° movement of the C-terminal helix which is observed in other pheromone- or odorant-binding proteins accompanied by an unpredicted 37° displacement of the N-terminal helix. Molecular dynamic trajectories suggest that the conformational change of the α1 helix facilitates the movement of the C-terminal helix.

  16. Contribution of ROB-1 and PBP3 mutations to the resistance phenotype of a β-lactamase-positive amoxicillin/clavulanic acid-resistant Haemophilus influenzae carrying plasmid pB1000 in Italy.

    Science.gov (United States)

    San Millan, Alvaro; Giufré, Maria; Escudero, Jose Antonio; Hidalgo, Laura; Gutierrez, Belen; Cerquetti, Marina; Gonzalez-Zorn, Bruno

    2011-01-01

    plasmid pB1000 bearing bla(ROB-1) is responsible for high-level β-lactam resistance in Haemophilus influenzae as well as in Pasteurella multocida and Haemophilus parasuis isolates from Spain. Here, we explore the presence of ROB-1 in Italy and investigate the relative contribution of penicillin-binding protein 3 (PBP3) mutations and ROB-1 to the β-lactam resistance phenotype in H. influenzae. the collection of the Italian Reference Laboratory of H. influenzae was investigated for ROB-1-positive isolates between 2004 and 2009. H. influenzae Rd KW20 was used as recipient for pB1000 electroporation and for mutagenesis of the ftsI gene encoding PBP3. the presence of plasmid pB1000 in a non-typeable H. influenzae isolated in Italy, BB1059, is reported in this work. This strain is not genetically related to the H. influenzae clinical isolates bearing pB1000 described in Spain. The sequence of ftsI from BB1059 revealed several mutations in the predicted amino acid sequence of PBP3. To determine the relative contribution of pB1000 and PBP3 mutations to the β-lactam resistance phenotype of BB1059, H. influenzae Rd KW20 was transformed with ftsI and/or pB1000 from BB1059. β-Lactam resistance profiles revealed the additive effect of pB1000 and PBP3 mutations conferring resistance to β-lactams, including amoxicillin/clavulanic acid and third-generation cephalosporins. intra-European spread of plasmid pB1000 among H. influenzae has been shown. The coexistence of plasmid pB1000 and mutations in PBP3 produces an additive resistance phenotype in H. influenzae.

  17. LHCb: Search for $D^{+}_{(s)} \\rightarrow \\pi^+ \\mu^+ \\mu^-$ and $D^{+}_{(s)} \\rightarrow \\pi^- \\mu^+ \\mu^+$ decays

    CERN Multimedia

    Greening, E

    2013-01-01

    A search for non-resonant $D^{+}_{(s)} \\rightarrow \\pi^+ \\mu^+ \\mu^-$ and $D^{+}_{(s)} \\rightarrow \\pi^- \\mu^+ \\mu^+$ decays is performed using 1.0 $fb^{-1}$ of proton-proton collisions at s = 7 TeV recorded by the LHCb experiment. No signals are observed and the world's best limits on the branching fractions are set.

  18. 76 FR 25733 - 60-Day Notice of Proposed Information Collection: DS-7001 and DS-7005, DOS-Sponsored Academic...

    Science.gov (United States)

    2011-05-05

    ... to identity qualified candidates for exchange activities sponsored by the Office of Academic Exchange... Notice of Proposed Information Collection: DS-7001 and DS- 7005, DOS-Sponsored Academic Exchange Program... of 1995. Title of Information Collection: DOS-Sponsored Academic Exchange Program Application. OMB...

  19. Measurement of the Pseudoscalar Decay Constant fDs Using Ds+ -> tau+ nu, tau+ -> rho+ anti-nu Decays

    CERN Document Server

    2009-01-01

    Analyzing 600/pb of e+e- collisions at 4170 MeV center-of-mass energy with the CLEO-c detector, we measure the branching fraction B(Ds+ -> tau+ nu)=(5.52\\pm 0.57\\pm 0.21)% using the tau+ -> rho^+ anti-nu decay mode. Combining with other CLEO measurements of B(Ds+ -> tau+ nu) we determine the pseudoscalar decay constant fDs = (259.7\\pm 7.8\\pm 3.4) MeV consistent with the value obtained from our Ds+ -> mu+ nu measurement of (257.6\\pm 10.3\\pm 4.3) MeV. Combining these measurements we find a value of fDs=(259.0 \\pm 6.2\\pm 3.0) MeV, that differs from the most accurate prediction based on unquenched lattice gauge theory of (241\\pm 3) MeV by 2.4 standard deviations. We also present the first measurements of B(Ds+ -> K0 pi+ pi0)=(1.00\\pm0.18\\pm 0.04)%, and B(Ds+ -> pi+ pi0 pi0)=(0.65\\pm0.13\\pm 0.03)%, and measure a new value for B(Ds+ -> eta rho+)=(8.9\\pm0.6\\pm0.5)%.

  20. Performance, digestibility, microbial production and carcass characteristics of feedlot young bulls fed diets containing propolis=Desempenho, digestibilidade, produção microbiana e características de carcaça de bovinos confinados que receberam dietas contendo própolis

    Directory of Open Access Journals (Sweden)

    Eduardo Marostegan de Paula

    2012-10-01

    Full Text Available The objective was to evaluate the effect of propolis-based products (PBP on performance, digestibility, microbial production and carcass characteristics of feedlot young bulls. Twenty-seven crossbred young bulls were used, with 353 ± 28 kg of body weight in a completely randomized experimental design, divided in three treatments: two diets with PBP with different dosages (PBP1= 0.018 mg g-1 and PBP2= 0.036 mg g-1 of total flavonoids in chrysin and control diet (CON. To determine total digestibility, the indigestible dry matter was used as an internal marker, while microbial production was estimated from purine derivatives in urine, collected by the spot method. The evaluated carcass characteristics were: hot carcass weight, dressing percentage, conformation, Longissimus muscle area, fat thickness, colour, texture, marbling, pH, cushion thickness and percentages of muscle, bone and fat. The studied variables were subjected to analysis of variance with 5% probability. The addition of propolis had no effect on DM and nutrients digestibility (except the ADF, which was higher or efficiency of microbial synthesis. Carcass characteristics were not affected by the experimental treatments. The PBP in the used dosages should be reviewed and higher dosages should be tested.Objetivou-se avaliar o efeito de produtos à base de própolis (PBP sobre o desempenho, digestibilidade, produção microbiana e características de carcaça de bovinos confinados. Foram utilizados 27 bovinos com 353 ± 28 kg de peso corporal em um delineamento inteiramente casualizado dividido em três tratamentos: duas dietas contendo PBP em diferentes dosagens (PBP1 = 0.018 mg g-1 e PBP2 = 0.036 mg g-1 de flavonoides totais em crisina e dieta controle (CON sem adição de própolis. Para a determinação da digestibilidade total, a matéria seca indigestível foi usada como marcador interno, enquanto a produção microbiana foi estimada pelos derivados de purina na urina, coletadas

  1. Observation of the decays B- to Ds(*)+ K- pi-

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We report first observations of the decays B- to Ds(*)+ K- pi-, using 292 fb^-1 of data collected at Upsilon(4S) resonance energy by the BaBar detector at the PEP II e+ e- collider. The branching fractions are measured to be B(B- to Ds+ K- pi-) = (1.88 +- 0.13 +- 0.41) x 10^-4 and B(B- to Ds*+ K- pi-) = (1.84 +- 0.19 +- 0.40) X 10^-4.

  2. Rapid bench identification of methicillin-sensitive and methicillin-resistant Staphylococcus aureus: A multicenter comparative evaluation of Alere PBP2a Culture Colony Test (Alere) Versus Slidex MRSA detection (bioMérieux).

    Science.gov (United States)

    Tasse, Jason; Dupieux, Céline; Caillon, Jocelyne; Lanotte, Philippe; Lamy, Brigitte; Aissa, Nejla; Bemer, Pascale; Mereghetti, Laurent; Michon, Anne-Laure; Lozniewski, Alain; Bes, Michèle; Trouillet-Assant, Sophie; Laurent, Frédéric

    2016-08-01

    Using 30 clinical isolates of Staphylococcus aureus representative of the most prevalent clones circulating in France, the performance of the Alere™ PBP2a Culture Colony Test (CCT) and the Slidex(®) MRSA detection kit (SMD) were compared in 5 different labs. CCT demonstrated better performance and was easier to conduct in routine. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Commentary: PhDs in Biochemistry Education--5 Years Later

    Science.gov (United States)

    Offerdahl, Erika G.; Momsen, Jennifer L.; Osgood, Marcy

    2014-01-01

    In this commentary, the discussion of PhDs in biochemistry education research is expanded to explore a number of diverse pathways leading to a competitive research program in biochemistry education research.

  4. A putative low-molecular-mass penicillin-binding protein (PBP) of Mycobacterium smegmatis exhibits prominent physiological characteristics of DD-carboxypeptidase and beta-lactamase.

    Science.gov (United States)

    Bansal, Ankita; Kar, Debasish; Murugan, Rajagopal A; Mallick, Sathi; Dutta, Mouparna; Pandey, Satya Deo; Chowdhury, Chiranjit; Ghosh, Anindya S

    2015-05-01

    DD-carboxypeptidases (DD-CPases) are low-molecular-mass (LMM) penicillin-binding proteins (PBPs) that are mainly involved in peptidoglycan remodelling, but little is known about the dd-CPases of mycobacteria. In this study, a putative DD-CPase of Mycobacterium smegmatis, MSMEG_2433 is characterized. The gene for the membrane-bound form of MSMEG_2433 was cloned and expressed in Escherichia coli in its active form, as revealed by its ability to bind to the Bocillin-FL (fluorescent penicillin). Interestingly, in vivo expression of MSMEG_2433 could restore the cell shape oddities of the septuple PBP mutant of E. coli, which was a prominent physiological characteristic of DD-CPases. Moreover, expression of MSMEG_2433 in trans elevated beta-lactam resistance in PBP deletion mutants (ΔdacAdacC) of E. coli, strengthening its physiology as a dd-CPase. To confirm the biochemical reason behind such physiological behaviours, a soluble form of MSMEG_2433 (sMSMEG_2433) was created, expressed and purified. In agreement with the observed physiological phenomena, sMSMEG_2433 exhibited DD-CPase activity against artificial and peptidoglycan-mimetic DD-CPase substrates. To our surprise, enzymic analyses of MSMEG_2433 revealed efficient deacylation for beta-lactam substrates at physiological pH, which is a unique characteristic of beta-lactamases. In addition to the MSMEG_2433 active site that favours dd-CPase activity, in silico analyses also predicted the presence of an omega-loop-like region in MSMEG_2433, which is an important determinant of its beta-lactamase activity. Based on the in vitro, in vivo and in silico studies, we conclude that MSMEG_2433 is a dual enzyme, possessing both DD-CPase and beta-lactamase activities. © 2015 The Authors.

  5. Determination of the branching fractions of B-s(0) -> D-s(-/+) K--/+ and B-0 -> Ds-K+

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M. -O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brett, D.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Gomez, M. Calvo; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Akiba, K. Carvalho; Mohr, R. C. M. Casanova; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Chen, S.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A. C.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Domenico, A.; Di Ruscio, F.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dossett, D.; Dovbnya, A.; Dreimanis, K.; Dujany, G.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. -M.; Evans, T.; Falabella, A.; Faerber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Albor, V. Fernandez; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fol, P.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Torreira, A. Gallas; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Pardinas, J. Garcia; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gascon, D.; Gaspar, C.; Gastaldi, U.; Gauld, R.; Gavardi, L.; Gazzoni, G.; Geraci, A.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani, S.; Gibson, V.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gotti, C.; Gandara, M. Grabalosa; Diaz, R. Graciani; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kelsey, M.; Kenyon, I. R.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Likhomanenko, T.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lowdon, P.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Benito, C. Marin; Marino, P.; Maerki, R.; Marks, J.; Martellotti, G.; Martinelli, M.; Santos, D. Martinez; Vidal, F. Martinez; Tostes, D. Martins; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. -N.; Moggi, N.; Rodriguez, J. Molina; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. -B.; Mountain, R.; Muheim, F.; Mueller, K.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Orlandea, M.; Rodrigues, B. Osorio; Goicochea, J. M. Otalora; Otto, A.; Owen, P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Olloqui, E. Picatoste; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Casasus, M. Plo; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redi, F.; Reichert, S.; Reid, M. M.; dos Reis, A. C.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Molina, V. Rives; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Perez, P. Rodriguez; Roiser, S.; Romanovsky, V.; Vidal, A. Romero; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Valls, P. Ruiz; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Guimaraes, V. Salustino; Mayordomo, C. Sanchez; Sedes, B. Sanmartin; Santacesaria, R.; Rios, C. Santamarina; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R. Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skillicorn, I.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; De Paula, B. Souza; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Sterpka, F.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Todd, J.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M. T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M. Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Barbosa, J. V. V. B. Viana; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wilkinson, G.; Wilkinson, M.; Williams, M. P.; Williams, M.; Wilschut, H. W.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.

    2015-01-01

    Measurements are presented of the branching fractions of the decays B-s(0) -> D-s(-/+) K--/+ and B-0 -> Ds-K+ relative to the decays B-s(0) -> D-s(-)pi(+) and B-0 -> D-s(-)pi(+), respectively. The data used correspond to an integrated luminosity of 3.0 fb(-1) of proton-proton collisions. The ratios

  6. Unique Thermal Stability of Unnatural Hydrophobic Ds Bases in Double-Stranded DNAs.

    Science.gov (United States)

    Kimoto, Michiko; Hirao, Ichiro

    2017-10-20

    Genetic alphabet expansion technology, the introduction of unnatural bases or base pairs into replicable DNA, has rapidly advanced as a new synthetic biology area. A hydrophobic unnatural base pair between 7-(2-thienyl)imidazo[4,5-b]pyridine (Ds) and 2-nitro-4-propynylpyrrole (Px) exhibited high fidelity as a third base pair in PCR. SELEX methods using the Ds-Px pair enabled high-affinity DNA aptamer generation, and introducing a few Ds bases into DNA aptamers extremely augmented their affinities and selectivities to target proteins. Here, to further scrutinize the functions of this highly hydrophobic Ds base, the thermal stabilities of double-stranded DNAs (dsDNA) containing a noncognate Ds-Ds or G-Ds pair were examined. The thermal stability of the Ds-Ds self-pair was as high as that of the natural G-C pair, and apart from the generally higher stability of the G-C pair than that of the A-T pair, most of the 5'-pyrimidine-Ds-purine-3' sequences, such as CDsA and TDsA, exhibited higher stability than the 5'-purine-Ds-pyrimidine-3' sequences, such as GDsC and ADsC, in dsDNAs. This trait enabled the GC-content-independent control of the thermal stability of the designed dsDNA fragments. The melting temperatures of dsDNA fragments containing the Ds-Ds pair can be predicted from the nearest-neighbor parameters including the Ds base. In addition, the noncognate G-Ds pair can efficiently distinguish its neighboring cognate natural base pairs from noncognate pairs. We demonstrated that real-time PCR using primers containing Ds accurately detected a single-nucleotide mismatch in target DNAs. These unique properties of the Ds base that affect the stabilities of the neighboring base pairs could impart new functions to DNA molecules and technologies.

  7. Ac-induced disruption of the doubleDs structure in tomato

    NARCIS (Netherlands)

    Rommens, Caius M.T.; Biezen, Erik A. van der; Ouwerkerk, Pieter B.F.; Nijkamp, H. John J.; Hille, Jacques

    1991-01-01

    The maize doubleDs element is stably maintained in the tomato genome. Upon the subsequent introduction of Ac into a plant containing doubleDs, disruption of the doubleDs structure and DNA rearrangements at the site of the doubleDs element were observed. No indications were obtained for excision of

  8. Evidence for the Rare Decay B+ --> Ds+ pi0

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Harrison, T J; Hart, A J; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Martin, E C; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Zhang, L; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Albert, J; Chen, E; Cheng, C H; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Kaiser, S; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F R; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Potter, C T; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; Leruste, P; Malcles, J; Ocariz, J; Gladney, L; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; Franek, B; Olaiya, E O; Ricciardi, S; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Wulsin, H W; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Oyanguren, A; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We have searched for the rare decay B+ --> Ds+ pi0. The analysis is based on a sample of 232 million Upsilon(4S) --> B anti-B decays collected with the BABAR detector at the PEP-II e+ e- storage ring. We find 19.6 signal events, corresponding to a significance of 4.7 sigma. The extracted signal yield including statistical and systematic uncertainties is 20.1+6.8+0.4 -6.0-1.5, and we measure B(B+ --> Ds+ pi0) =(1.5 +0.5 -0.4 +- 0.1 +- 0.2) 10^-5, where the first uncertainty is statistical, the second is systematic, and the last is due to the uncertainty on the Ds+ decay and its daughter decay branching fractions.

  9. Reflections on DS/AHP: lessons to be learnt

    OpenAIRE

    Beynon, Malcolm James

    2014-01-01

    DS/AHP is a technique for multi-criteria decision making (MCDM), based on the Dempster-Shafer Theory of evidence (DST) and the Analytic Hi-erarchy Process (AHP). Since its introduction it has been developed and ap-plied by a number of authors, as well as form the foundation for other DST re-lated MCDM techniques. This paper reviews the evolution and impact of DS/AHP, culminating in a critical perspective, over relevant criteria, namely i) Ease of understanding, ii) A champion, iii) Software d...

  10. First Observation and Measurement of the Branching Fraction for the Decay $B^0_S \\rightarrow D{_S}^* K$

    CERN Multimedia

    Sestini, Lorenzo

    2015-01-01

    The Bs -> Ds* K and Bs -> Ds* \\pi decays are of paramount interest as they can be used, combined with Bs -> Ds K and Bd -> D* \\pi, to measure the weak phase \\gamma. We present the first observation of the Bs -> Ds* K decay, where Ds* are reconstructed through the decay chain Ds* -> Ds (-> K K \\pi) \\gamma, using an integrated luminosity of 3.0 fb^{-1} recorded by the LHCb experiment.

  11. Measurement of the $D_s^+ - D_s^-$ production asymmetry in 7 TeV pp collisions

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    Heavy quark production in 7 TeV centre-of-mass energy $pp$ collisions at the LHC is not necessarily flavour symmetric. The production asymmetry, $A_P$, between $D_s^+$ and $D_s^-$ mesons is studied using the $\\phi\\pi^\\pm$ decay mode in a data sample of 1.0 fb$^{-1}$ collected with the LHCb detector. The difference between $\\pi^+$ and $\\pi^-$ detection efficiencies is determined using the ratios of fully reconstructed to partially reconstructed $D^{*\\pm}$ decays. The overall production asymmetry in the $D_s$ rapidity region 2.0 to 4.5 with transverse momentum larger than 2 GeV is measured to be $A_P=(-0.33 \\pm 0.22 \\pm 0.10)\\%$. This result can constrain models of heavy flavour production.

  12. Naturally occurring V region connected antibodies inhibit anti-dsDNA antibody reactivity with dsDNA.

    Science.gov (United States)

    Srdic-Rajic, Tatjana; Jurisic, Vladimir; Andrejevic, Sladjana; Bonaci-Nikolic, Branka; Bowker, Timothy; Concas, Daniela; Metlas, Radmila

    2012-01-01

    The production of autoantibodies against a vast array of self antigens, most notably double stranded (ds) DNA, characterized systemic lupus erythematosus (SLE). The purpose of this work is to study specific Ig fractions isolated from normal human serum (NHS) and their effect on the binding of anti-double-stranded deoxyribonucleic acid (dsDNA) antibodies (Abs) to dsDNA. A fraction named immunoglobulin G (IgG)-reactive IgG was purified from total NHS IgG by absorption onto (CNBr)-activated Sepharose 4B linked to intact IgG molecules (IgG-Sepharose column). IgG-reactive IgG was co-incubated with systemic lupus erythematosus (SLE) patient's serum and binding of the anti-dsDNA Abs to dsDNA was measured by enzyme-linked immunosorbent assay (ELISA). Co-incubation of SLE patient's serum with IgG-reactive IgG resulted in a dose-dependent reduction in binding of anti-dsDNA Abs to dsDNA. A reduction greater than 70% was observed at a concentration of 300 μg of IgG-reactive IgG per mL of a 400-fold diluted SLE patient's serum whereas total NHS IgG, at the same concentration, resulted in a 10% reduction in binding. The purification process used to isolate IgG-reactive IgG was based on interactions between intact Ig rather than on interactions between F(ab')(2) portions. IgG(2) is the predominant immunoglobulin (Ig) subclass in IgG-reactive IgG. Thus, IgG(2) might have an important role in the connectivity characteristics of NHS IgG. The capacity of IgG-reactive IgG to inhibit anti-DNA Ab binding to dsDNA may have potential application in the treatment of SLE. This targeted biological approach may provide an alternative strategy to immunosuppressants. Copyright © 2011 Elsevier GmbH. All rights reserved.

  13. Sequence Selection and Performance in DS/CDMA Systems

    Directory of Open Access Journals (Sweden)

    Jefferson Santos Ambrosio

    2016-03-01

    Full Text Available In this work key concepts on coding division multiple access (CDMA communication systems have been discussed. The sequence selection impact on the performance and capacity of direct sequence CDMA (DS/CDMA systems under AWGN and increasing system loading, as well as under multiple antennas channels was investigated.

  14. PhDs by Publications: An "Easy Way Out"?

    Science.gov (United States)

    Niven, Penelope; Grant, Carolyn

    2012-01-01

    PhDs by publications are a relatively new model for doctoral research, especially in the context of the Humanities or Education. This paper describes two writers' experiences of conducting doctoral studies in this genre and in these faculties. Each discover alternative ways of employing a body of published research papers in development of an…

  15. Statistical Inconsistencies in the KiDS-450 Dataset

    Science.gov (United States)

    Efstathiou, George; Lemos, Pablo

    2018-01-01

    The Kilo-Degree Survey (KiDS) has been used in several recent papers to infer constraints on the amplitude of the matter power spectrum and matter density at low redshift. Some of these analyses have claimed tension with the Planck ΛCDM cosmology at the ˜2 - 3σ level, perhaps indicative of new physics. However, Planck is consistent with other low redshift probes of the matter power spectrum such as redshift space distortions and the combined galaxy-mass and galaxy-galaxy power spectra. Here we perform consistency tests of the KiDS data, finding internal tensions for various cuts of the data at ˜2.2 - 3.5σ significance. Until these internal tensions are understood, we argue that it is premature to claim evidence for new physics from KiDS. We review the consistency between KiDS and other weak lensing measurements of S8, highlighting the importance of intrinsic alignments for precision cosmology.

  16. Commentary: PhDs in biochemistry education-5 years later.

    Science.gov (United States)

    Offerdahl, Erika G; Momsen, Jennifer L; Osgood, Marcy

    2014-01-01

    In this commentary, the discussion of PhDs in biochemistry education research is expanded to explore a number of diverse pathways leading to a competitive research program in biochemistry education research. © 2013 by The International Union of Biochemistry and Molecular Biology.

  17. Data of evolutionary structure change: 1DS8L-1AIGM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DS8L-1AIGM 1DS8 1AIG L M -----------------ALLSFERKYRVPGGTLV--GGNLFDFWVGPFYVGFFGVA...WQWWVKLPWWANIPGGING YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFT...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM VGPFSTLLGWFG...1AIG M 1AIGM YGLSFAAPLKE

  18. Data of evolutionary structure change: 1DS8M-2GMRL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DS8M-2GMRL 1DS8 2GMR M L YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVL...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL... 2GMR L 2GMRL 2GMR L 2GMRL 2 2GMR L 2GMRL

  19. Data of evolutionary structure change: 1DS8R-2GMRM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DS8R-2GMRM 1DS8 2GMR R M ----------------ALLSFERKYRVPGG--TLVGGNLFDFWVGPFYVGFFGVAT...WWQWWVKLPWWANIPGGING QNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFT...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL... 2GMR M 2GMRM 2GMR M 2GMRM

  20. Measurement of the Decay Constant $f_D{_S^+}$ using $D_S^+ --> ell^+ nu

    CERN Document Server

    Artuso, M

    2007-01-01

    We measure the decay constant fDs using the Ds -> l+ nu channel, where the l+ designates either a mu+ or a tau+, when the tau+ -> pi+ nu. Using both measurements we find fDs = 274 +-13 +- 7 MeV. Combining with our previous determination of fD+, we compute the ratio fDs/fD+ = 1.23 +- 0.11 +- 0.04. We compare with theoretical estimates.

  1. Network anomaly detection system with optimized DS evidence theory.

    Science.gov (United States)

    Liu, Yuan; Wang, Xiaofeng; Liu, Kaiyu

    2014-01-01

    Network anomaly detection has been focused on by more people with the fast development of computer network. Some researchers utilized fusion method and DS evidence theory to do network anomaly detection but with low performance, and they did not consider features of network-complicated and varied. To achieve high detection rate, we present a novel network anomaly detection system with optimized Dempster-Shafer evidence theory (ODS) and regression basic probability assignment (RBPA) function. In this model, we add weights for each sensor to optimize DS evidence theory according to its previous predict accuracy. And RBPA employs sensor's regression ability to address complex network. By four kinds of experiments, we find that our novel network anomaly detection model has a better detection rate, and RBPA as well as ODS optimization methods can improve system performance significantly.

  2. Molecular cloning of dsRNAs associated with strawberry mottle virus

    NARCIS (Netherlands)

    Schoen, C.D.; Miglino, R.; Jelkmann, W.; Leone, G.

    1998-01-01

    Strawberry mottle virus was transmitted from Fragaria vesca to Chenopodium quinoa and Nicotiana occidentalis 37B. In all plants, SMoV infection-associated dsRNA was detected but dsRNA patterns showed some differences between the herbaceous hosts. The differences were more evident when the dsRNA

  3. Astro-WISE for KiDS survey production and quality control

    NARCIS (Netherlands)

    Kleijn, G.V.; de Jong, Jelte; Valentijn, E.; Kuijken, K.; Consortiums, KiDS; Consortium, Astro-WISE; Ballester, P.; Egret, D.; Lorente, N.P.F.

    The Kilo Degree Survey (KiDS) is a 1500 square degree optical imaging survey with the recently commissioned OmegaCAM wide-field imager on the VLT Survey Telescope (VST). A suite of data products will be delivered to ESO and the community by the KiDS survey team. Spread over Europe, the KiDS team

  4. Norm for last på konstruktioner DS410

    DEFF Research Database (Denmark)

    Hertz, Kristian

    The fire chapter of the Danish Code of Practice for Loads for the Design of Structures DS410 contains definitions of basic concepts and principles of calculation and thermal fire load, and calculation methods for nominal fire courses and for parametric fire courses and modification for thermal...... inertia of the fire compartment. The calculation method for assessing the fully developed parametric fire course has been made by Kristian Hertz....

  5. Earth and Space Science PhDs: Class of 2000

    Science.gov (United States)

    Giesler, J.

    2001-12-01

    The American Geophysical Union (AGU) and the American Geological Institute (AGI) have been collecting data on recent PhDs in the geosciences for 5 years (1996-2000). Over these years continual improvement has been recorded in the job market through indicators such as time to find employment and starting salaries. As these indicators continue to improve, so too does the perception of the job market in general. There are several characteristics that are unique to PhDs in the geosciences. Unlike physical science graduates, there is a significant number who have been working full-time at least one year prior to earning their PhD. Recent graduates employed prior to graduation are heavily concentrated in Solid Earth Geology (41%) followed by Atmospheric Sciences (19%) and Oceanography (12%). A second distinguishable feature of Earth & space science PhDs is their age. Each year there is a higher percentage of recent graduates over the age of 40: 16% in 1998, 20% in 1999, and 23% in 2000. In 2000, the average time between earning a B.S. and starting a graduate program was 4.6 years. Both 1999 and 2000 show a drop in the overall numbers of postdoctoral appointments. This suggests that greater than 50% of the recent graduates are finding full-time permanent employment. Of the geoscience subfields, oceanography has greatest number of people obtaining employment outside the field.

  6. A dsRNA virus with filamentous viral particles.

    Science.gov (United States)

    Jia, Hengxia; Dong, Kaili; Zhou, Lingling; Wang, Guoping; Hong, Ni; Jiang, Daohong; Xu, Wenxing

    2017-08-01

    Viruses with double-stranded RNA genomes form isometric particles or are capsidless. Here we report a double-stranded RNA virus, Colletotrichum camelliae filamentous virus 1 (CcFV-1) isolated from a fungal pathogen, that forms filamentous particles. CcFV-1 has eight genomic double-stranded RNAs, ranging from 990 to 2444 bp, encoding 10 putative open reading frames, of which open reading frame 1 encodes an RNA-dependent RNA polymerase and open reading frame 4 a capsid protein. When inoculated, the naked CcFV-1 double-stranded RNAs are infectious and induce the accumulation of the filamentous particles in vivo. CcFV-1 is phylogenetically related to Aspergillus fumigatus tetramycovirus-1 and Beauveria bassiana polymycovirus-1, but differs in morphology and in the number of genomic components. CcFV-1 might be an intermediate virus related to truly capsidated viruses, or might represent a distinct encapsidating strategy. In terms of genome and particle architecture, our findings are a significant addition to the knowledge of the virosphere diversity.Viruses with double-stranded RNA (dsRNA) genomes form typically isometric particles or are capsid-less. Here, the authors identify a mycovirus with an eight-segmented dsRNA genome that forms exceptionally long filamentous particles and could represent an evolutionary link between ssRNA and dsRNA viruses.

  7. $B0 \\to Ds^{(*)}Ds^{(*)}$ and outlook of $B0 \\to D^{(*)}D$ at LHCb

    CERN Multimedia

    Belloli, Nicoletta

    2016-01-01

    The measurement of the inclusive branching fraction of $B0s \\to Ds^{(*)+} Ds^{(*)-}$ decay together with its contribution to the determination of $\\Delta \\Gamma{s}/ \\Gamma {s}$ are presented. The branching fraction value is compatible with results from previous experiments, improving the world average. The $B0 \\to D^+D^-$ and $B0 \\to D^*D^{(*)}$ decays are used to measure the parameters associated with $CP$ Violation in those channels; while the analysis associated to the second channel is at an initial stage the first one is almost concluded, the values obtained for the sensitivity on the $CP$ observables show that LHCb can rival the results obtained by previous experiments.

  8. Production and decay of the isotope {sup 271}Ds (Z=110)

    Energy Technology Data Exchange (ETDEWEB)

    Morita, K.; Morimoto, K.; Haba, H.; Ideguchi, E.; Kanungo, R.; Katori, K.; Ohnishi, T.; Ozawa, A.; Suda, T.; Tanihata, I.; Yoneda, A.; Yoshida, A. [RIKEN (The Institute of Physical and Chemical research), 351-0198, Wako-shi, Saitama (Japan); Kaji, D. [RIKEN (The Institute of Physical and Chemical research), 351-0198, Wako-shi, Saitama (Japan); Niigata University, 950-2181, Ikarashi, Niigata (Japan); Koura, H. [RIKEN (The Institute of Physical and Chemical research), 351-0198, Wako-shi, Saitama (Japan); Advanced Research Institute for Science and Engineering, Waseda University, Okubo, Shinjuku-ku, 169-8555, Tokyo (Japan); Kudo, H. [Niigata University, 950-2181, Ikarashi, Niigata (Japan); Sueki, K. [University of Tsukuba, 3058577, Tsukuba, Ibaragi (Japan); Xu, H. [Institute of Modern Physics, Chinese Academy of Science, 730000, Lanzhou (China); Yeremin, A.V. [Flerov Laboratory of Nuclear Reactions, JINR, RU-141 980, Dubna (Russian Federation); Zhao, Y.L. [Institute of High Energy Physics, Chinese Academy of Science, 100039, Beijing (China); Zheng, T. [School of Physics, Peking University, 100871, Beijing (China)

    2004-08-01

    Production and decay of the isotope {sup 271}Ds were studied. The isotope was produced by {sup 208}Pb + {sup 64}Ni {yields}{sup 271}Ds + n reaction. Fourteen {alpha}-decay chains have been assigned to decays originating from the isotope {sup 271}Ds. An excitation function of the production of this isotope was measured. The results have provided a good confirmation of production and decay of {sup 271}Ds reported by Hofmann et al. The presence of an isomeric state in {sup 271}Ds has been confirmed. The existence of a possible isomeric state in {sup 267}Hs is presented. (orig.)

  9. Immunological mimicry of PrPC-PrPSc interactions: antibody-induced PrP misfolding.

    Science.gov (United States)

    Li, Li; Guest, Will; Huang, Alan; Plotkin, Steven S; Cashman, Neil R

    2009-08-01

    Prion diseases are associated with the conversion of cellular prion protein (PrP(C)) to an abnormal protease-resistant conformational isoform (PrP(Sc)) by template-directed conversion. The interaction between PrP(C) and PrP(Sc) is mediated by specific sites which have been mapped to six putative 'binding and conversion domains' (PrP-BCD) through peptide and antibody competition studies. Monoclonal antibodies (mAbs) directed against the bityrosine motif Tyr-Tyr-Arg (YYR) specifically recognize PrP(Sc) and other misfolded PrP species. Here, we report that select bead-bound PrP-BCD mAbs induce exposure of bityrosine epitopes on mouse brain PrP. By competition immunoprecipitation, we show that PrP-BCD mAb-induced bityrosine exposure occurs at alpha-helices 1 and 3. However, PrP-BCD mAb-induced PrP(C) misfolding is not accompanied by beta-sheet dissociation, a key event in PrP(C) conversion to PrP(Sc), and is not associated with acquisition of protease resistance, or the capacity to recruit additional molecules of PrP. Our data suggest that mAb mimics of the physical interaction of PrP(C) with PrP(Sc) can induce unfolding of specific PrP domains, but that subsequent processes (including the energetically unfavorable beta-sheet dissociation) effect isoform conversion in prion disease.

  10. H1DS: A new web-based data access system

    Energy Technology Data Exchange (ETDEWEB)

    Pretty, D.G., E-mail: david.pretty@anu.edu.au; Blackwell, B.D.

    2014-05-15

    Highlights: • We present H1DS, a new RESTful web service for accessing fusion data. • We examine the scalability and extensibility of H1DS. • We present a fast and user friendly web browser client for the H1DS web service. • A summary relational database is presented as an application of the H1DS API. - Abstract: A new data access system, H1DS, has been developed and deployed for the H-1 Heliac at the Australian Plasma Fusion Research Facility. The data system provides access to fusion data via a RESTful web service. With the URL acting as the API to the data system, H1DS provides a scalable and extensible framework which is intuitive to new users, and allows access from any internet connected device. The H1DS framework, originally designed to work with MDSplus, has a modular design which can be extended to provide access to alternative data storage systems.

  11. M-ds-P21 induces cell apoptosis in bladder cancer T24 cells through P53 independent pathway.

    Science.gov (United States)

    Wang, Haifeng; Liu, Wujiang; Jin, Jie; Zhou, Liqun; Liang, Lili; Guo, Yinglu

    2013-01-01

    To investigate the effect of M-ds-P21 on the apoptosis of bladder cancer T24 cells and its potential mechanism. Effect of M-ds-P21 on T24 cells were assessed by cell morphology and Western blot. Apoptosis was quantified by Annexin-V flow-cytometry analysis. To uncover the role of P53 in M-ds-P21-mediated apoptosis of T24 cells, we knocked down P53 before treating cells with M-ds-P21, and then assayed P21 and apoptosis-related protein by Western blot. To uncover the mechanism by which M-ds-P21 played stronger effect than ds-P21, we performed confocal microscope analyses. Both M-ds-P21 and ds-P21 treatment changed the cell morphology, leading to cell apoptosis after 3 days. Apoptosis induced by M-ds-P21 and ds-P21 treatment is not P53-dependent but caspase-dependent. Compared with ds-P21, M-ds-P21 significantly increased the bioavailability of ds-RNA in T24 cells. M-ds-P21 treatment induces more apoptotic population than ds-P21 does. The mechanism for stronger effect of M-ds-P21 is partly due to the enhanced bioavailability of ds-RNA in human bladder cancer T24 cells, and not P53-dependent but caspase-dependent.

  12. M-ds-P21 induces cell apoptosis in bladder cancer T24 cells through P53 independent pathway

    Directory of Open Access Journals (Sweden)

    Haifeng Wang

    2013-01-01

    Full Text Available Objectives: To investigate the effect of M-ds-P21 on the apoptosis of bladder cancer T24 cells and its potential mechanism. Materials and Methods: Effect of M-ds-P21 on T24 cells were assessed by cell morphology and Western blot. Apoptosis was quantified by Annexin-V flow-cytometry analysis. To uncover the role of P53 in M-ds-P21-mediated apoptosis of T24 cells, we knocked down P53 before treating cells with M-ds-P21, and then assayed P21 and apoptosis-related protein by Western blot. To uncover the mechanism by which M-ds-P21 played stronger effect than ds-P21, we performed confocal microscope analyses. Results: Both M-ds-P21 and ds-P21 treatment changed the cell morphology, leading to cell apoptosis after 3 days. Apoptosis induced by M-ds-P21 and ds-P21 treatment is not P53-dependent but caspase-dependent. Compared with ds-P21, M-ds-P21 significantly increased the bioavailability of ds-RNA in T24 cells. Conclusions: M-ds-P21 treatment induces more apoptotic population than ds-P21 does. The mechanism for stronger effect of M-ds-P21 is partly due to the enhanced bioavailability of ds-RNA in human bladder cancer T24 cells, and not P53-dependent but caspase-dependent.

  13. Polymorphism of viral dsRNA in Xanthophyllomyces dendrorhous strains isolated from different geographic areas

    Directory of Open Access Journals (Sweden)

    Libkind Diego

    2009-10-01

    Full Text Available Abstract Background Strains of the astaxanthin producing yeast Xanthophyllomyces dendrorhous have been isolated from different cold regions around the earth, and the presence of double stranded RNA (dsRNA elements was described in some isolates. This kind of viruses is widely distributed among yeasts and filamentous fungi and, although generally are cryptic in function, their studies have been a key factor in the knowledge of important fungi. In this work, the characterization and genetic relationships among dsRNA elements were determined in strains representatives of almost all regions of the earth where X. dendrorhous have been isolated. Results Almost all strains of X. dendrorhous analyzed carry one, two or four dsRNA elements, of molecular sizes in the range from 0.8 to 5.0 kb. Different dsRNA-patterns were observed in strains with different geographic origin, being L1 (5.0 kb the common dsRNA element. By hybridization assays a high genomic polymorphism was observed among L1 dsRNAs of different X. dendrorhous strains. Contrary, hybridization was observed between L1 and L2 dsRNAs of strains from same or different regions, while the dsRNA elements of minor sizes (M, S1, and S2 present in several strains did not show hybridization with neither L1 or L2 dsRNAs. Along the growth curve of UCD 67-385 (harboring four dsRNAs an increase of L2 relative to L1 dsRNA was observed, whiles the S1/L1 ratio remains constant, as well as the M/L1 ratio of Patagonian strain. Strains cured of S2 dsRNA were obtained by treatment with anisomycin, and comparison of its dsRNA contents with uncured strain, revealed an increase of L1 dsRNA while the L2 and S1 dsRNA remain unaltered. Conclusion The dsRNA elements of X. dendrorhous are highly variable in size and sequence, and the dsRNA pattern is specific to the geographic region of isolation. Each L1 and L2 dsRNA are viral elements able to self replicate and to coexist into a cell, and L1 and S2 dsRNAs elements could

  14. Polymorphism of viral dsRNA in Xanthophyllomyces dendrorhous strains isolated from different geographic areas.

    Science.gov (United States)

    Baeza, Marcelo; Sanhueza, Mario; Flores, Oriana; Oviedo, Vicente; Libkind, Diego; Cifuentes, Víctor

    2009-10-08

    Strains of the astaxanthin producing yeast Xanthophyllomyces dendrorhous have been isolated from different cold regions around the earth, and the presence of double stranded RNA (dsRNA) elements was described in some isolates. This kind of viruses is widely distributed among yeasts and filamentous fungi and, although generally are cryptic in function, their studies have been a key factor in the knowledge of important fungi. In this work, the characterization and genetic relationships among dsRNA elements were determined in strains representatives of almost all regions of the earth where X. dendrorhous have been isolated. Almost all strains of X. dendrorhous analyzed carry one, two or four dsRNA elements, of molecular sizes in the range from 0.8 to 5.0 kb. Different dsRNA-patterns were observed in strains with different geographic origin, being L1 (5.0 kb) the common dsRNA element. By hybridization assays a high genomic polymorphism was observed among L1 dsRNAs of different X. dendrorhous strains. Contrary, hybridization was observed between L1 and L2 dsRNAs of strains from same or different regions, while the dsRNA elements of minor sizes (M, S1, and S2) present in several strains did not show hybridization with neither L1 or L2 dsRNAs. Along the growth curve of UCD 67-385 (harboring four dsRNAs) an increase of L2 relative to L1 dsRNA was observed, while the S1/L1 ratio remains constant, as well as the M/L1 ratio of Patagonian strain. Strains cured of S2 dsRNA were obtained by treatment with anisomycin, and comparison of its dsRNA contents with uncured strain, revealed an increase of L1 dsRNA while the L2 and S1 dsRNA remain unaltered. The dsRNA elements of X. dendrorhous are highly variable in size and sequence, and the dsRNA pattern is specific to the geographic region of isolation. Each L1 and L2 dsRNA are viral elements able to self replicate and to coexist into a cell, and L1 and S2 dsRNAs elements could be part of a helper/satellite virus system in X

  15. Préface

    OpenAIRE

    Cazanove, Olivier de; Scheid, John

    2015-01-01

    Le 8 Mars 1890, au Trinity College de Cambridge, un ethnologue de trente-six ans, James George Frazer, achève et signe la préface de l’œuvre en deux volumes à laquelle il travaille depuis le printemps précédent. Cette première version du Rameau d’Or sera, comme on sait, suivie de plusieurs autres, qui porteront cette « étude séparée » sur « la règle, jusqu’ici inexpliquée, de la prêtrisd’Aricie » aux dimensions monumentales de la troisième édition (1911-1915) en douze volumes. Il nous a sembl...

  16. Smart Antenna Application in DS-CDMA Mobile Communication System

    Science.gov (United States)

    Ng, Kok K.

    2002-09-01

    This thesis examine the use of an equally-spaced linear adaptive antenna array at the mobile station for a typical Direct Sequence Code Division Multiple Access (DS-CDMA) cellular mobile communications system with forward error correction, with soft decision decoding is studied, We analyze the performance of a randomly positioned mobile terminal with a randomly orientated adaptive antenna array in the forward channel (base- station to mobile) of a multi-cell DS-CDMA system and established four performance% boundaries, Using the more conservative optimized array antenna performance boundary for the 2-, 3- and 4-element linear array, we compare the capacity and the performance% of different cellular systems under a range of shadowing conditions, with and without antenna sectoring at the base-station, and for various user capacities, using Monte Carlo simulation We further apply tapped-delay line (transversal filter) to each antenna element channel, to allow frequency dependent amplitude and phase adjustment for broadband signals, The performance of a DS-CDMA cellular system with a mobile terminal equipped with a linear array and a tapped-delay line is analyzed, It has been demonstrated that the optimization process has been extremely computationally expensive and hence minimum taps should be used for practical consideration, The results illustrated that, in general, for a 2-element linear array system, a 3-tap delay line would be sufficient to equalize the broadband signal while providing a similar performance level to that of a narrow-band adaptive array system In the case of a 3-element linear array system, a 2-tap delay line would suffice.

  17. Protein chainmail variants in dsDNA viruses

    Directory of Open Access Journals (Sweden)

    Z. Hong Zhou

    2015-06-01

    Full Text Available First discovered in bacteriophage HK97, biological chainmail is a highly stable system formed by concatenated protein rings. Each subunit of the ring contains the HK97-like fold, which is characterized by its submarine-like shape with a 5-stranded β sheet in the axial (A domain, spine helix in the peripheral (P domain, and an extended (E loop. HK97 capsid consists of covalently-linked copies of just one HK97-like fold protein and represents the most effective strategy to form highly stable chainmail needed for dsDNA genome encapsidation. Recently, near-atomic resolution structures enabled by cryo electron microscopy (cryoEM have revealed a range of other, more complex variants of this strategy for constructing dsDNA viruses. The first strategy, exemplified by P22-like phages, is the attachment of an insertional (I domain to the core 5-stranded β sheet of the HK97-like fold. The atomic models of the Bordetella phage BPP-1 showcases an alternative topology of the classic HK97 topology of the HK97-like fold, as well as the second strategy for constructing stable capsids, where an auxiliary jellyroll protein dimer serves to cement the non-covalent chainmail formed by capsid protein subunits. The third strategy, found in lambda-like phages, uses auxiliary protein trimers to stabilize the underlying non-covalent chainmail near the 3-fold axis. Herpesviruses represent highly complex viruses that use a combination of these strategies, resulting in four-level hierarchical organization including a non-covalent chainmail formed by the HK97-like fold domain found in the floor region. A thorough understanding of these structures should help unlock the enigma of the emergence and evolution of dsDNA viruses and inform bioengineering efforts based on these viruses.

  18. Adaptive Multiuser Detectors for DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    Paul Jean Etienne Jeszensky

    2006-02-01

    Full Text Available This work makes a review of the main Adaptives Multi-user Detectors (MuD-Adpt for Direct Sequence - Code Division Multiple Access (DS-CDMA systems. The MuD-Adpt based on Minimum Mean Square Error (MMSE and Decorrelator (MuD-Dec are focused. Multi-user detectors show great resistance to the near-far effect and combat effectively the Multiple Access Interference (MAI. Comparative numeric results characterize the substantial performance improvement of those detectors in relation to the matched filter conventional receiver (Conv.

  19. 3ds Max design architectural visualization for intermediate users

    CERN Document Server

    Smith, Brian L

    2012-01-01

    Learn time-saving techniques and tested production-ready tips for maximum speed and efficiency in creating professional-level architectural visualizations in 3ds Max. Move from intermediate to an advanced level with specific and comprehensive instruction with this collaboration from nine different authors from around the world. Get their experience and skills in this full-color book, which not only teaches more advanced features, but also demonstrates the practical applications of those features to get readers ready for a real production environment. Fully updated for the most recent version o

  20. Passivation Strategies on Board Airbus ds Leo Pcdus

    Directory of Open Access Journals (Sweden)

    Lapeña Emilio

    2017-01-01

    This paper deals with the different strategies followed in the Airbus DS LEO PCDUs regarding the implementation of the passivation function in several LEO missions with different architectures (DET and MPPT solar array power conditioning. In the selection of the solution implemented in the frame of every mission, a key driver is the degree of advance in the test performed over flight representative battery modules regarding their safe behavior when deeply depleted after a long period in orbit with the passivation applied over the spacecraft.

  1. PR-PR: cross-platform laboratory automation system.

    Science.gov (United States)

    Linshiz, Gregory; Stawski, Nina; Goyal, Garima; Bi, Changhao; Poust, Sean; Sharma, Monica; Mutalik, Vivek; Keasling, Jay D; Hillson, Nathan J

    2014-08-15

    To enable protocol standardization, sharing, and efficient implementation across laboratory automation platforms, we have further developed the PR-PR open-source high-level biology-friendly robot programming language as a cross-platform laboratory automation system. Beyond liquid-handling robotics, PR-PR now supports microfluidic and microscopy platforms, as well as protocol translation into human languages, such as English. While the same set of basic PR-PR commands and features are available for each supported platform, the underlying optimization and translation modules vary from platform to platform. Here, we describe these further developments to PR-PR, and demonstrate the experimental implementation and validation of PR-PR protocols for combinatorial modified Golden Gate DNA assembly across liquid-handling robotic, microfluidic, and manual platforms. To further test PR-PR cross-platform performance, we then implement and assess PR-PR protocols for Kunkel DNA mutagenesis and hierarchical Gibson DNA assembly for microfluidic and manual platforms.

  2. $B_{s}^{0} \\to D_{s}^{- }a_{1}^{+} (D_{s}^{-} \\to \\phi \\pi^{-}, D_{s}^{-} \\to K^{*0}K^{-})$ decay channel in the ATLAS $B_{s}^{0}$-mixing studies

    CERN Document Server

    Bannikov, AV; Silagadze, Z K

    1997-01-01

    It is shown, using a track-level simulation, that the use of the $D_s^- \\to K^{*0}K^-$ decay channel for $D_s^-$ reconstruction, in additioon with the previously studied $D_s^- \\to \\phi \\pi^-$ mode, enables two fold gain in the ATLAS $B_s^0$-mixing signal statistics through $B_s^0 \\to D_s^-a_1$ $B_s^0$-decay channel. A new modification of the amplitude fit method is suggested for the $x_s$ determination. Some general aspects of the $B_s^0$-mixing phenomenon is illustrated by pictures of Casimir Malevich, Maurits Cornelis Escher and Salvador Dali.

  3. Pr?vention de la transmission m?re-enfant de l'h?patite B

    OpenAIRE

    El Agheb, Mohamed Ould Mohamed; Grange, Jean-Didier

    2015-01-01

    La transmission m?re-enfant du virus de l'h?patite B est la principale cause de portage chronique de l'AgHBs. La pr?vention de cette transmission repose principalement sur la s?rovaccination du nouveau-n?. En France, le d?pistage pr?natal de l'AgHBs est obligatoire au sixi?me mois de la grossesse chez toutes les femmes enceintes. Lorsque la recherche de l'AgHBs est positive chez la m?re, le nouveau-n? doit recevoir d?s sa naissance, par voie intramusculaire et dans deux sites diff?rents, une ...

  4. A Unified Approach to the Analysis of Multicarrier DS-CDMA over Nakagami-$M$ Fading Channels

    OpenAIRE

    Yang, L-L.; Hanzo, L.

    2001-01-01

    A class of unified multicarrier DS-CDMA (MC DS-CDMA) schemes is defined and its performance is considered over multipath Nakagami-$M$ fading channels. The spacing between two adjacent subcarriers of the unified MC DS-CDMA scheme is a variable, allowing us to gain insight into the effects of the spacing on the bit error rate (BER) performance of MC DS-CDMA systems. This unified MC DS-CDMA scheme includes the subclasses of multitone DS-CDMA and orthogonal MC DS-CDMA as special cases. The optimu...

  5. Rapid detection of meticillin-resistant Staphylococcus aureus bacteraemia using combined three-hour short-incubation matrix-assisted laser desorption/ionization time-of-flight MS identification and Alere Culture Colony PBP2a detection test.

    Science.gov (United States)

    Delport, Johannes Andries; Mohorovic, Ivor; Burn, Sandi; McCormick, John Kenneth; Schaus, David; Lannigan, Robert; John, Michael

    2016-07-01

    Meticillin-resistant Staphylococcus aureus (MRSA) bloodstream infection is responsible for significant morbidity, with mortality rates as high as 60 % if not treated appropriately. We describe a rapid method to detect MRSA in blood cultures using a combined three-hour short-incubation BRUKER matrix-assisted laser desorption/ionization time-of-flight MS BioTyper protocol and a qualitative immunochromatographic assay, the Alere Culture Colony Test PBP2a detection test. We compared this combined method with a molecular method detecting the nuc and mecA genes currently performed in our laboratory. One hundred and seventeen S. aureus blood cultures were tested of which 35 were MRSA and 82 were meticillin-sensitive S. aureus (MSSA). The rapid combined test correctly identified 100 % (82/82) of the MSSA and 85.7 % (30/35) of the MRSA after 3 h. There were five false negative results where the isolates were correctly identified as S. aureus, but PBP2a was not detected by the Culture Colony Test. The combined method has a sensitivity of 87.5 %, specificity of 100 %, a positive predictive value of 100 % and a negative predictive value of 94.3 % with the prevalence of MRSA in our S. aureus blood cultures. The combined rapid method offers a significant benefit to early detection of MRSA in positive blood cultures.

  6. DS-Connect: A Promising Tool to Improve Lives and Engage Down Syndrome Communities Worldwide.

    Science.gov (United States)

    Peprah, Emmanuel K; Parisi, Melissa A; Kaeser, Lisa; Bardhan, Sujata; Oster-Granite, MaryLou; Maddox, Yvonne T

    2015-12-01

    Down syndrome (DS) is the most common genetic cause of intellectual and developmental disabilities in the United States with an estimated birth prevalence of 1:691 births; however, worldwide estimates of the number of individuals with intellectual and developmental disabilities, including DS, remain speculative. Little is known about the global health impact of DS, such as heart defects, gastrointestinal malformations, and other medical and behavioral issues. Further research is needed to develop the next generation of novel therapies and compounds aimed at improving cognition, reducing dementia, and mitigating other manifestations of DS. To address these challenges, the National Institutes of Health has created the first web-based, voluntary registry and data resource called DS-Connect: The Down Syndrome Registry to collect demographic and health information about individuals with DS. Published by Elsevier B.V.

  7. Neutron Scattering from fcc Pr and Pr3Tl

    DEFF Research Database (Denmark)

    Birgeneau, R. J.; Als-Nielsen, Jens Aage; Bucher, E.

    1972-01-01

    Elastic-neutron-scattering measurements on the singlet-ground-state ferromagnets fcc Pr and Pr3 Tl are reported. Both exhibit magnetic phase transitions, possibly to a simple ferromagnetic state at 20 and 11.6 °K, respectively. The transitions appear to be of second order although that in fcc Pr ...... is clearly anomalous. Additional information on the inelastic scattering studies of the Γ1-Γ4 excitons in these systems is presented. dhcp Pr is also briefly discussed....

  8. Leptonic D and D_s Decays near c-cbar Threshold

    CERN Document Server

    Blusk, Steven R

    2007-01-01

    We present recent results from the CLEO Collaboration on leptonic decay rates of $D$ and $D_s$ near $c\\bar{c}$ production threshold. From these decay rates, we extract the decay constants, f_D = (222.6+-16.7^{+2.8}_{-3.4}) MeV, f_Ds = (274+-10+-5) MeV, and the ratio f_Ds/f_D = 1.23+-0.11+-0.03.

  9. Search for $D^{+}_{(s)} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}$ and $D^{+}_{(s)} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}$ decays

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-07-23

    A search for non-resonant $D^{+}_{(s)} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}$ and $D^{+}_{(s)} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}$ decays is performed using proton-proton collision data, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, at $\\sqrt{s}=7$ TeV recorded by the LHCb experiment in 2011. No signals are observed and the $90\\% \\, (95\\%)$ confidence level (CL) limits on the branching fractions are found to be \\begin{eqnarray*} \\mathcal{B}(D^{+} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}) < 7.3 \\, (8.3) \\times 10^{-8},\\\\ \\mathcal{B}(D^{+}_{s} \\rightarrow \\pi^{+} \\mu^{+} \\mu^{-}) < 4.1 \\, (4.8) \\times 10^{-7},\\\\ \\mathcal{B}(D^{+} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}) < 2.2 \\, (2.5) \\times 10^{-8},\\\\ \\mathcal{B}(D^{+}_{s} \\rightarrow \\pi^{-} \\mu^{+} \\mu^{+}) < 1.2 \\, (1.4) \\times 10^{-7}.\\\\ \\end{eqnarray*} These limits are the most stringent to date.

  10. Préface

    Directory of Open Access Journals (Sweden)

    Marguerite Mendell

    2008-12-01

    Full Text Available C’est avec grand plaisir que je contribue la préface de ce numéro d’Interventions économiques dédié à la pertinence de la pensée de Karl Polanyi au début du 21ème siècle. Je suis très reconnaissante aux éditeurs, Diane Gabrielle Tremblay, Jean-Marc Fontan et Jean Louis Laville d’avoir pris l’initiative de préparer ce numéro pour le 11ème colloque international de l’Institut Karl Polanyi, qui correspond aussi au 20ème anniversaire de l’Institut, établi à l’Université Concordia en 1988. Interve...

  11. PR, Lobbyism and Democracy

    DEFF Research Database (Denmark)

    Ørsten, Mark; Willig, Ida; Pedersen, Leif Hemming

    2017-01-01

    The growth of PR in Scandinavia is linked both to the mediatization of politics and to the decline of corporatism. Studies in Sweden and Norway suggest that one consequence of these changes is the increasing number of politicians who find new careers as lobbyists in the private sector. In this st......The growth of PR in Scandinavia is linked both to the mediatization of politics and to the decline of corporatism. Studies in Sweden and Norway suggest that one consequence of these changes is the increasing number of politicians who find new careers as lobbyists in the private sector....... In this study, we have constructed a data set of all members of the Danish Parliament who have left politics from 1981 to 2015 (n= 613) and identified the number and type of job positions they have taken up subsequently (n= 1094). We find that especially from the 1990s we can register revolving door activity...

  12. Observation of $\\Bm \\to D^{(*)+}_s K^- \\pi^-$ and $\\bar{B^0} \\to D_s^{+} \\KS \\pi^-$ and Search for $\\bar{B^0} \\to D_s^{*+} \\KS \\pi^-$ and $B^- \\to D^{(*)+}_s K^- K^-$

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H

    2007-01-01

    We report on our search for $B^- \\to D^{(*)+}_s K^- \\pi^-$, $\\bar{B^0} \\to D_s^{(*)+} \\KS \\pi^-$, and $B^- \\to D^{(*)+}_s K^- K^-$ decays in 383 million Upsilon(4S) \\to B \\bar{B}$ events collected by the BABAR detector at the PEP2 asymmetric-energy $B$-factory. The branching fractions are measured to be ${\\cal B}(B^- \\to D^+_s K^- \\pi^-) = (2.02 \\pm 0.13_{stat} \\pm 0.38_{syst}) \\times 10^{-4},$ ${\\cal B}(B^- \\to D^{*+}_s K^- \\pi^-)= (1.67 \\pm 0.16_{stat} \\pm 0.35_{syst}) \\times 10^{-4},$ ${\\cal B}(\\bar{B^0} \\to D_s^{+} \\KS \\pi^-)= (0.55 \\pm 0.13_{stat} \\pm 0.10_{syst}) \\times 10^{-4},$ and ${\\cal B}(B^- \\to D_s^{+} K^- K^-) = (0.11 \\pm 0.04_{stat} \\pm 0.02_{syst}) \\times 10^{-4}$. Upper limits at the 90% C.L. are set on ${\\cal B}(\\bar{B^0} \\to D_s^{*+} \\KS \\pi^-)< 0.55 \\times 10^{-4}$ and ${\\cal B}(B^- \\to D_s^{*+} K^- K^-) < 0.15 \\times 10^{-4}.$

  13. RNA interference of four genes in adult Bactrocera dorsalis by feeding their dsRNAs.

    Directory of Open Access Journals (Sweden)

    Xiaoxue Li

    Full Text Available BACKGROUND: RNA interference (RNAi is a powerful method to inhibit gene expression in a sequence specific manner. Recently silencing the target gene through feeding has been successfully carried out in many insect species. METHODOLOGY/PRINCIPAL FINDINGS: Escherichia coli strain HT115 was genetically engineered to express dsRNA targeting genes that encode ribosomal protein Rpl19, V type ATPase D subunit, the fatty acid elongase Noa and a small GTPase Rab11. qRT-PCR showed that mRNA level of four target genes was reduced compared to ds-egfp control by feeding either engineered bacteria or dsRNAs. The maximum down-regulation of each gene varied from 35% to 100%. Tissue specific examination indicated that RNAi could be observed not only in midgut but also in other tissues like the ovary, nervous system and fat body. Silencing of rab11 through ingestion of dsRNA killed 20% of adult flies. Egg production was affected through feeding ds-noa and ds-rab11 compared to ds-egfp group. Adult flies were continuously fed with dsRNA and bacteria expressing dsRNA for 14 days and up-regulations of target genes were observed during this process. The transcripts of noa showed up-regulation compared to ds-egfp control group in four tissues on day 7 after continuous feeding either dsRNA or engineered bacteria. The maximum over-expression is 21 times compared to ds-egfp control group. Up-regulation of rab11 mRNA level could be observed in testes on day 7 after continuous bacteria treatment and in midgut on day 2 after ds-rab11 treatment. This phenomenon could also be observed in rpl19 groups. CONCLUSIONS: Our results suggested that it is feasible to silence genes by feeding dsRNA and bacteria expressing dsRNA in Bactrocera dorsalis. Additionally the over-expression of the target gene after continuously feeding dsRNA or bacteria was observed.

  14. Reduction in Musca domestica fecundity by dsRNA-mediated gene knockdown.

    Directory of Open Access Journals (Sweden)

    Neil D Sanscrainte

    Full Text Available House flies (Musca domestica are worldwide agricultural pests with estimated control costs at $375 million annually in the U.S. Non-target effects and widespread resistance challenge the efficacy of traditional chemical control. Double stranded RNA (dsRNA has been suggested as a biopesticide for M. domestica but a phenotypic response due to the induction of the RNAi pathway has not been demonstrated in adults. In this study female house flies were injected with dsRNA targeting actin-5C or ribosomal protein (RP transcripts RPL26 and RPS6. Ovaries showed highly reduced provisioning and clutch reductions of 94-99% in RP dsRNA treated flies but not in actin-5C or GFP treated flies. Gene expression levels were significantly and specifically reduced in dsRNA injected groups but remained unchanged in the control dsGFP treated group. Furthermore, injections with an Aedes aegypti conspecific dsRNA designed against RPS6 did not impact fecundity, demonstrating species specificity of the RNAi response. Analysis of M. domestica tissues following RPS6 dsRNA injection showed significant reduction of transcript levels in the head, thorax, and abdomen but increased expression in ovarian tissues. This study demonstrates that exogenous dsRNA is specifically effective and has potential efficacy as a highly specific biocontrol intervention in adult house flies. Further work is required to develop effective methods for delivery of dsRNA to adult flies.

  15. A Joint Optimization Criterion for Blind DS-CDMA Detection

    Directory of Open Access Journals (Sweden)

    Sergio A. Cruces-Alvarez

    2007-01-01

    Full Text Available This paper addresses the problem of the blind detection of a desired user in an asynchronous DS-CDMA communications system with multipath propagation channels. Starting from the inverse filter criterion introduced by Tugnait and Li in 2001, we propose to tackle the problem in the context of the blind signal extraction methods for ICA. In order to improve the performance of the detector, we present a criterion based on the joint optimization of several higher-order statistics of the outputs. An algorithm that optimizes the proposed criterion is described, and its improved performance and robustness with respect to the near-far problem are corroborated through simulations. Additionally, a simulation using measurements on a real software-radio platform at 5 GHz has also been performed.

  16. Subband Adaptive Array for DS-CDMA Mobile Radio

    Directory of Open Access Journals (Sweden)

    Tran Xuan Nam

    2004-01-01

    Full Text Available We propose a novel scheme of subband adaptive array (SBAA for direct-sequence code division multiple access (DS-CDMA. The scheme exploits the spreading code and pilot signal as the reference signal to estimate the propagation channel. Moreover, instead of combining the array outputs at each output tap using a synthesis filter and then despreading them, we despread directly the array outputs at each output tap by the desired user's code to save the synthesis filter. Although its configuration is far different from that of 2D RAKEs, the proposed scheme exhibits relatively equivalent performance of 2D RAKEs while having less computation load due to utilising adaptive signal processing in subbands. Simulation programs are carried out to explore the performance of the scheme and compare its performance with that of the standard 2D RAKE.

  17. Rayleigh fading effect reduction with wideband DS/CDMA signals

    Science.gov (United States)

    Holtzman, Jack M.; Jalloul, Louay M. A.

    1994-02-01

    Mobile radio fading analyses typically assume a single frequency carrier transmitted through the propagation medium. The results are then used for the case of narrowband transmission. New phenomena occur with wideband transmission. This paper presents an analysis of the mitigation of the Rayleigh fading effect for wideband direct sequence code division multiple access (DS/CDMA) signaling. There are measurements that show this phenomenon. The reduction of the Rayleigh fading effect is an advantage of CDMA over narrowband transmission systems and it eases the burden of CDMA power control. A general expression for the coefficient of variation of the received wideband signal power is derived. It is shown how the coefficient of variation of the received power decreases as the bandwidth spreading increases. This paper also analyzes the time correlation needed for other analyses (e.g., CDMA power control).

  18. Subband Adaptive Array for DS-CDMA Mobile Radio

    Science.gov (United States)

    Tran, Xuan Nam; Omata, Takanori; Taniguchi, Tetsuki; Karasawa, Yoshio

    2004-12-01

    We propose a novel scheme of subband adaptive array (SBAA) for direct-sequence code division multiple access (DS-CDMA). The scheme exploits the spreading code and pilot signal as the reference signal to estimate the propagation channel. Moreover, instead of combining the array outputs at each output tap using a synthesis filter and then despreading them, we despread directly the array outputs at each output tap by the desired user's code to save the synthesis filter. Although its configuration is far different from that of 2D RAKEs, the proposed scheme exhibits relatively equivalent performance of 2D RAKEs while having less computation load due to utilising adaptive signal processing in subbands. Simulation programs are carried out to explore the performance of the scheme and compare its performance with that of the standard 2D RAKE.

  19. A surge in anti-dsDNA titer predicts a severe lupus flare within six months.

    Science.gov (United States)

    Pan, N; Amigues, I; Lyman, S; Duculan, R; Aziz, F; Crow, M K; Kirou, K A

    2014-03-01

    Rising anti-double-stranded (ds) DNA titers have been shown by some, but not all, studies to be predictive of disease flares in systemic lupus erythematosus (SLE). We hypothesized that a rapid and substantial rise in anti-dsDNA titer (anti-dsDNA surge) would be a good predictor of a clinically important SLE flare. A matched case-control study was conducted in an academic rheumatology practice setting. Our primary endpoint was the occurrence of a severe SELENA-SLEDAI (SS) flare within six months of an anti-dsDNA surge, and secondary endpoints were mild/moderate SS flares, as well as BILAG A and B renal flares. Cases were identified as those patients whose disease course included a surge of anti-dsDNA, defined as an increase of anti-dsDNA titer by the Crithidia luciliae immunofluorescence (CLIF) assay from 0 to 3+/4+, or from 1+ to 4+, within a period of less than 12 months. The date of the anti-dsDNA surge was defined as Day 0. Two control SLE patients were identified for each case and were matched for age, sex, race, and visit date closest to case Day 0, but without an anti-dsDNA surge. Logistic regression models were used to detect associations between anti-dsDNA surges and severe SS flares. A higher proportion of cases, compared to controls, experienced a severe SS flare within six months of Day 0 (OR 6.3 (95% confidence intervals 2.0-19.9), p = 0.02). Associations with all flares and hospitalizations for flares were also observed. However, an anti-dsDNA surge was not predictive of a renal flare. An anti-dsDNA surge predicts the subsequent development of a severe SS flare within six months. Physicians should closely monitor such patients and treat promptly at the first sign of clinical activity.

  20. Measurements of the absolute branching fractions for D-s(+) -> eta e(+)nu(e) and D-s(+) -> eta ' e(+)nu(e)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Y.; Huang, Z. L.; Hussain, T.; Andersson, W. Ikegami; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. W.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kiese, P.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kupsc, A.; Kuhn, W.; Lange, J. S.; Lara, M.; Larin, P.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. L.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Y. B.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Loehner, H.; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrie, M.; Schnier, C.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, M.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W.; Wang, W. P.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Z. J.; Xie, Y. G.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

    2016-01-01

    By analyzing 482 pb(-1) of e(+)e(-) collision data collected at root s = 4.009 GeV with the BESIII detector at the BEPCII collider, we measure the absolute branching fractions for the semileptonic decays D-s(+) -> eta e(+)nu(e) and D-s(+) -> eta ' e(+)nu(e) to be B(D-s(+) -> eta e(+)nu(e)) = (2.30

  1. Préface

    Science.gov (United States)

    Chardonnet, Christian; Millot, Guy

    2006-10-01

    COLOQ, réunion nationale biennale initiée en 1988 par la communauté française des lasers, de l'optique non linéaire et de l'optique quantique atteint sa neuvième édition. Depuis sa création, les objectifs poursuivis sont les suivants : - réunir la communauté française des lasers, de l'optique non linéaire et de l'optique quantique, en dépassant les clivages fondamental/appliqué, recherche publique/industrielle, - faire le point sur les avancées récentes, - permettre aux jeunes chercheurs de se rencontrer, de s'exprimer et de s'aguerrir au plan national. Le but est que tout thésard du domaine de l'optique puisse participer à COLOQ une fois durant sa thèse, présenter son travail et de se confronter à la communauté de l'optique. COLOQ9 s'est tenu, pour sa 9e édition, sur le campus universitaire de Dijon, du 7 au 9 septembre 2005. Il a été une grande réussite : nombre de participants (255) et de présentations scientifiques record (148 affiches), forte représentation des industriels (15) et participation d'environ 200 lycéens aux conférences grand public. Le nombre plus élevé que prévu d'affiches a rendu un peu serrée leur présentation : une attention particulière sera portée à cet aspect lors des prochaines éditions. Ces journées ont été consacrées à des conférences invitées données par des scientifiques de haut niveau et à des présentations sous forme d'affiches. Une plage de temps importante a été réservée pour des discussions autour des affiches. À proximité immédiate de la salle de conférence, l'exposition de matériels spécialisés pour les lasers, l'optique et l'optoélectronique a été une occasion pour les jeunes participants de découvrir et contacter les industriels et les autres grands acteurs de l'optique. L'année 2005 ayant été l'année mondiale de la physique, COLOQ9 a retenu comme thème central ”1905-2005 : à propos d'Einstein". Plusieurs grandes conférences ont été dédiées à ce th

  2. Présentation

    Directory of Open Access Journals (Sweden)

    Stéphane Haber

    2010-08-01

    Full Text Available Les articles réunis dans ce dossier de la revue Astérion portent sur la première génération de la Théorie critique (dont Max Horkheimer, Walter Benjamin, Theodor W. Adorno, Herbert Marcuse et Erich Fromm constituent sans doute les figures principales. Ils se concentrent plus précisément sur les contributions philosophiques qui marquèrent la période ouverte par l’accession de Horkheimer à la direction de l’Institut de recherches sociales (1931 et close par la publication en 1944 de Dialektik...

  3. Prólogo

    OpenAIRE

    Gómez Pin, Víctor

    1999-01-01

    Prólogo del número dedicado a Descartes Múltiples instituciones culturales y académicas del mundo entero (la UNESCO en primer lugar) celebraron en 1996 un singular acontecimiento: el nacimiento en 1596 del universalmente conocido como matemático y filósofo René Descartes. Escribo intencionalmente "universalmente conocido", en lugar de umversalmente reconocido por la sencilla razón de que no está claro que Descartes goce de lo que se entiendo por universal reconocimiento. Una simple encuest...

  4. Prólogo

    OpenAIRE

    Naranjo-Ramírez, J.

    2003-01-01

    Prólogo al libro: Cabezas Pérez, Francisco (2003): Las fuentes y el agua en Aguilar de la Frontera. (S. XVI al XIX). Aguilar, Excma. Diputación Provincial de Córdoba e Ilustrísimo Ayuntamiento de Aguilar, págs. 11-16 El contenido del libro que se prologa se desarrolla mediante un amplio recorrido histórico por las fuentes y manantiales históricos de Aguilar de la Frontera (Córdoba), con referencia asimismo a los problemas de abastecimiento que, en cada momento, se fueron produciendo. Ad...

  5. Behavioral phenotype in children with 22q11Ds : Agreement between parents and teachers

    NARCIS (Netherlands)

    Klaassen, Petra W J; Duijff, Sasja N.|info:eu-repo/dai/nl/30481914X; Sinnema, Gerben; Beemer, Frits A.; Swanenburg de Veye, Henriëtte F N|info:eu-repo/dai/nl/180652842; Vorstman, Jacob A S|info:eu-repo/dai/nl/304817023

    2015-01-01

    Patients with the 22q11-deletion syndrome (22q11DS) are at an increased risk of developing schizophrenia. Besides the effects of genetic variation, environmental factors could also be important in modifying the risk of schizophrenia in 22q11DS patients. In particular, previous studies have shown the

  6. Characterization of the Ac/Ds behaviour in transgenic tomato plants using plasmid rescue

    NARCIS (Netherlands)

    Rommens, Caius M.T.; Rudenko, George N.; Dijkwel, Paul P.; Haaren, Mark J.J. van; Ouwerkerk, Pieter B.F.; Blok, Karin M.; Nijkamp, H. John J.; Hille, Jacques

    1992-01-01

    We describe the use of plasmid rescue to facilitate studies on the behaviour of Ds and Ac elements in transgenic tomato plants. The rescue of Ds elements relies on the presence of a plasmid origin of replication and a marker gene selective in Escherichia coli within the element. The position within

  7. Creating opportunities for science PhDs to pursue careers in high school education.

    Science.gov (United States)

    Doyle, Kari M H; Vale, Ronald D

    2013-11-01

    The United States is confronting important challenges at both the early and late stages of science education. At the level of K-12 education, a recent National Research Council report (Successful K-12 STEM Education) proposed a bold restructuring of how science is taught, moving away from memorizing facts and emphasizing hands-on, inquiry-based learning and a deeper understanding of the process of science. At higher levels of training, limited funding for science is leading PhDs to seek training and careers in areas other than research. Might science PhDs play a bigger role in the future of K-12 education, particularly at the high school level? We explore this question by discussing the roles that PhDs can play in high school education and the current and rather extensive barriers to PhDs entering the teaching profession and finally suggest ways to ease the entrance of qualified PhDs into high school education.

  8. Viral dsRNA in the wine yeast Saccharomyces bayanus var. uvarum.

    Science.gov (United States)

    Ivannikova, Yuliya V; Naumova, Elena S; Naumov, Gennadi I

    2007-01-01

    The presence of viral dsRNA (L and M fractions) in the cryophilic yeast Saccharomyces bayanus var. uvarum is documented here for the first time. Sixty-eight strains of different origins were analyzed. Most of them did not carry dsRNA; the L fraction was found in seven strains, while 11 strains had both L and M fractions. The size of the L fraction was invariable (4.5 kb), as in the cultured yeast Saccharomyces cerevisiae. In contrast to L-dsRNA, the M fraction varied in size from ca. 1.2 to 1.8 kb. In total, seven different M-dsRNA types were recognized (M1-M3 and M8-M11), predominantly among French wine strains of S. bayanus var. uvarum. Phenotypic analysis revealed that the M-dsRNAs found were cryptic and may represent mutant forms of killer plasmids.

  9. Use of bacterially expressed dsRNA to downregulate Entamoeba histolytica gene expression.

    Science.gov (United States)

    Solis, Carlos F; Santi-Rocca, Julien; Perdomo, Doranda; Weber, Christian; Guillén, Nancy

    2009-12-23

    Modern RNA interference (RNAi) methodologies using small interfering RNA (siRNA) oligonucleotide duplexes or episomally synthesized hairpin RNA are valuable tools for the analysis of gene function in the protozoan parasite Entamoeba histolytica. However, these approaches still require time-consuming procedures including transfection and drug selection, or costly synthetic molecules. Here we report an efficient and handy alternative for E. histolytica gene down-regulation mediated by bacterial double-stranded RNA (dsRNA) targeting parasite genes. The Escherichia coli strain HT115 which is unable to degrade dsRNA, was genetically engineered to produce high quantities of long dsRNA segments targeting the genes that encode E. histolytica beta-tubulin and virulence factor KERP1. Trophozoites cultured in vitro were directly fed with dsRNA-expressing bacteria or soaked with purified dsRNA. Both dsRNA delivery methods resulted in significant reduction of protein expression. In vitro host cell-parasite assays showed that efficient downregulation of kerp1 gene expression mediated by bacterial dsRNA resulted in significant reduction of parasite adhesion and lytic capabilities, thus supporting a major role for KERP1 in the pathogenic process. Furthermore, treatment of trophozoites cultured in microtiter plates, with a repertoire of eighty-five distinct bacterial dsRNA segments targeting E. histolytica genes with unknown function, led to the identification of three genes potentially involved in the growth of the parasite. Our results showed that the use of bacterial dsRNA is a powerful method for the study of gene function in E. histolytica. This dsRNA delivery method is also technically suitable for the study of a large number of genes, thus opening interesting perspectives for the identification of novel drug and vaccine targets.

  10. Use of bacterially expressed dsRNA to downregulate Entamoeba histolytica gene expression.

    Directory of Open Access Journals (Sweden)

    Carlos F Solis

    Full Text Available BACKGROUND: Modern RNA interference (RNAi methodologies using small interfering RNA (siRNA oligonucleotide duplexes or episomally synthesized hairpin RNA are valuable tools for the analysis of gene function in the protozoan parasite Entamoeba histolytica. However, these approaches still require time-consuming procedures including transfection and drug selection, or costly synthetic molecules. PRINCIPAL FINDINGS: Here we report an efficient and handy alternative for E. histolytica gene down-regulation mediated by bacterial double-stranded RNA (dsRNA targeting parasite genes. The Escherichia coli strain HT115 which is unable to degrade dsRNA, was genetically engineered to produce high quantities of long dsRNA segments targeting the genes that encode E. histolytica beta-tubulin and virulence factor KERP1. Trophozoites cultured in vitro were directly fed with dsRNA-expressing bacteria or soaked with purified dsRNA. Both dsRNA delivery methods resulted in significant reduction of protein expression. In vitro host cell-parasite assays showed that efficient downregulation of kerp1 gene expression mediated by bacterial dsRNA resulted in significant reduction of parasite adhesion and lytic capabilities, thus supporting a major role for KERP1 in the pathogenic process. Furthermore, treatment of trophozoites cultured in microtiter plates, with a repertoire of eighty-five distinct bacterial dsRNA segments targeting E. histolytica genes with unknown function, led to the identification of three genes potentially involved in the growth of the parasite. CONCLUSIONS: Our results showed that the use of bacterial dsRNA is a powerful method for the study of gene function in E. histolytica. This dsRNA delivery method is also technically suitable for the study of a large number of genes, thus opening interesting perspectives for the identification of novel drug and vaccine targets.

  11. Direct Identification of Staphylococcus aureus and Determination of Methicillin Susceptibility From Positive Blood-Culture Bottles in a Bact/ALERT System Using Binax Now S. aureus and PBP2a Tests.

    Science.gov (United States)

    Heraud, Sandrine; Freydiere, Anne-Marie; Doleans-Jordheim, Anne; Bes, Michèle; Tristan, Anne; Vandenesch, François; Laurent, Frederic; Dauwalder, Olivier

    2015-07-01

    Staphylococcus aureus bacteremia is associated with high mortality and morbidity, requiring prompt and appropriate antimicrobial treatment. Therefore, it is important to detect methicillin-resistant S. aureus (MRSA) rapidly from blood cultures. Two immunochromatographic tests, BinaxNow S. aureus and BinaxNow PBP2a, were directly applied to 79 Bact/Alert bottles that were positive for Gram positive cocci in cluster aggregations. Sensitivity and specificity for the identification of S. aureus and determination of methicillin resistance were 94% and 87%, and 100% and 100%, respectively, with less than 30 min of performance time. These tests are efficient and rapid; these tests are valuable alternatives to more sophisticated and expensive methods used in the diagnosis of MRSA bacteremia.

  12. Decay properties of {sup 256-339}Ds superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

    2017-09-15

    The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

  13. Calibration of optical components for the DS-1 space probe

    Science.gov (United States)

    Zito, Richard R.

    1997-09-01

    The deep space one (DS-1) probe is a mini-tour photo reconnaissance mission of Earth-Mars space. Target bodies include an asteroid, a comet, and the planet Mars. Central to this mission is an accurate measurement of the reflectance of the primary mirror of the imaging system. Knowledge of this reflectance will allow calculation of the absolute albedos of the target bodies encountered. Scattering measurements were also made on the so-called 'diffuser plate' of the optical train. This component was intended to be used only for the solar occultation experiment which measures the solar intensity as a function of atmospheric depth as Mars comes between the Sun and the probes optical detectors. The diffuser plate was designed to reduce the solar intensity by scattering light in an isotropic fashion. However, it has been found that the diffuser plate is not an isotropic scatterer. This report describes the equipment used to make the reflectance and scattering measurements, as well as the results obtained from the measurement program.

  14. Préface

    Directory of Open Access Journals (Sweden)

    Christian Ménard

    2009-10-01

    Full Text Available La piraterie est un phénomène fort complexe qui remonte à la nuit des temps. Déjà 5 000 ans avant J.-C., des exactions sont mentionnées en mer Egée et Méditerranée. Jules César en sera même l’une des célèbres victimes, mais saura prendre, au moment voulu, sa revanche. Tout au long des siècles, le processus restera récurrent (Atlantique, Antilles…, trouvant son apogée dans le premier quart du XIXe siècle avec l’intervention directe de l’U.S. Navy sous la férule de Thomas Jefferson, Président ...

  15. Préface

    Directory of Open Access Journals (Sweden)

    Mathieu Petite

    2011-07-01

    Full Text Available De nombreux auteurs, depuis une quinzaine d’années, n’ont cessé de diagnostiquer une inflation patrimoniale (Choay, 1996 ; Rautenberg, 2003 ; Heinich, 2009 qu’ils ont attribué à l’élargissement considérable tant des types d’objets susceptibles d’être patrimonialisés que du champ temporel que ceux-ci pouvaient représenter. Ce numéro spécial de la Revue de géographie alpine s’intéresse à cet élargissement typologique et chronologique du patrimoine. Plus précisément, les quatre contributions s’...

  16. Préface

    Directory of Open Access Journals (Sweden)

    Hugues François

    2011-01-01

    Full Text Available Le changement climatique revêt en ce début de millénaire les habits de « mal du siècle » prédisant, à l’horizon 2100, un véritable cataclysme pour les sociétés humaines et leur organisation. Par delà le catastrophisme, les bouleversements induits par l’évolution du climat sur nos pratiques de gestion des territoires sont une réalité. Plus que de céder aux sirènes d’un discours alarmiste, il devient indispensable de se doter d’une meilleure connaissance des mécanismes de ces changements et d’e...

  17. Présentation

    Directory of Open Access Journals (Sweden)

    Arondel Vincent

    2002-01-01

    Full Text Available En juillet 2001, s’est tenu à Strasbourg un colloque de recherche sur les lipides des plantes. Nous présentons ici des articles correspondant à cinq des conférences qui y ont été données. Un point déterminant la qualité des huiles de plantes réside dans leur degré d’insaturation. Cette caractéristique est déterminée par des enzymes appelées désaturases et les gènes codant pour ces enzymes peuvent être utilisés comme marqueurs moléculaires….

  18. Présentation

    Directory of Open Access Journals (Sweden)

    Cheikh N’Guirane

    2011-09-01

    Full Text Available Le 18 Mars 2011, une journée d’étude sur le thème : « Le parti Libéral au Royaume-Uni hier et aujourd’hui / The Liberal Party in Britain 1906-­1924 Past and Present » était organisée conjointement par le MIMMOC (Université de Poitiers et le Groupe de Recherches Anglo-Américaines de Tours (GRAAT. Nous en proposons ci-dessous un compte rendu qui ne restitue qu’une partie seulement des nombreuses et riches échanges de cette journée.À partir d’une brève présentation des intervenants, Susan Find...

  19. Préface

    Directory of Open Access Journals (Sweden)

    Sylvie Duvillard

    2010-09-01

    Full Text Available Le moment est opportun, la question foncière est de retour, légitimée par presque une décennie (2001-2008 d’augmentation continue des prix de l’immobilier. De « sommets » , en articles de presse, la montagne et les Alpes en particulier font l’objet, dans ce domaine, d’une attention toute particulière. Le contexte est ici délicat. Les sociétés alpines sont partagées entre désir de préservation d’une forte identité montagnarde et crainte d’une « déprise » économique (agricole, touristique et/...

  20. Présentation

    Directory of Open Access Journals (Sweden)

    Aurore Monod Becquelin

    2010-09-01

    Full Text Available Les recherches présentées dans ce volume sont issues des travaux de chercheurs qui se réunissent régulièrement depuis 2005 sur le thème de l’« Agentivité ». Ce groupe rassemble des ethnologues et des linguistes du Laboratoire d’ethnologie et de sociologie comparative (umr 7186, cnrs/université Paris Ouest Nanterre La Défense, du Laboratoire d’anthropologie sociale (umr 7130, Collège de France/ehess Paris/cnrs, de l’École des hautes études en sciences sociales, de l’Institut des hautes étude...

  1. STRATEGIJSKA ULOGA PR U SPORTU

    Directory of Open Access Journals (Sweden)

    Duško Tomić

    2005-05-01

    Full Text Available PR in the modern world are developed with rapid speed and become important aspect of strategic management. Modern menagers are very interesting in PR and they observe that there is not successful strategy without experiance theory and practice in PR. The goals must be defined, basic phylosophy to, and managers must take responsability and describe everithing what they have to do. It must be financial fond and evaluation must be done

  2. Présentation

    Directory of Open Access Journals (Sweden)

    Leger Claude-Louis

    2000-05-01

    Full Text Available Ce qui frappe aujourd’hui, c’est une évolution rapide des connaissances sur les quatre vitamines liposolubles qui font l’objet des revues générales présentées dans ce dossier, et plus particulièrement peut-être sur les vitamines A, D et E. On savait ces vitamines indispensables en raison de leur implication dans les réactions cellulaires, pas uniquement métaboliques d’ailleurs, mais on ne pouvait les soupçonner d’intervenir dans des phénomènes complexes touchant aux régulations cellulaires et à l’expression des gènes avant l’explosion des techniques de biologie moléculaire. Ces trois vitamines ont ainsi, entre autres, la capacité de réguler la prolifération et la différenciation cellulaire selon des mécanismes qui peuvent paraître différents aujourd’hui dans certains cas (pour la vitamine E par exemple, ou souvent proches (cas des vitamine A et D. Les quatre vitamines sont capables en revanche d’intervenir dans la mort cellulaire programmée (apoptose. Dans le cas du tissu osseux, ce sont les vitamines A, D et K qui agissent sur l’accrétion calcique. La vitamine E, quant à elle, pourrait prévenir, au moins théoriquement, l’ostéoporose.

  3. VizieR Online Data Catalog: KiDS-ESO-DR3 multi-band source catalog (de Jong+, 2017)

    Science.gov (United States)

    de Jong, J. T. A.; Verdoes Kleijn, G. A.; Erben, T.; Hildebrandt, H.; Kuijken, K.; Sikkema, G.; Brescia, M.; Bilicki, M.; Napolitano, N. R.; Amaro, V.; Begeman, K. G.; Boxhoorn, D. R.; Buddelmeijer, H.; Cavuoti, S.; Getman, F.; Grado, A.; Helmich, E.; Huang, Z.; Irisarri, N.; La Barbera, F.; Longo, G.; McFarland, J. P.; Nakajima, R.; Paolillo, M.; Puddu, E.; Radovich, M.; Rifatto, A.; Tortora, C; Valentijn, E. A.; Vellucci, C.; Vriend, W-J.; Amon, A.; Blake, C.; Choi, A.; Fenech, Conti I.; Herbonnet, R.; Heymans, C.; Hoekstra, H.; Klaes, D.; Merten, J.; Miller, L.; Schneider, P.; Viola, M.

    2017-04-01

    KiDS-ESO-DR3 contains a multi-band source catalogue encompassing all publicly released tiles, a total of 440 survey tiles including the coadded images, weight maps, masks and source lists of 292 survey tiles of KiDS-ESO-DR3, adding to the 148 tiles released previously (50 in KiDS-ESO-DR1 and 98 in KiDS-ESO-DR2). (1 data file).

  4. Force spectroscopy and fluorescence microscopy of dsDNA-YOYO-1 complexes: implications for the structure of dsDNA in the overstretching region.

    Science.gov (United States)

    Murade, Chandrashekhar U; Subramaniam, Vinod; Otto, Cees; Bennink, Martin L

    2010-06-01

    When individual dsDNA molecules are stretched beyond their B-form contour length, they reveal a structural transition in which the molecule extends 1.7 times its contour length. The nature of this transition is still a subject of debate. In the first model, the DNA helix unwinds and combined with the tilting of the base pairs (which remain intact), results in a stretched form of DNA (also known as S-DNA). In the second model the base pairs break resulting effectively in two single-strands, which is referred to as force-induced melting. Here a combination of optical tweezers force spectroscopy with fluorescence microscopy was used to study the structure of dsDNA in the overstretching regime. When dsDNA was stretched in the presence of 10 nM YOYO-1 an initial increase in total fluorescence intensity of the dye-DNA complex was observed and at an extension where the dsDNA started to overstretch the fluorescence intensity leveled off and ultimately decreased when stretched further into the overstretching region. Simultaneous force spectroscopy and fluorescence polarization microscopy revealed that the orientation of dye molecules did not change significantly in the overstretching region (78.0 degrees +/- 3.2 degrees). These results presented here clearly suggest that, the structure of overstretched dsDNA can be explained accurately by force induced melting.

  5. Force spectroscopy and fluorescence microscopy of dsDNA–YOYO-1 complexes: implications for the structure of dsDNA in the overstretching region

    Science.gov (United States)

    Murade, Chandrashekhar U.; Subramaniam, Vinod; Otto, Cees; Bennink, Martin L.

    2010-01-01

    When individual dsDNA molecules are stretched beyond their B-form contour length, they reveal a structural transition in which the molecule extends 1.7 times its contour length. The nature of this transition is still a subject of debate. In the first model, the DNA helix unwinds and combined with the tilting of the base pairs (which remain intact), results in a stretched form of DNA (also known as S-DNA). In the second model the base pairs break resulting effectively in two single-strands, which is referred to as force-induced melting. Here a combination of optical tweezers force spectroscopy with fluorescence microscopy was used to study the structure of dsDNA in the overstretching regime. When dsDNA was stretched in the presence of 10 nM YOYO-1 an initial increase in total fluorescence intensity of the dye–DNA complex was observed and at an extension where the dsDNA started to overstretch the fluorescence intensity leveled off and ultimately decreased when stretched further into the overstretching region. Simultaneous force spectroscopy and fluorescence polarization microscopy revealed that the orientation of dye molecules did not change significantly in the overstretching region (78.0°± 3.2°). These results presented here clearly suggest that, the structure of overstretched dsDNA can be explained accurately by force induced melting. PMID:20129944

  6. Measurements of $B\\rightarrow \\bar{D} D_{s0} ^{*+}(2317)$ decay rates and a search for isospin partners of the $D_{s0}^{*+} (2317)$

    CERN Document Server

    Choi, S -K; Abdesselam, A; Adachi, I; Aihara, H; Arinstein, K; Asner, D M; Aushev, T; Ayad, R; Babu, V; Badhrees, I; Bakich, A M; Barberio, E; Bhardwaj, V; Bhuyan, B; Bonvicini, G; Bozek, A; Bracko, M; Browder, T E; Cervenkov, D; Chen, A; Cheon, B G; Chilikin, K; Cho, K; Chobanova, V; Choi, Y; Cinabro, D; Dalseno, J; Danilov, M; Dolezal, Z; Drasal, Z; Drutskoy, A; Dutta, D; Eidelman, S; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Getzkow, D; Gillard, R; Glattauer, R; Goh, Y M; Golob, B; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; He, X H; Horiguchi, T; Hou, W -S; Iijima, T; Inami, K; Inguglia, G; Ishikawa, A; Itoh, R; Iwasaki, Y; Jaegle, I; Joffe, D; Julius, T; Kang, K H; Kato, E; Katrenko, P; Kawasaki, T; Kim, B H; Kim, D Y; Kim, H J; Kim, J B; Kim, J H; Kim, K T; Kim, S H; Kim, Y J; Kinoshita, K; Ko, B R; Kodys, P; Korpar, S; Krizan, P; Krokovny, P; Kumita, T; Kuzmin, A; Kwon, Y -J; Lange, J S; Lee, I S; Lewis, P; Li, H; Gioi, L Li; Libby, J; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Moon, H K; Mori, T; Mussa, R; Nakano, E; Nakao, M; Nanut, T; Natkaniec, Z; Nayak, M; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Pakhlov, P; Pakhlova, G; Pal, B; Park, C W; Park, H; Pedlar, T K; Pesantez, L; Pestotnik, R; Petric, M; Piilonen, L E; Ribezl, E; Ritter, M; Rostomyan, A; Ryu, S; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Solovieva, E; Staric, M; Steder, M; Tamponi, U; Tanaka, S; Tanida, K; Teramoto, Y; Trusov, V; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Usov, Y; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Wang, C H; Wang, M -Z; Wang, X L; Watanabe, Y; Williams, K M; Won, E; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2015-01-01

    We report improved measurements of the product branching fractions ${\\mathcal B}(B^+\\rightarrow\\bar{D}^0 D_{s0}^{*+} (2317))\\times{\\mathcal B}( D_{s0} ^{*+}(2317)\\rightarrow D_s^{+}\\pi^0) =(8.0^{+1.3}_{-1.2} \\pm 1.1 \\pm 0.4)\\times 10^{-4}$ and ${\\mathcal B}(B^0\\rightarrow D^- D_{s0} ^{*+}(2317))\\times{\\mathcal B}(D_{s0}^{*+}(2317)\\rightarrow D_s^{+}\\pi^0) =(10.2^{+1.3}_{-1.2} \\pm 1.0 \\pm 0.4)\\times 10^{-4}$, where the first errors are statistical, the second are systematic and the third are from $D$ and $D_s$ branching fractions. In addition, we report negative results from a search for hypothesized neutral ($Z^0$) and doubly charged ($Z^{++}$) isospin partners of the $D_{s0}^{*+}(2317)$ and provide upper limits on the product branching fractions ${\\mathcal B}(B^0 \\rightarrow D^0 z^0)\\times{\\mathcal B}(z^0\\rightarrow D_s^{+}\\pi^-)$ and ${\\mathcal B}(B^+\\rightarrow D^0 z^{++})\\times{\\mathcal B}(z^{++}\\rightarrow D_s^{+}\\pi^+)$ that are more than an order of magnitude smaller than theoretical expectations for t...

  7. Phenylmethimazole Blocks dsRNA-Induced IRF3 Nuclear Translocation and Homodimerization

    Directory of Open Access Journals (Sweden)

    Maria C. Courreges

    2012-10-01

    Full Text Available Previous studies revealed that phenylmethimazole (C10 inhibits IRF3 signaling, preventing dsRNA-induction of type 1 interferon gene expression, production, and downstream signaling. In the present study, we investigated the molecular basis for C10 inhibition of dsRNA-stimulated IRF3 signaling. IRF-3 Trans-AM assays were used to measure C10 effects on dsRNA induction of IRF3 DNA binding. Green fluorescent protein-labeled IRF3 was used to measure C10 effects on dsRNA-induced IRF3 nuclear translocation. Native PAGE, SDS PAGE, and western blotting were used to identify effects of C10 on IRF3 homodimer formation and phosphorylation, respectively. There was a significant impairment of dsRNA-induced IRF3 DNA binding activity in human embryonic kidney and pancreatic cancer cells with C10 treatment. C10 also blocked dsRNA-induced IRF3 nuclear translocation and homodimer formation without blocking serine 396 phosphorylation of IRF3. Together, these results indicate that C10 interferes with IRF3 signaling by blocking dsRNA-induced IRF3 homodimer formation, a prerequisite for nuclear translocation and DNA binding activities.

  8. VizieR Online Data Catalog: KiDS-ESO-DR3 multi-band source catalog (de Jong+, 2017)

    NARCIS (Netherlands)

    de Jong, J. T. A.; Verdoes Kleijn, G. A.; Erben, T.; Hildebrandt, H.; Kuijken, K.; Sikkema, G.; Brescia, M.; Bilicki, M.; Napolitano, N. R.; Amaro, V.; Begeman, K. G.; Boxhoorn, D. R.; Buddelmeijer, H.; Cavuoti, S.; Getman, F.; Grado, A.; Helmich, E.; Huang, Z.; Irisarri, N.; La Barbera, F.; Longo, G.; McFarland, J. P.; Nakajima, R.; Paolillo, M.; Puddu, E.; Radovich, M.; Rifatto, A.; Tortora, C; Valentijn, E. A.; Vellucci, C.; Vriend, W-J.; Amon, A.; Blake, C.; Choi, A.; Fenech Conti, I.; Herbonnet, R.; Heymans, C.; Hoekstra, H.; Klaes, D.; Merten, J.; Miller, L.; Schneider, P.; Viola, M.

    2017-01-01

    KiDS-ESO-DR3 contains a multi-band source catalogue encompassing all publicly released tiles, a total of 440 survey tiles including the coadded images, weight maps, masks and source lists of 292 survey tiles of KiDS-ESO-DR3, adding to the 148 tiles released previously (50 in KiDS-ESO-DR1 and 98 in

  9. The evaluation and management of respiratory disease in children with Down syndrome (DS).

    Science.gov (United States)

    Alsubie, Haya S; Rosen, Dennis

    2017-08-23

    Children with Down syndrome (DS) have wide range of respiratory problems. Although underlying abnormalities in the respiratory system are important causes of morbidity and mortality in children with DS, particularly in the young, abnormalities in other organ systems may also impact respiratory function. A comprehensive evaluation of the child with DS and respiratory disease may prevent short-term morbidity and mortality, and reduce the incidence of complications in the long term. This review provides an overview of the various causes of respiratory disease, and insight into some of the newer therapies available to treat obstructive sleep apnea, in this population. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Helical Structure Determines Different Susceptibilities of dsDNA, dsRNA, and tsDNA to Counterion-Induced Condensation

    Science.gov (United States)

    Kornyshev, Alexei A.; Leikin, Sergey

    2013-01-01

    Recent studies of counterion-induced condensation of nucleic acid helices into aggregates produced several puzzling observations. For instance, trivalent cobalt hexamine ions condensed double-stranded (ds) DNA oligomers but not their more highly charged dsRNA counterparts. Divalent alkaline earth metal ions condensed triple-stranded (ts) DNA oligomers but not dsDNA. Here we show that these counterintuitive experimental results can be rationalized within the electrostatic zipper model of interactions between molecules with helical charge motifs. We report statistical mechanical calculations that reveal dramatic and nontrivial interplay between the effects of helical structure and thermal fluctuations on electrostatic interaction between oligomeric nucleic acids. Combining predictions for oligomeric and much longer helices, we also interpret recent experimental studies of the role of counterion charge, structure, and chemistry. We argue that an electrostatic zipper attraction might be a major or even dominant force in nucleic acid condensation. PMID:23663846

  11. Exploring the decay B¯s0→Ds-(DK ) + to study DK scattering and the Ds0 * (2317) state

    Science.gov (United States)

    Albaladejo, Miguel; Nielsen, Marina; Oset, Eulogio

    2016-05-01

    We study the KD invariant mass distribution in the B¯s0→Ds-(KD ) + weak decay. We use recent lattice QCD results for the KD interaction, in which the Ds0 * (2317) resonance appears as a KD bound state. Since there are not yet experimental data on this reaction, in a second step we propose an analysis method to obtain information on the Ds0 * (2317) resonance from the future experimental KD mass distribution in this decay. For this purpose, synthetic data are generated from our theoretical distribution, to which we attach a 5% or 10% error. With this analysis method, it is shown that one can obtain from these "data" the existence of a bound KD state, the KD scattering length and effective range, and most importantly, the KD probability in the wave function of the bound state obtained, which was found to be largely dominant in lattice QCD studies.

  12. PR's involvement in International Cooperation

    NARCIS (Netherlands)

    Anonymous,

    1995-01-01

    In The Netherlands, the Research Station for Cattle, Sheep and Horse Husbandry (in Dutch abbreviated as PR) bridges the gap between more basic and disciplinary research done at universities and research institutes on the one hand and the extension service and the farmers on the other hand. The PR

  13. Préface

    Science.gov (United States)

    Ouerdane, Youcef; Laporte, Pierre

    2005-06-01

    L'objectif de la série de colloques UVX est de réunir, au rythme d'une fois tous les deux ans, les scientifiques et industriels travaillant dans le domaine du développement des sources de photon de grande énergie (UV, VUV, et X) et de leurs applications. En particulier cette manifestation est l'occasion de faire se rencontrer une communauté très pluridisciplinaire (physique, chimie, biologie, sciences de l'univers) liée à des domaines en forte évolution technologique (lasers et rayonnement synchrotron notamment). Le colloque UVX 2004 s'est tenu au Palais des Congrès de Saint-Étienne (42000) du 7 au 11 juin 2004. La période écoulée depuis l'édition précédente (Oléron 2002) a été particulièrement active dans tous les domaines concernés : grands projets de sources, méthodes de diagnostic au sens large. Une nouvelle fois on constate que le bref et l'ultra-bref ont une place privilégiée, qu'il s'agisse du travail sur les accélérateurs ou sur les lasers qui, bien sûr, dans la course aux temps courts remportent la palme avec la présence de spécialistes du domaine attoseconde. La communauté représentée a la chance d'être en prise directe avec de très grands projets en phase active de réalisation comme le Laser Megajoule (LMJ), la source SOLEIL, et un projet d'ampleur plus modeste mais remarquable dans son domaine : la source LASERIX d'Orsay/Palaiseau. On pourra citer aussi le projet Arc en Ciel qui, lui, est encore au stade de sa définition. - SOLEIL, source de nouvelle génération de rayonnement synchrotron (plateau de Saclay) est dans une phase active de réalisation : achèvement de l'infrastructure en 2005 et injection du 1o faisceau dans l'anneau de stockage prévu également en 2005. Cette source devrait être la meilleure au monde dans le domaine VUV/X mous, tout en restant très polyvalente (brillance, accordabilité, structure temporelle, polarisation) et complémentaire de l'ESRF. Au final on disposera de 21 lignes de lumi

  14. Préface

    Science.gov (United States)

    Aspect, Alain

    2004-11-01

    COLOQ est une conférence regroupant, tous les deux ans, la communauté scientifique et industrielle nationale travaillant dans les domaines des lasers, de l'optique non-linéaire et de l'optique quantique. Elle s'est tenue pour sa huitième édition à Toulouse, du 3 au 5 septembre 2004, sur le campus de I'INSA. Comme il est de tradition tous les quatre ans, COLOQ était couplé avec Horizons de l'optique, avec en particulier une journée commune dont le programme avait été préparé en concertation par les deux comités scientifiques. Depuis sa création, COLOQ a pour but de favoriser les rencontres entre les chercheurs des différents laboratoires nationaux publics ou privés travaillant sur les lasers et l'optique quantique au sens large. C'est un moyen privilégié de resserrer les liens de cette communauté et d'y intégrer les jeunes chercheurs. Ces derniers y trouvent l'occasion de se connaître, de se faire connaître, de découvrir la communauté à laquelle ils appartiennent et d'élargir leurs connaissances des thèmes qui la structurent. La participation de 230 chercheurs et d'une vingtaine d'exposants de matériels spécialisés dans les lasers et l'optoélectronique témoigne de la vitalité de COLOQ et de son audience dans les laboratoires et chez les industriels de l'optique. Le programme de COLOQ 8 comportait d'une vingtaine de conférences générales données par des chercheurs de renom international, et des séances de communications par affiches, occasions privilégiées de rencontres et d'échanges. Les exposés ont porté sur des sujets particulièrement actifs au niveau national et international, avec un accent sur des thèmes importants pour la région toulousaine : contrôle cohérent, optique et nanosciences, optique et astronomie, sans oublier la traditionnelle rubrique phénomènes fondamentaux, éclectique pour ne pas dire hétéroclite, mais si représentative d'une des ambitions de COLOQ qui est d'offrir à ses participants une

  15. A Charrelation Matrix-Based Blind Adaptive Detector for DS-CDMA Systems.

    Science.gov (United States)

    Luo, Zhongqiang; Zhu, Lidong

    2015-08-14

    In this paper, a blind adaptive detector is proposed for blind separation of user signals and blind estimation of spreading sequences in DS-CDMA systems. The blind separation scheme exploits a charrelation matrix for simple computation and effective extraction of information from observation signal samples. The system model of DS-CDMA signals is modeled as a blind separation framework. The unknown user information and spreading sequence of DS-CDMA systems can be estimated only from the sampled observation signals. Theoretical analysis and simulation results show that the improved performance of the proposed algorithm in comparison with the existing conventional algorithms used in DS-CDMA systems. Especially, the proposed scheme is suitable for when the number of observation samples is less and the signal to noise ratio (SNR) is low.

  16. Uniform Circular Antenna Array Applications in Coded DS-CDMA Mobile Communication Systems

    National Research Council Canada - National Science Library

    Seow, Tian

    2003-01-01

    ...) has greatly increased. This thesis examines the use of an equally spaced circular adaptive antenna array at the mobile station for a typical coded direct sequence code division multiple access (DS-CDMA...

  17. Stream Habitat Reach Summary - San Francisco Bay, Central Coast [ds159

    Data.gov (United States)

    California Department of Resources — The Stream Habitat - San Francisco Bay, Central and South Coasts [ds159] shapefile contains four years of in-stream salmonid habitat data at the reach level. The...

  18. An efficient digital signal processing method for RRNS-based DS-CDMA systems

    Directory of Open Access Journals (Sweden)

    Peter Olsovsky

    2017-09-01

    Full Text Available This paper deals with an efficient method for achieving low power and high speed in advanced Direct-Sequence Code Division Multiple-Access (DS-CDMA wireless communication systems based on the Residue Number System (RNS. A modified algorithm for multiuser DS-CDMA signal generation in MATLAB is proposed and investigated. The most important characteristics of the generated PN code are also presented. Subsequently, a DS-CDMA system based on the combination of the RNS or the so-called Redundant Residue Number System (RRNS is proposed. The enhanced method using a spectrally efficient 8-PSK data modulation scheme to improve the bandwidth efficiency for RRNS-based DS-CDMA systems is presented. By using the C-measure (complexity measure of the error detection function, it is possible to estimate the size of the circuit. Error detection function in RRNSs can be efficiently implemented by LookUp Table (LUT cascades.

  19. Self-association of an activating natural killer cell receptor, KIR2DS1.

    Directory of Open Access Journals (Sweden)

    Michael Hayley

    Full Text Available As a major component of the innate immune system, natural killer cells are responsible for activating the cytolytic killing of certain pathogen-infected or tumor cells. The self-recognition of natural killer cells is achieved in part by the killer cell immunoglobulin-like receptors (KIRs protein family. In the current study, using a suite of biophysical methods, we investigate the self-association of an activating KIR, KIR2DS1. This KIR is of particular interest because when in the presence of the HLA-Cw6 protein, KIR2DS1 becomes a major risk factor for psoriasis, an autoimmune chronic skin disease. Using circular dichroism spectroscopy, dynamic light scattering, and atomic force microscopy, we reveal that KIR2DS1 self-associates in a well-defined fashion. Our novel results on an activating KIR allow us to suggest a working model for the KIR2DS1- HLA class I molecular mechanism.

  20. A Charrelation Matrix-Based Blind Adaptive Detector for DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    Zhongqiang Luo

    2015-08-01

    Full Text Available In this paper, a blind adaptive detector is proposed for blind separation of user signals and blind estimation of spreading sequences in DS-CDMA systems. The blind separation scheme exploits a charrelation matrix for simple computation and effective extraction of information from observation signal samples. The system model of DS-CDMA signals is modeled as a blind separation framework. The unknown user information and spreading sequence of DS-CDMA systems can be estimated only from the sampled observation signals. Theoretical analysis and simulation results show that the improved performance of the proposed algorithm in comparison with the existing conventional algorithms used in DS-CDMA systems. Especially, the proposed scheme is suitable for when the number of observation samples is less and the signal to noise ratio (SNR is low.

  1. SMART-DS: Synthetic Models for Advanced, Realistic Testing: Distribution Systems and Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Palmintier, Bryan: Hodge, Bri-Mathias

    2017-01-26

    This presentation provides a Smart-DS project overview and status update for the ARPA-e GRID DATA program meeting 2017, including distribution systems, models, and scenarios, as well as opportunities for GRID DATA collaborations.

  2. 22q11.2DS deletion syndrome: developmental milestones in infants and toddlers.

    Science.gov (United States)

    Roizen, Nancy J; Antshel, Kevin M; Fremont, Wanda; AbdulSabur, Nuria; Higgins, Anne Marie; Shprintzen, Robert J; Kates, Wendy R

    2007-04-01

    The majority of children with 22q11.2DS deletion syndrome (22q11.2DS) have learning disabilities, and a substantial number have mental retardation. Although cognitive data have been reported on several samples of children with 22q11.2DS, data on their early developmental milestones are limited. The present study used a retrospective design and asked parents to recall developmental milestones. The participants were 88 children with 22q11.2DS, 47 community controls, and 29 sibling controls. Although very early gross motor and expressive language milestones did not differ significantly from comparison groups, subsequent gross motor and expressive language milestones did, suggesting that children with 22q11.2DS may begin to lag behind their peers sometime after the first year of life in these two domains. These patterns were also apparent when a subset of intellectually comparable children (22q11.2DS, n = 40 vs community controls, n = 24) was analyzed. We further found that receptive language and social adaptive milestones did not differ from comparison samples in either the early or later period. Receptive language delays were predictive of later Wechsler Intelligence Scale for Children-Third Edition Perceptual Organization Index scores, particularly in girls with 22q11.2DS. This suggests that although receptive language may be an area of relative strength in the developmental profile of young children with 22q11.2DS, even mild receptive delays should not be overlooked in early interventions with children with this disorder.

  3. LHCb Sensitivity to $\\gamma$ with $B_{s} \\to D_{s} K$

    CERN Document Server

    Rodrigues, E

    2005-01-01

    The decay channels Bs->DsK and Bs->DsPi can be used to extract the CKM-matrix gamma angle, a parameter of the Standard Model not yet directly measured. The strategy of the LHCb experiment for such a measurement is described. We also outline the event selection criteria, the expected annual yields and background-over-signal B/S ratii, and the expected precision on the CKM gamma measurement.

  4. Absolute Branching Fraction Measurements for Exclusive $D_s$ Semileptonic Decays

    CERN Document Server

    Yelton, J

    2009-01-01

    We measure the absolute branching fractions of $\\Ds$ semileptonic decays where the hadron in the final state is one of $\\phi$, $\\eta$, $\\etap$, $\\Ks$, $\\Kstar$, and $f_0$, using $2.8 \\times 10^5$ $\\epm \\to \\Ds\\Dsstar$ decays collected in the CLEO-c detector at a center-of-mass energy close to 4170 MeV. We obtain ${\\cal B}(\\Dsp\\to \\phi e^+ \

  5. Functional genomics tool: Gene silencing in Ixodes scapularis eggs and nymphs by electroporated dsRNA

    Directory of Open Access Journals (Sweden)

    Troiano Emily

    2010-01-01

    Full Text Available Abstract Background Ticks are blood-sucking arthropods responsible for transmitting a wide variety of disease-causing agents, and constitute important public health threats globally. Ixodes scapularis is the primary vector of the Lyme disease agent in the eastern and central U.S. RNAi is a mechanism by which gene-specific double-stranded RNA (dsRNA triggers degradation of homologous mRNA transcripts. Here, we describe an optimized protocol for effectively suppressing gene expression in the egg and nymphal stages of I. scapularis by electroporation. Results The genes encoding the putative Phospholipase A2 (PLA2, cytoplasmic Cystatin, Syntaxin-5, β-Actin and Calreticulin were targeted by delivering the dsRNA encoding the specific gene coding regions in the unfed nymphs. Silencing was measured using real time qRT-PCR. Electroporation as a mode of dsRNA delivery appears to be substantially efficient and less traumatic to the tick than dsRNA microinjection in the unfed nymphs. Using Cy3-labeled dsRNA to monitor the movement, electroporated dsRNA entered the nymphs and spread to salivary glands and other tissues. The significant disruption of β-actin and cytoplasmic Cystatin transcripts in tick eggs demonstrate the applicability of this technique. The PLA2, cytoplasmic Cystatin, Syntaxin-5, β-Actin and Calreticulin genes were also significantly silenced, suggesting that this method has the potential to introduce dsRNA in eggs and unfed nymphs. Conclusions Our study demonstrates that electroporation can be used as a simple dsRNA delivery tool in assessing the functional role of tick genes in the vector-host interactions. This technique represents a novel approach for specific gene suppression in immature stages of ticks.

  6. Préface

    Science.gov (United States)

    Hamieh, Tayssir

    2005-05-01

    Né simultanément à Mulhouse et à Beyrouth en 1996 dans le cadre d'une collaboraiion franco-libanaise sur une initiative personnelle de Monsieur Tayssir HAMIEH. le Colloque Franco-Libanais sur la Science des Matériaux (CSM), qui s'inscrit dans le cadre des relations étroites entre la France et le Liban, est très vite devenu une occasion très importante de rencontre entre scientifiques de haut niveau, non seulement, du contour méditerranéen mais également des pays européens, américains et arabes. La quatrieme édition CSM4 est une véritable réussite grâce à la participation des chercheurs confirmés dans tous les domaines des sciences de matériaux et venant de plusieurs pays tels que la France, I'Algérie, Le Liban, la Syrie, le Maroc, la Tunisie, l'Italie, l'Espagne, le Portugal, le Royaume Uni, les États-Unis, la Russie, l'Allemagne, le Japon et I'Inde ; pour présenter plus de 350 communications orales et par affiche et couvrant presque toutes les disciplines des systèmes des matériaux. Le choix des diffèrents thèmes du colloque sur la science des matériaux a été dicté par l'importance capitale de cette discipline dans notre civilisation moderne. En fait, les matériaux utilisés pour la fabrication artisanale ou industrielle d'objets, de produits et de systèmes ainsi que pour la réalisation de constructions et d'équipements ont de tout temps défini le niveau de notre civilisation technique. La réalisation des objectifs communs de notre monde en plein développement, pour ne pas dire en pleine mutation, est en grande partie tributaire de la mise au point de nouveaux matériaux et de procédés de transformation et d'assemblages nouveaux, présentant des performances et des qualités améliorées. Le colloque a illustré et traduit, de manière remarquables, l'excellente collaboration entre chercheurs libanais et français. Le partenariat est exemplaire par la qualité des laboratoires impliqués et par le niveau scientifique des r

  7. Prólogo

    Directory of Open Access Journals (Sweden)

    Alta Suzzane Hooker Blandford

    2017-08-01

    Full Text Available Este volumen No. 20, presenta una compilación estructurada en 5 secciones, las cuales comprenden 9 artículos, en el área de Educación: Estrategias de evaluación en la enseñanza de los algoritmos de factorización en noveno grado de Educación Secundaria. La segunda sección, en Ciencias Sociales: 2 Alianza estratégica entre Venezuela y Nicaragua para la construcción de una refinería petrolera; 3 Breves consideraciones sobre el código aduanero del MERCOSUR (CAM. Fuentes y antecedentes de creación; 4. Plan de Desarrollo Municipal como herramienta de gestión pública de la ciudad de Siuna, Costa Caribe Norte de Nicaragua. En la tercera sección, Salud: 5 Hombres creole y cáncer de próstata en Bluefields, Costa Caribe Sur de Nicaragua. En la cuarta sección, Recursos Naturales y Medio Ambiente: 6 Calidad del agua potable y su efecto en la salud de la comunidad de Kamla, Costa Caribe Norte de Nicaragua; 7 Gobernanza forestal en el territorio Twi Waupasa, Costa Caribe Norte de Nicaragua. En la quinta sección, Agropecuaria: 8 Germinación del coco (Cocos nucifera, utilizando tres tipos de cortes en Sandy Bay Sirpi, Costa Caribe Sur de Nicaragua; 9 Manejo de pastizales en sistemas de producción ganaderos de Nueva Guinea, Costa Caribe Sur de Nicaragua  Los resultados de estas investigaciones aportan significativamente a la praxis in- novadora de la comunidad universitaria, y constituyen un medio educativo y de comunicación para compartir con la comunidad de profesores, investigadores y estudiantes del mundo, en una expresión crítica, autónoma y de emancipación en un ambiente de interculturalidad.

  8. ESO PR Highlights in 2006

    Science.gov (United States)

    2007-01-01

    Last year proved to be another exceptional year for the European organisation for ground-based astronomy. ESO should begin the New Year with two new member states: Spain (PR 05/06) and the Czech Republic (PR 52/06). ESO PR Highlights 2006 2006 was a year of renovation and revolution in the world of planets. A new Earth-like exoplanet has been discovered (PR 03/06) using a network of telescopes from all over the world (including the Danish 1.54-m one at ESO La Silla). It is not the only child of this fruitful year: thanks to the combined use of ESO's Very Large Telescope (VLT) and La Silla instruments, a surprising system of twin giant exoplanets was found (PR 29/06), and a trio of Neptune-like planets hosted by a nearby star were identified (PR 18/06). These results open new perspectives on the search for habitable zones and on the understanding of the mechanism of planet formation. The VISIR instrument on the VLT has been providing unique information to answer this last question, by supplying a high resolution view of a planet-forming disc (PR 36/06). There are not only new members in the planets' register: during the General Assembly of the International Astronomical Union held in Prague (Czech Republic), it was decided that Pluto is not a planet anymore but a 'dwarf planet'. Whatever its status, Pluto still has a satellite, Charon, whose radius and density have been measured more accurately by observing a rare occultation from different sites, including Cerro Paranal (PR 02/06). The scientific community dedicated 2006 to the great physicist James Clerk Maxwell (it was the 175th anniversary of the birth): without his electromagnetic theory of light, none of the astonishing discoveries of modern physics could have been achieved. Nowadays we can look at distant galaxies in great detail: the GIRAFFE spectrograph on the VLT revealed that galaxies 6 billion years ago had the same amount of dark matter relative to stars than nowadays (PR 10/06), while SINFONI gave an

  9. Improvement of DS Evidence Theory for Multi-Sensor Conflicting Information

    Directory of Open Access Journals (Sweden)

    Fang Ye

    2017-05-01

    Full Text Available A new DS (Dempster-Shafer combination method is presented in this paper. As data detected by a single sensor are characterized by not only fuzziness, but also partial reliability, the development of multi-sensor information fusion becomes extremely indispensable. The DS evidence theory is an effective means of information fusion, which can not only deal with the uncertainty and inconsistency of multi-sensor data, but also handle the inevitably ambiguity and instability under noise or possible interference. However, the application of DS evidence theory has some limitations when multi-sensor data are conflicting. To address this issue, the DS evidence theory is modified in this paper. Adopting the idea of cluster analysis, we firstly introduce the Lance distance function and spectral angle cosine function to revise original evidence separately before the combination of evidence. Then, based on the modifications of original evidence, an improved conflict redistribution strategy is ulteriorly raised to fuse multi-sensor information. Finally, the numerical simulation analyses demonstrate that the improvement of the DS evidence theory available in this paper overcomes the limitations of conventional DS evidence theory, and realizes more reliable fusion with multi-sensor conflicting information compared to the existing methods.

  10. Structural Basis for dsRNA Recognition by NS1 Protein of Influenza A Virus

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, A.; Wong, S; Yuan, Y

    2009-01-01

    Influenza A viruses are important human pathogens causing periodic pandemic threats. Nonstructural protein 1 (NS1) protein of influenza A virus (NS1A) shields the virus against host defense. Here, we report the crystal structure of NS1A RNA-binding domain (RBD) bound to a double-stranded RNA (dsRNA) at 1.7A. NS1A RBD forms a homodimer to recognize the major groove of A-form dsRNA in a length-independent mode by its conserved concave surface formed by dimeric anti-parallel alpha-helices. dsRNA is anchored by a pair of invariable arginines (Arg38) from both monomers by extensive hydrogen bonds. In accordance with the structural observation, isothermal titration calorimetry assay shows that the unique Arg38-Arg38 pair and two Arg35-Arg46 pairs are crucial for dsRNA binding, and that Ser42 and Thr49 are also important for dsRNA binding. Agrobacterium co-infiltration assay further supports that the unique Arg38 pair plays important roles in dsRNA binding in vivo.

  11. In-medium properties of pseudoscalar D_s and B_s mesons

    Science.gov (United States)

    Chhabra, Rahul; Kumar, Arvind

    2017-11-01

    We calculate the shift in the masses and decay constants of D_s(1968) and B_s(5370) mesons in hot and dense asymmetric strange hadronic matter using QCD sum rules and chiral SU(3) model. In-medium strange quark condensates _{ρ _B}, and gluon condensates _{ρ _B}, to be used in the QCD sum rules for pseudoscalar D_s and B_s mesons, are calculated using a chiral SU(3) model. As an application of our present work, we calculate the in-medium decay widths of the excited (c\\bar{s}) states D_s^*(2715) and D_s^*(2860) decaying to (D_s(1968),η ) mesons. The medium effects in their decay widths are incorporated through the mass modification of the D_s(1968) and η mesons. The results of the present investigation may be helpful in understanding the possible outcomes of the future experiments like CBM and PANDA under the FAIR facility.

  12. Political PR is dying. Long live business PR! / Ilyn Oleg

    Index Scriptorium Estoniae

    Oleg, Ilyn

    2005-01-01

    Vene suurima suhtekorraldusagentuuri Imageland Public Relations rahvusvaheliste suhete juhi hinnangul on Venemaal peamisteks probleemideks PR professionaalide vähesus, nende kehv haritus oma erialal, samuti vähene teadlikkus suhtekorralduse tähtsusest äris

  13. Observation of $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ decays

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    The decays $B^+_c \\rightarrow J/\\psi D_s^+$ and $B^+_c \\rightarrow J/\\psi D_s^{*+}$ are observed for the first time using a dataset, corresponding to an integrated luminosity of 3$fb^{-1}$, collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of $\\sqrt{s}$=7 and 8 TeV. The statistical significance for both signals is in excess of 9 standard deviations. The following ratios of branching fractions are measured to be \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^+)/BR( B^+_c \\rightarrow J/\\psi \\pi+ ) = 2.90 \\pm 0.57 \\pm 0.24$,\\end{equation*} \\begin{equation*}BR( B^+_c \\rightarrow J/\\psi D_s^{*+} ) / BR ( B^+_c \\rightarrow J/\\psi D_s^+ ) = 2.37 \\pm 0.56 \\pm 0.10, \\end{equation*} where the first uncertainties are statistical and the second systematic. The mass of the $B^+_c$ meson is measured to be \\begin{equation*}m_{B^+_c} = 6276.28 \\pm 1.44 (stat) \\pm 0.36(syst) MeV/c^2,\\end{equation*} using the $B^+_c \\rightarrow J/\\psi D_...

  14. Présentation

    Directory of Open Access Journals (Sweden)

    Gregor Perko

    2011-12-01

    Full Text Available Au cours des dernières décennies où l’on assiste à une refondation de la morphologie, la discipline s’intéresse de plus en plus à des phénomènes « périphériques », « marginaux », « irréguliers » ou « extragrammaticaux », à des phénomènes n’appartenant pas aux « régions nodales » de la morphologie. Le présent numéro de Linguistica, premier numéro thématique de notre revue, réunit des études qui s’intéres- sent aux frontières internes et externes de la morphologie. La diversité et la richesse des thèmes abordés et des approches proposées témoignent d’un intérêt croissant que les linguistes, non pas uniquement les morphologues, portent à cette thématique. Les articles proposés s’articulent autour de cinq axes majeurs. Un premier axe rassemble les articles qui étudient les frontières entre différentes composantes de la morphologie. L’étude de Michel Roché examine les contraintes lexicales et morphophonologiques sur le paradigme des dérivés en –aie. Les résultats de son analyse remettent en question la notion de « règle de construction des lexèmes ». Irena Stramljič Breznik et Ines Voršič se penchent sur les néologismes de sport en slovène et essaient d’évaluer la productivité ou la créativité des procédés morphologiques en jeu. Dans une étude d’inspiration cognitiviste, Alexandra Bagasheva aborde l’hétérogénéité des verbes composés en anglais. En s’appuyant sur les données fournies par les para- digmes verbaux du maltais, Maris Camilleri examine la complexité du phénomène de classes flexionnelles basées sur les radicaux. Trois travaux concernent des procédés typiquement « extragrammaticaux » servant à former le plus souvent des occasionnalismes: Arnaud Léturgie tente de dégager des propriétés prototypiques de l’amalgamation lexicale en français, notamment celles de la création des mots-valises; Silvia Cacchiani analyse, à l

  15. CXCR2 is critical for dsRNA-induced lung injury: relevance to viral lung infection

    Directory of Open Access Journals (Sweden)

    Xue Ying

    2005-05-01

    Full Text Available Abstract Background Respiratory viral infections are characterized by the infiltration of leukocytes, including activated neutrophils into the lung that can lead to sustained lung injury and potentially contribute to chronic lung disease. Specific mechanisms recruiting neutrophils to the lung during virus-induced lung inflammation and injury have not been fully elucidated. Since CXCL1 and CXCL2/3, acting through CXCR2, are potent neutrophil chemoattractants, we investigated their role in dsRNA-induced lung injury, where dsRNA (Poly IC is a well-described synthetic agent mimicking acute viral infection. Methods We used 6–8 week old female BALB/c mice to intratracheally inject either single-stranded (ssRNA or double-stranded RNA (dsRNA into the airways. The lungs were then harvested at designated timepoints to characterize the elicited chemokine response and resultant lung injury following dsRNA exposure as demonstrated qualititatively by histopathologic analysis, and quantitatively by FACS, protein, and mRNA analysis of BAL fluid and tissue samples. We then repeated the experiments by first pretreating mice with an anti-PMN or corresponding control antibody, and then subsequently pretreating a separate cohort of mice with an anti-CXCR2 or corresponding control antibody prior to dsRNA exposure. Results Intratracheal dsRNA led to significant increases in neutrophil infiltration and lung injury in BALB/c mice at 72 h following dsRNA, but not in response to ssRNA (Poly C; control treatment. Expression of CXCR2 ligands and CXCR2 paralleled neutrophil recruitment to the lung. Neutrophil depletion studies significantly reduced neutrophil infiltration and lung injury in response to dsRNA when mice were pretreated with an anti-PMN monoclonal Ab. Furthermore, inhibition of CXCR2 ligands/CXCR2 interaction by pretreating dsRNA-exposed mice with an anti-CXCR2 neutralizing Ab also significantly attenuated neutrophil sequestration and lung injury. Conclusion

  16. Préface

    Science.gov (United States)

    Jörgen Stevefelt, Henri Bachau Et

    2003-06-01

    UVX 2002, sixième édition du “Colloque sur les Sources Cohérentes et Incohérentes UV, VUV, et X : Applications et Développements Récents" s'est tenu du 11 au 14 juin 2002 au Centre CAES du CNRS “La Vieille, Perrotine", à Saint-Pierre d'Oléron. Le colloque a réunni une centaine de chercheurs et d'industriels et a permis de faire le point sur la production, la caractérisation et l'utilisation de rayonnement dans un domaine spectral s'étendant de l'ultraviolet aux rayons X. Les participants ont pu assister a trente conférences et une table ronde autour des problèmes locaux de pollution, une cinquantaine d'affiches ont été présentées au travers de deux sessions. Une douzaine d'industriels ont exposé leurs produits durant les séances d'affiches.Conformément aux éditions précédentes, les domaines couverts par le colloque UVX 2002 sont très variés et il est impossible de les résumer en quelques lignes. Parmi les activités en développement rapide on notera les lasers femtosecondes dont les applications se multiplient dans les laboratoires (propriétés des molécules, agrégats et solides), dans l'industrie (usinage, ablation...) et en médecine. L'absence de thermalisation ou de diffusion thermique ouvre aussi des perspectives pour la réalisation de films minces par ablation laser, un domaine où les lasers excimères sont traditionnellement utilisés, avec des applications importantes dans le secteur des télécommunications. Dans le domaine de l'extrème UV, des progrès significatifs ont été réalisés par plusieurs groupes dans la gamme de longueur d'onde de 5 à 20 nm, ouvrant ainsi la voie au développement industriel de la lithographie EUV. On note les progrès dans la réalisation des sources UV et X (laser X, génération d'harmoniques, laser a électrons libres) et la nécessité de développer des optiques adaptées. Une perspective intéressante, ouverte par la génération d'harmoniques, est la production d

  17. [22q11.2DS Syndrome as a Genetic Subtype of Schizophrenia].

    Science.gov (United States)

    Huertas-Rodríguez, Cindy Katherin; Payán-Gómez, César; Forero-Castro, Ruth Maribel

    2015-01-01

    The 22q11.2 deletion syndrome (22q11.2DS) is associated with the microdeletion of this chromosomal region, and represents the second most common genetic syndrome after Down's syndrome. In patients with schizophrenia, 22q11.2DS has a prevalence of 2%, and in selected groups can be increased to between 32-53%. To describe the generalities of 22q11.2DS syndrome as a genetic subtype of schizophrenia, its clinical characteristics, molecular genetic aspects, and frequency in different populations. A review was performed from 1967 to 2013 in scientific databases, compiling articles about 22q11.2DS syndrome and its association with schizophrenia. The 22q11.2 DS syndrome has a variable phenotype associated with other genetic syndromes, birth defects in many tissues and organs, and a high rate of psychiatric disorders, particularly schizophrenia. Likewise, it has been identified in clinical populations with schizophrenia selected by the presence of common syndromic characteristics. FISH, qPCR and MLPA techniques, and recently, aCGH and NGS technologies, are being used to diagnose this microdeletion. It is important in clinical practice to remember that people suffering the 22q11.2DS have a high genetic risk for developing schizophrenia, and it is considered that the simultaneous presence of this disease and 22q11.2DS represents a genetic subtype of schizophrenia. There are clear phenotypic criteria, molecular and cytogenetic methods to diagnose this group of patients, and to optimize a multidisciplinary approach in their monitoring. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.

  18. Sensitive DsRed fluorescence-based reporter cell systems for genotoxicity and oxidative stress assessment.

    Science.gov (United States)

    Hendriks, Giel; Atallah, Mirna; Raamsman, Martine; Morolli, Bruno; van der Putten, Haidy; Jaadar, Haziz; Tijdens, Ine; Esveldt-van Lange, Rebecca; Mullenders, Leon; van de Water, Bob; Vrieling, Harry

    2011-05-10

    Various in vitro test systems have been developed for genotoxic risk assessment in early drug development. However, these genotoxicity tests often show limited specificity, and provide limited insights into the mode of toxicity of the tested compounds. To identify genes that could serve as specific biomarkers for genotoxicity or oxidative stress, we exposed mouse embryonic stem (ES) cells to various genotoxic and oxidative stress-inducing compounds and performed genome-wide expression profiling. Differentially expressed genes were classified based on the fold-change of expression and their specificity for either genotoxic or oxidative stress. Promoter regions of four selected genes (Ephx1, Btg2, Cbr3 and Perp) were fused to a DsRed fluorescent reporter gene and stably integrated in mouse ES cells. Established stable reporter cell lines displayed significant induction of DsRed expression upon exposure to different classes of genotoxic and oxidative stress-inducing compounds. In contrast, exposure to non-genotoxic carcinogenic compounds did not induce DsRed expression even at cytotoxic doses. Expression of the Cbr3-DsRed reporter was more responsive to compounds that induce oxidative stress while the other three DsRed reporters reacted more specific to direct-acting genotoxic agents. Therefore, the differential response of the Btg2- and Cbr3-DsRed reporters can serve as indicator for the main action mechanism of genotoxic and oxidative stress-inducing compounds. In addition, we provide evidence that inhibition of DNA replication results in preferential activation of the Btg2-DsRed genotoxicity reporter. In conclusion, we have generated sensitive mouse ES cell reporter systems that allow detection of genotoxic and oxidative stress-inducing properties of chemical compounds and can be used in high-throughput assays. Copyright © 2011 Elsevier B.V. All rights reserved.

  19. Refinement and revalidation of the demoralization scale: The DS-II-external validity.

    Science.gov (United States)

    Robinson, Sophie; Kissane, David W; Brooker, Joanne; Hempton, Courtney; Michael, Natasha; Fischer, Jane; Franco, Michael; Sulistio, Merlina; Clarke, David M; Ozmen, Mehmet; Burney, Susan

    2016-07-15

    The recently refined Demoralization Scale-II (DS-II) is a 16-item, self-report measure of demoralization. Its 2 factors-Meaning and Purpose and Distress and Coping Ability-demonstrate sound internal validity, including item fit, unidimensionality, internal consistency, and test-retest reliability. The convergent and discriminant validity of the DS-II with various measures is reported here. Patients who had cancer or other progressive diseases and were receiving palliative care (n = 211) completed a battery of questionnaires, including the DS-II and measures of symptom burden, quality of life, depression, and attitudes toward the end of life. Spearman ρ correlations were determined to assess convergent validity. Mann-Whitney U tests with calculated effect sizes were used to examine discriminant validity and establish the minimal clinically important difference (MCID). Cross-tabulation frequencies with chi-square analyses were used to examine discriminant validity with major depression. The DS-II demonstrated convergent validity with measures of psychological distress, quality of life, and attitudes toward the end of life. It also demonstrated discriminant validity, as the DS-II differentiated patients who had different functional performance levels and high/low symptoms, with a difference of 2 points between groups on the DS-II considered clinically meaningful. Furthermore, discriminant validity was demonstrated, as comorbidity with depression was not observed at moderate levels of demoralization. The DS-II has sound psychometric properties and is an appropriate measure of demoralization. Given its structural simplicity and brevity, it is likely to be a useful tool in meaning-centered therapies. Cancer 2016;122:2260-7. © 2016 American Cancer Society. © 2016 American Cancer Society.

  20. Préface

    Science.gov (United States)

    Moncorgé, R.

    2006-12-01

    Cette nouvelle édition du Colloque UVX avait pour objectifs de : - réunir les chercheurs et les industriels intéressés par les applications et les développements les plus récents obtenus sur les sources UV, VUV et X, cohérentes ou incohérentes, et les optiques et matériaux associés ; - dresser un bilan des sources de photons à haute énergie et de leurs applications courantes et futures ; - susciter de nouvelles collaborations ; - ouvrir de nouveaux champs disciplinaires. Elle a été organisée par le laboratoire CIRIL au VVF de Colleville-sur-Mer, dans le département du Calvados, du 6 au 9 juin 2006, la journée du 5 juin ayant été consacrée à une réunion de travail du GDR CNRS SAXO, ce GDR regroupant une majorité de scientifiques concernés par le Colloque UVX. La manifestation a réuni ainsi une centaine de participants dont une dizaine d'exposants industriels. Parmi ces participants, trente étaient invités à donner une conférence orale. Une sélection a été faite également parmi les meilleures communications soumises par affiches pour qu'elles soient présentées oralement. Une trentaine de ces communications ont été préparées sous la forme d'articles de 6 à 12 pages et font l'objet de cet ouvrage. De nombreux travaux récents ont été exposés tant au niveau des sources que des techniques de caractérisation et des applications, ceci dans des domaines très divers allant de la physique des lasers et de la mise en forme spatiale et temporelle des faisceaux au domaine de l'imagerie médicale et biologiques en passant par les techniques de fabrication des cristaux, fibres et films minces organiques et inorganiques. Plusieurs résultats marquants en sont ressortis. Dans le domaine des sources, la mise en forme spatiale du faisceau laser utilisé pour la production d'harmoniques d'ordre élevé dans les gaz, ceci à l'aide de lames de phase peu onéreuses et simples d'utilisation, semble être une bonne solution pour accroître les

  1. Developing an Informant Questionnaire for Cognitive Abilities in Down Syndrome: The Cognitive Scale for Down Syndrome (CS-DS.

    Directory of Open Access Journals (Sweden)

    Carla M Startin

    Full Text Available Down syndrome (DS is the most common genetic cause of intellectual disability (ID. Abilities relating to executive function, memory and language are particularly affected in DS, although there is a large variability across individuals. People with DS also show an increased risk of developing dementia. While assessment batteries have been developed for adults with DS to assess cognitive abilities, these batteries may not be suitable for those with more severe IDs, dementia, or visual / hearing difficulties. Here we report the development of an informant rated questionnaire, the Cognitive Scale for Down Syndrome (CS-DS, which focuses on everyday abilities relating to executive function, memory and language, and is suitable for assessing these abilities in all adults with DS regardless of cognitive ability. Complete questionnaires were collected about 128 individuals with DS. After final question selection we found high internal consistency scores across the total questionnaire and within the executive function, memory and language domains. CS-DS scores showed a wide range, with minimal floor and ceiling effects. We found high interrater (n = 55 and test retest (n = 36 intraclass correlations. CS-DS scores were significantly lower in those aged 41+ with significant cognitive decline compared to those without decline. Across all adults without cognitive decline, CS-DS scores correlated significantly to measures of general abilities. Exploratory factor analysis suggested five factors within the scale, relating to memory, self-regulation / inhibition, self-direction / initiation, communication, and focussing attention. The CS-DS therefore shows good interrater and test retest reliability, and appears to be a valid and suitable informant rating tool for assessing everyday cognitive abilities in a wide range of individuals with DS. Such a questionnaire may be a useful outcome measure for intervention studies to assess improvements to cognition, in

  2. Developing an Informant Questionnaire for Cognitive Abilities in Down Syndrome: The Cognitive Scale for Down Syndrome (CS-DS).

    Science.gov (United States)

    Startin, Carla M; Rodger, Erin; Fodor-Wynne, Lucy; Hamburg, Sarah; Strydom, André

    2016-01-01

    Down syndrome (DS) is the most common genetic cause of intellectual disability (ID). Abilities relating to executive function, memory and language are particularly affected in DS, although there is a large variability across individuals. People with DS also show an increased risk of developing dementia. While assessment batteries have been developed for adults with DS to assess cognitive abilities, these batteries may not be suitable for those with more severe IDs, dementia, or visual / hearing difficulties. Here we report the development of an informant rated questionnaire, the Cognitive Scale for Down Syndrome (CS-DS), which focuses on everyday abilities relating to executive function, memory and language, and is suitable for assessing these abilities in all adults with DS regardless of cognitive ability. Complete questionnaires were collected about 128 individuals with DS. After final question selection we found high internal consistency scores across the total questionnaire and within the executive function, memory and language domains. CS-DS scores showed a wide range, with minimal floor and ceiling effects. We found high interrater (n = 55) and test retest (n = 36) intraclass correlations. CS-DS scores were significantly lower in those aged 41+ with significant cognitive decline compared to those without decline. Across all adults without cognitive decline, CS-DS scores correlated significantly to measures of general abilities. Exploratory factor analysis suggested five factors within the scale, relating to memory, self-regulation / inhibition, self-direction / initiation, communication, and focussing attention. The CS-DS therefore shows good interrater and test retest reliability, and appears to be a valid and suitable informant rating tool for assessing everyday cognitive abilities in a wide range of individuals with DS. Such a questionnaire may be a useful outcome measure for intervention studies to assess improvements to cognition, in addition to

  3. Functional analysis of dsRNAs (L1, L3, L5, and M2) associated with isometric 34-nm virions of Agaricus bisporus (white button mushroom)

    NARCIS (Netherlands)

    VanDerLende, TR; Duitman, EH; Gunnewijk, MGW; Yu, L; Wessels, JGH

    1996-01-01

    cDNA clones of dsRNAs associated with La France disease of Agaricus bisporus were isolated, Clones corresponding to L1 and L5 dsRNAs were sequenced. The deduced amino acid sequence of L1 dsRNA (1078 amino acids, M(r) 121K) showed significant homology with RNA-dependent RNA polymerases of other dsRNA

  4. PR Crisis Melalui Media Sosial

    Directory of Open Access Journals (Sweden)

    Gladys Carlina

    2017-07-01

    Full Text Available The background of this research is communication, new media, PR and PR Crisis. Fourth of this background has a close relationship, starting from communication, human in everyday life would require communication to receive and convey information, human can not be released from human life. The advancement of the times and the development of technology, causing people to communicate easily and the development of this era caused a new challenge for the PR and PR Crisis of a company, they should be able to maintain a positive image of the company in the minds of people. In this study using descriptive qualitative methodology, it contains many writings and drawings compared to the numbers. The purpose of this research is to know the strategy used by Pizza Hut in dealing with the issue of expired food. Penelitin results, social media is very positive impact on Pizza Hut in the recovery of food issues expired. The strategy used by the Pizza Hut Crisis PR is to utilize social media. Visible from the issue of expired food that disappeared in public and Pizza Hut restaurant until now crowded visited. Latar belakang dari penelitian ini yaitu komunikasi, media baru, PR dan PR Krisis. Keempat dari latar belakang ini mempunyai hubungan yang erat, dimulai dari komunikasi, manusia di dalam kehidupan sehari-hari tentunya memerlukan komunikasi untuk menerima dan menyampaikan informasi, manusia tidak bisa dilepaskan dari kehidupan manusia. Majunya perkembangan zaman dan perkembangan teknologi, menyebabkan manusia melakukan komunikasi dengan mudah dan perkembangan zaman ini menyebabkan adanya tantangan baru bagi para PR dan PR Krisis sebuah perusahaan, mereka harus bisa mempertahankan citra positif perusahaan di benak masyarakat. Dalam penelitian ini menggunakan metodologi kualitatif deksriptif, memuat banyak tulisan dan gambar dibandingkan angka-angka. Tujuan dari penelitian ini untuk mengetahui strategi yang digunakan oleh Pizza Hut dalam menangani isu makanan

  5. Measurement of the Semileptonic Branching Ratio of Bs0 to an Orbitally Excited Ds** State: Br(Bs0→Ds1-(2536)μ+νX)

    Science.gov (United States)

    Abazov, V. M.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S. H.; Ahsan, M.; Alexeev, G. D.; Alkhazov, G.; Alton, A.; Alverson, G.; Alves, G. A.; Anastasoaie, M.; Ancu, L. S.; Andeen, T.; Anderson, S.; Andrieu, B.; Anzelc, M. S.; Arnoud, Y.; Arov, M.; Arthaud, M.; Askew, A.; Åsman, B.; Assis Jesus, A. C. S.; Atramentov, O.; Autermann, C.; Avila, C.; Ay, C.; Badaud, F.; Baden, A.; Bagby, L.; Baldin, B.; Bandurin, D. V.; Banerjee, S.; Banerjee, P.; Barberis, E.; Barfuss, A.-F.; Bargassa, P.; Baringer, P.; Barreto, J.; Bartlett, J. F.; Bassler, U.; Bauer, D.; Beale, S.; Bean, A.; Begalli, M.; Begel, M.; Belanger-Champagne, C.; Bellantoni, L.; Bellavance, A.; Benitez, J. A.; Beri, S. B.; Bernardi, G.; Bernhard, R.; Bertram, I.; Besançon, M.; Beuselinck, R.; Bezzubov, V. A.; Bhat, P. C.; Bhatnagar, V.; Biscarat, C.; Blazey, G.; Blekman, F.; Blessing, S.; Bloch, D.; Bloom, K.; Boehnlein, A.; Boline, D.; Bolton, T. A.; Borissov, G.; Bose, T.; Brandt, A.; Brock, R.; Brooijmans, G.; Bross, A.; Brown, D.; Buchanan, N. J.; Buchholz, D.; Buehler, M.; Buescher, V.; Bunichev, S.; Burdin, S.; Burke, S.; Burnett, T. H.; Buszello, C. P.; Butler, J. M.; Calfayan, P.; Calvet, S.; Cammin, J.; Carvalho, W.; Casey, B. C. K.; Cason, N. M.; Castilla-Valdez, H.; Chakrabarti, S.; Chakraborty, D.; Chan, K. M.; Chan, K.; Chandra, A.; Charles, F.; Cheu, E.; Chevallier, F.; Cho, D. K.; Choi, S.; Choudhary, B.; Christofek, L.; Christoudias, T.; Cihangir, S.; Claes, D.; Coadou, Y.; Cooke, M.; Cooper, W. E.; Corcoran, M.; Couderc, F.; Cousinou, M.-C.; Crépé-Renaudin, S.; Cutts, D.; Ćwiok, M.; da Motta, H.; Das, A.; Davies, G.; de, K.; de Jong, S. J.; de La Cruz-Burelo, E.; de Oliveira Martins, C.; Degenhardt, J. D.; Déliot, F.; Demarteau, M.; Demina, R.; Denisov, D.; Denisov, S. P.; Desai, S.; Diehl, H. T.; Diesburg, M.; Dominguez, A.; Dong, H.; Dudko, L. V.; Duflot, L.; Dugad, S. R.; Duggan, D.; Duperrin, A.; Dyer, J.; Dyshkant, A.; Eads, M.; Edmunds, D.; Ellison, J.; Elvira, V. D.; Enari, Y.; Eno, S.; Ermolov, P.; Evans, H.; Evdokimov, A.; Evdokimov, V. N.; Ferapontov, A. V.; Ferbel, T.; Fiedler, F.; Filthaut, F.; Fisher, W.; Fisk, H. E.; Ford, M.; Fortner, M.; Fox, H.; Fu, S.; Fuess, S.; Gadfort, T.; Galea, C. F.; Gallas, E.; Galyaev, E.; Garcia, C.; Garcia-Bellido, A.; Gavrilov, V.; Gay, P.; Geist, W.; Gelé, D.; Gerber, C. E.; Gershtein, Y.; Gillberg, D.; Ginther, G.; Gollub, N.; Gómez, B.; Goussiou, A.; Grannis, P. D.; Greenlee, H.; Greenwood, Z. D.; Gregores, E. M.; Grenier, G.; Gris, Ph.; Grivaz, J.-F.; Grohsjean, A.; Grüendahl, S.; Grünewald, M. W.; Guo, J.; Guo, F.; Gutierrez, P.; Gutierrez, G.; Haas, A.; Hadley, N. J.; Haefner, P.; Hagopian, S.; Haley, J.; Hall, I.; Hall, R. E.; Han, L.; Hansson, P.; Harder, K.; Harel, A.; Harrington, R.; Hauptman, J. M.; Hauser, R.; Hays, J.; Hebbeker, T.; Hedin, D.; Hegeman, J. G.; Heinmiller, J. M.; Heinson, A. P.; Heintz, U.; Hensel, C.; Herner, K.; Hesketh, G.; Hildreth, M. D.; Hirosky, R.; Hobbs, J. D.; Hoeneisen, B.; Hoeth, H.; Hohlfeld, M.; Hong, S. J.; Hossain, S.; Houben, P.; Hu, Y.; Hubacek, Z.; Hynek, V.; Iashvili, I.; Illingworth, R.; Ito, A. S.; Jabeen, S.; Jaffré, M.; Jain, S.; Jakobs, K.; Jarvis, C.; Jesik, R.; Johns, K.; Johnson, C.; Johnson, M.; Jonckheere, A.; Jonsson, P.; Juste, A.; Kajfasz, E.; Kalinin, A. M.; Kalk, J. R.; Kalk, J. M.; Kappler, S.; Karmanov, D.; Kasper, P. A.; Katsanos, I.; Kau, D.; Kaur, R.; Kaushik, V.; Kehoe, R.; Kermiche, S.; Khalatyan, N.; Khanov, A.; Kharchilava, A.; Kharzheev, Y. M.; Khatidze, D.; Kim, T. J.; Kirby, M. H.; Kirsch, M.; Klima, B.; Kohli, J. M.; Konrath, J.-P.; Korablev, V. M.; Kozelov, A. V.; Krop, D.; Kuhl, T.; Kumar, A.; Kunori, S.; Kupco, A.; Kurča, T.; Kvita, J.; Lacroix, F.; Lam, D.; Lammers, S.; Landsberg, G.; Lebrun, P.; Lee, W. M.; Leflat, A.; Lehner, F.; Lellouch, J.; Leveque, J.; Li, J.; Li, Q. Z.; Li, L.; Lietti, S. M.; Lima, J. G. R.; Lincoln, D.; Linnemann, J.; Lipaev, V. V.; Lipton, R.; Liu, Y.; Liu, Z.; Lobodenko, A.; Lokajicek, M.; Love, P.; Lubatti, H. J.; Luna, R.; Lyon, A. L.; Maciel, A. K. A.; Mackin, D.; Madaras, R. J.; Mättig, P.; Magass, C.; Magerkurth, A.; Mal, P. K.; Malbouisson, H. B.; Malik, S.; Malyshev, V. L.; Mao, H. S.; Maravin, Y.; Martin, B.; McCarthy, R.; Melnitchouk, A.; Mendoza, L.; Mercadante, P. G.; Merkin, M.; Merritt, K. W.; Meyer, J.; Meyer, A.; Millet, T.; Mitrevski, J.; Molina, J.; Mommsen, R. K.; Mondal, N. K.; Moore, R. W.; Moulik, T.; Muanza, G. S.; Mulders, M.; Mulhearn, M.; Mundal, O.; Mundim, L.; Nagy, E.; Naimuddin, M.; Narain, M.; Naumann, N. A.; Neal, H. A.; Negret, J. P.; Neustroev, P.; Nilsen, H.; Nogima, H.; Novaes, S. F.; Nunnemann, T.; O'Dell, V.; O'Neil, D. C.; Obrant, G.; Ochando, C.; Onoprienko, D.; Oshima, N.; Osta, J.; Otec, R.

    2009-02-01

    In a data sample of approximately 1.3fb-1 collected with the D0 detector between 2002 and 2006, the orbitally excited charm state Ds1±(2536) has been observed with a measured mass of 2535.7±0.6(stat)±0.5(syst)MeV/c2 via the decay mode Bs0→Ds1-(2536)μ+νμX. A first measurement is made of the branching ratio product Br( bmacr →Ds1-(2536)μ+νμX)×Br(Ds1-→D*-KS0). Assuming that Ds1-(2536) production in semileptonic decay is entirely from Bs0, an extraction of the semileptonic branching ratio Br(Bs0→Ds1-(2536)μ+νμX) is made.

  6. γ-Tocotrienol does not substantially protect DS neurons from hydrogen peroxide-induced oxidative injury

    Directory of Open Access Journals (Sweden)

    Then Sue-Mian

    2012-01-01

    Full Text Available Abstract Background Down syndrome (DS neurons are more susceptible to oxidative stress and previous studies have shown that vitamin E was able to reduce oxidative stress and improve DS neurons' viability. Therefore, this study was done to investigate the protective role of γ-tocotrienol (γT3 in DS neurons from hydrogen peroxide (H2O2 -induced oxidative stress. The pro-apoptosis tendency of γT3 was compared to α-tocopherol (αT in non-stress condition as well. Methods Primary culture of DS and euploid neurons were divided into six groups of treatment: control, H2O2, γT3 pre-treatment with H2O2, γT3 only, αT pre-treatment with H2O2 and αT only. The treatments were assessed by MTS assay and apoptosis assay by single-stranded DNA (ssDNA apoptosis ELISA assay, Hoechst and Neu-N immunofluorescence staining. The cellular uptake of γT3 and αT was determined by HPLC while protein expressions were determined by Western blot. Comparison between groups was made by the Student's t test, one-way ANOVA and Bonferroni adjustment as well as two-way ANOVA for multiple comparisons. Results One day incubation of γT3 was able to reduced apoptosis of DS neurons by 10%, however γT3 was cytotoxic at longer incubation period (14 days and at concentrations ≥ 100 μM. Pre-treatment of αT and γT3 only attenuate apoptosis and increase cell viability in H2O2-treated DS and euploid neurons by 10% in which the effects were minimal to maintain most of the DS cells' morphology. γT3 act as a free radical scavenger by reducing ROS generated by H2O2. In untreated controls, DS neurons showed lower Bcl-2/Bax ratio and p53 expression compared to normal neurons, while cPKC and PKC-δ expressions were higher in DS neurons. On the other hand, pre-treatment of γT3 in H2O2-treated DS neurons have reduced Bcl-2/Bax ratio, which was not shown in euploid neurons. This suggests that pre-treatment of γT3 did not promote DS cell survival. Meanwhile γT3 and αT treatments

  7. Brassica napus DS-3, encoding a DELLA protein, negatively regulates stem elongation through gibberellin signaling pathway.

    Science.gov (United States)

    Zhao, Bo; Li, Haitao; Li, Juanjuan; Wang, Bo; Dai, Cheng; Wang, Jing; Liu, Kede

    2017-04-01

    Identification and characterization of a semi-dwarfing gene ds-3 encoding a mutant DELLA protein regulating plant height through gibberellin signaling pathway. Lodging is one of the most important factors causing severe yield loss in oilseed rape. Utilization of semi-dwarf varieties has been proved the most effective way to increase lodging resistance and yield in many crops. To develop semi-dwarf germplasm in oilseed rape, we identified a semi-dwarf mutant ds-3 which showed a reduced response to phytohormones gibberellins (GAs). Genetic analysis indicated the dwarfism was controlled by a single semi-dominant gene, ds-3. The DS-3 gene was mapped to a genomic region on chromosome C07, which is syntenic to the region of a previously identified semi-dwarf gene ds-1 (BnaA06.RGA). In this region, DS-3 (BnaC07.RGA) gene was identified to encode a DELLA protein that functions as a repressor in GA signaling pathway. A substitution of proline to leucine was identified in ds-3 in the conserved VHYNP motif, which is essential for GA-dependent interaction between gibberellin receptor GID1 and DELLA proteins. Segregation analysis in the F2 population derived from the cross between ds-1 and ds-3 demonstrated that BnaA06.RGA displayed a stronger effect on plant height than BnaC07.RGA, indicating that different RGA genes may play different roles in stem elongation. In addition to BnaA06.RGA and BnaC07.RGA, two more RGA genes (BnaA09.RGA and BnaC09.RGA) were identified in the Brassica napus (B. napus) genome. Reverse-transcription polymerase chain reaction (RT-PCR) and yeast two-hybrid (Y2H) assays suggest that both BnaA09.RGA and BnaC09.RGA are transcribed in leaves and stems and can mediate GA signaling in vivo. These genes represent potential targets for screening ideal semi-dwarfing alleles for oilseed rape breeding.

  8. Præjudikat eller ikke præjudikat

    DEFF Research Database (Denmark)

    Nielsen, Ruth; Tvarnø, Christina D.

    2017-01-01

    Denne artikel behandler præjudikatværdien af EU-Domstolens og Højesterets afgørelser i Ajos-sagen. Artiklen belyser navnlig den manglende præjudikatværdi af Højesterets obiter dictum udtalelse om EU’s Charter om grundlæggende rettigheder, hvor Højesteret antog, at de grundlæggende rettigheder i...... Chartret, heriblandt diskriminationsforbuddet i artikel 21 ikke har direkte, horisontal virkning i Danmark. Efter forfatternes opfattelse er EU-Domstolens dom i Ajos-sagen, der fastholder tidligere EU-praksis (Mangold-og Kücükdeveci-dommene), præjudikat for, at Chartret har direkte, horisontal virkning i...

  9. SuDS and human behaviour: Co-developing solutions to encourage sustainable behaviour

    Directory of Open Access Journals (Sweden)

    Everett Glyn

    2016-01-01

    Full Text Available Sustainable Drainage Systems (SuDS are today widely considered to be a more progressive and environmentally sensitive approach to Flood Risk Management (FRM. However, this paper argues that the sustainability of SuDS should not be so simply presumed. Devices will depend upon correct behaviour from those local to them in order to function properly over time, and for Green Infrastructure SuDS to flourish and deliver their promised multiple benefits. This paper looks to the potential value in using Social Practice Theory as a lens for understanding current behaviours around SuDS devices, and for assessing possible strategies for encouraging positive behaviour amongst affected communities. It concludes in arguing that involving local people as much as possible in the co-design of systems and then working to maintain involvement and awareness will be the most cost-effective means by which SuDS might be made to live up to the sustainability they are celebrated for.

  10. Fluorescence Detection and Discrimination of ss- and ds-DNA with a Water Soluble Oligopyrene Derivative

    Directory of Open Access Journals (Sweden)

    Gaoquan Shi

    2009-06-01

    Full Text Available A novel water-soluble cationic conjugated oligopyrene derivative, oligo(N1,N1,N1,N4,N4,N4-hexamethyl-2-(4-(pyren-1-yl butane-1,4-diaminium bromide (OHPBDB, was synthesized by a combination of chemical and electrochemical synthesis techniques. Each oligomer chain has five pyrene derivative repeating units and brings 10 positive charges. OHPBDB showed high and rapid fluorescence quenching in aqueous media upon addition of trace amounts of single-stranded (ss and double-stranded (ds DNA. The Stern-Volmer constants for ss- and ds-DNA were measured to be as high as 1.3 × 108 mol-1·L and 1.2 × 108 mol-1·L, respectively. On the other hand, distinct fluorescence enhancement of OHPBDB upon addition of large amount of ss-DNA or ds-DNA was observed. Furthermore, ss-DNA showed much stronger fluorescence enhancement than that of ds-DNA, thus yielding a clear and simple signal useful for the discrimination between ss- and ds-DNA in aqueous media.

  11. The Folding of de Novo Designed Protein DS119 via Molecular Dynamics Simulations

    Directory of Open Access Journals (Sweden)

    Moye Wang

    2016-04-01

    Full Text Available As they are not subjected to natural selection process, de novo designed proteins usually fold in a manner different from natural proteins. Recently, a de novo designed mini-protein DS119, with a βαβ motif and 36 amino acids, has folded unusually slowly in experiments, and transient dimers have been detected in the folding process. Here, by means of all-atom replica exchange molecular dynamics (REMD simulations, several comparably stable intermediate states were observed on the folding free-energy landscape of DS119. Conventional molecular dynamics (CMD simulations showed that when two unfolded DS119 proteins bound together, most binding sites of dimeric aggregates were located at the N-terminal segment, especially residues 5–10, which were supposed to form β-sheet with its own C-terminal segment. Furthermore, a large percentage of individual proteins in the dimeric aggregates adopted conformations similar to those in the intermediate states observed in REMD simulations. These results indicate that, during the folding process, DS119 can easily become trapped in intermediate states. Then, with diffusion, a transient dimer would be formed and stabilized with the binding interface located at N-terminals. This means that it could not quickly fold to the native structure. The complicated folding manner of DS119 implies the important influence of natural selection on protein-folding kinetics, and more improvement should be achieved in rational protein design.

  12. Multi-method analysis of the internal structure of the Type D Scale-14 (DS14).

    Science.gov (United States)

    Straat, J Hendrik; van der Ark, L Andries; Sijtsma, Klaas

    2012-04-01

    The Type D Scale-14 (DS14) measures distressed (also, Type D) personality by assessing the medium-level trait negative affectivity that encompasses the low-level traits dysphoria, anxiety, and irritability, and the medium-level trait social inhibition that encompasses the low-level traits social discomfort, reticence, and lack of social poise. The literature discusses three different structural models of the DS14. The goal of this study was to investigate which of the three models best describes the internal structure of the DS14. We used three methods to investigate the internal structure of the DS14 items using data collected in representative samples from the Dutch general population (N=3,181). The methods were exploratory factor analysis, confirmatory factor analysis, and Mokken scale analysis. Exploratory factor analysis suggested a two-factor structure without evidence of the low-level factors, and the other two methods showed evidence of a three-level structure including the low-level factors. A two-factor model with correlated errors for items defining low-level traits adequately describes the data. The results support the three-level hierarchical model as a conceptual model for Type D personality, and support the interpretation of DS14 scores on item subsets representing medium-level traits and low-level traits. Copyright © 2012 Elsevier Inc. All rights reserved.

  13. The Folding of de Novo Designed Protein DS119 via Molecular Dynamics Simulations.

    Science.gov (United States)

    Wang, Moye; Hu, Jie; Zhang, Zhuqing

    2016-04-26

    As they are not subjected to natural selection process, de novo designed proteins usually fold in a manner different from natural proteins. Recently, a de novo designed mini-protein DS119, with a βαβ motif and 36 amino acids, has folded unusually slowly in experiments, and transient dimers have been detected in the folding process. Here, by means of all-atom replica exchange molecular dynamics (REMD) simulations, several comparably stable intermediate states were observed on the folding free-energy landscape of DS119. Conventional molecular dynamics (CMD) simulations showed that when two unfolded DS119 proteins bound together, most binding sites of dimeric aggregates were located at the N-terminal segment, especially residues 5-10, which were supposed to form β-sheet with its own C-terminal segment. Furthermore, a large percentage of individual proteins in the dimeric aggregates adopted conformations similar to those in the intermediate states observed in REMD simulations. These results indicate that, during the folding process, DS119 can easily become trapped in intermediate states. Then, with diffusion, a transient dimer would be formed and stabilized with the binding interface located at N-terminals. This means that it could not quickly fold to the native structure. The complicated folding manner of DS119 implies the important influence of natural selection on protein-folding kinetics, and more improvement should be achieved in rational protein design.

  14. ESO PR Highlights in 2005

    Science.gov (United States)

    2006-01-01

    2005 was the year of Physics. It was thus also in part the year of astronomy and this is clearly illustrated by the numerous breakthroughs that were achieved, in particular using ESO's telescopes. One of the highlights was without any doubt the confirmation of the first image of an exoplanet , around the star 2M1207 (see ESO PR 12/05). ESO's telescopes also found a Neptune-mass exoplanet around a small star ( PR 30/05) - a discovery that proves crucial in the census of other planetary systems, and imaged a tiny companion in the close vicinity of the star GQ Lupi, a very young object still surrounded by a disc, with an age between 100,000 and 2 million years ( PR 09/05). Moreover, using a new high-contrast adaptive optics camera on the VLT, the NACO Simultaneous Differential Imager, or NACO SDI, astronomers were able for the first time to image a companion 120 times fainter than its star , very near the star AB Doradus A. This companion appears to be almost twice as heavy as theory predicts it to be ( PR 02/05). ESO's telescopes proved very useful in helping to solve a 30-year old puzzle . Astronomers have for the first time observed the visible light from a short gamma-ray burst (GRB). Using the 1.5m Danish telescope at La Silla (Chile), they showed that these short, intense bursts of gamma-ray emission most likely originate from the violent collision of two merging neutron stars ( PR 26/05). Additional evidence came from witnessing another event with the VLT ( PR 32/05). Also in this field, astronomers found the farthest known gamma-ray burst with ESO's VLT, observing an object with a redshift 6.3, i.e. that is seen when the Universe was less than 900 million years old ( PR 22/05). On July 4, NASA's Deep Impact spacecraft plunged onto Comet 9P/Tempel 1 with the aim to create a crater and expose pristine material from beneath the surface. For two days before and six days after, all major ESO telescopes have been observing the comet, in a coordinated fashion and in

  15. Accumulation of dsRNA in endosomes contributes to inefficient RNA interference in the fall armyworm, Spodoptera frugiperda.

    Science.gov (United States)

    Yoon, June-Sun; Gurusamy, Dhandapani; Palli, Subba Reddy

    2017-11-01

    RNA interference (RNAi) efficiency varies among insects studied. The barriers for successful RNAi include the presence of double-stranded ribonucleases (dsRNase) in the lumen and hemolymph that could potentially digest double-stranded RNA (dsRNA) and the variability in the transport of dsRNA into and within the cells. We recently showed that the dsRNAs are transported into lepidopteran cells, but they are not processed into small interference RNAs (siRNAs) because they are trapped in acidic bodies. In the current study, we focused on the identification of acidic bodies in which dsRNAs accumulate in Sf9 cells. Time-lapse imaging studies showed that dsRNAs enter Sf9 cells and accumulate in acidic bodies within 20 min after their addition to the medium. CypHer-5E-labeled dsRNA also accumulated in the midgut and fat body dissected from Spodoptera frugiperda larvae with similar patterns observed in Sf9 cells. Pharmacological inhibitor assays showed that the dsRNAs use clathrin mediated endocytosis pathway for transport into the cells. We investigated the potential dsRNA accumulation sites employing LysoTracker and double labeling experiments using the constructs to express a fusion of green fluorescence protein with early or late endosomal marker proteins and CypHer-5E-labeled dsRNA. Interestingly, CypHer-5E-labeled dsRNA accumulated predominantly in early and late endosomes. These data suggest that entrapment of internalized dsRNA in endosomes is one of the major factors contributing to inefficient RNAi response in lepidopteran insects. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Speed Digital Control of Brushless DC Motor Using dsPIC Controller

    Directory of Open Access Journals (Sweden)

    Gheorghe Băluţă

    2014-09-01

    Full Text Available This paper presents the digital control of the Brushless DC motor (BLDCM speed. The dsPICDEM MC1 development system (with the dsPIC30F6010A microcontroller and the dsPICDEM MC1L power module, manufactured by Microchip Company, were used. The control program was developed in C programming language. The graphical user interface was realized in LabVIEW 8.6 graphical programming language. For speed control, a digital controller PI type was implemented. Due to digital controller well chosen and well tuned, the system response at speed step variation is very good. Therewith, the experimental results obtained also show a good compensation of disturbance which does not happen in open-loop control.

  17. The influence of Gamma Irradiation on flavonoïds content during storage of irradiated clementina

    Science.gov (United States)

    Oufedjikh, H.; Mahrouz, M.; Lacroix, M.; Amiot, M. J.; Taccini, M.

    1998-06-01

    The influence of Gamma irradiation on content of some important flavonoïds (flavonones glycosides and polymethoxylated flavones) was evaluated during storage of Moroccan clementina treated at a mean dose of 0.3 kGy and stored three months at 3'C. Results shows that at day one, gamma irradiation induced degradation of small quantities of these flavonoïds, however after 14 days of storage, the content of these compounds was significantly higher (p≤0.05) in irradiated samples. Irradiation stimulated biosynthesis of flavonoïds after 14 days of storage. Hesperidin was the major flavanones compounds in clementines. Nobiletin and Heptamethoxyflavone were the major polymethoxylated flavones in clementines. Our study demonstrated that the content of these compounds was significantly higher (p≤0.05) in irradiated samples.

  18. A Novel 2-D OFDM-DS-CDMA Receiver with Frequency-Time Spreading

    Science.gov (United States)

    Chen, Joy Iong-Zong

    This paper presents a novel 2-D (2-dimension) receiver that adopts the reception scheme to promote OFDM-DS-CDMA (orthogonal frequency division multiplexing multi-carrier coded-division multiple-access) system performance. The system model includes spread coding and a system block diagram of the 2-D receiver shown graphically with 3-D (three dimensions) plots. The analytical calculation of system performance for an OFDM-DS-CDMA system combined with the proposed receiver equipment is investigated. To evaluate the results from the channel fading effect is considered over the correlated fading environments. The correlated-Nakagami-m statistical distribution is taken into account in the evaluation. The results show that the number of users, the number of subcarriers and the fading channel correlation generally affect OFDM-DS-CDMA systems. The system is also influenced by the Doppler shift and the signal propagation environment (fading parameter).

  19. A performance analysis of DS-CDMA and SCPC VSAT networks

    Science.gov (United States)

    Hayes, David P.; Ha, Tri T.

    1990-01-01

    Spread-spectrum and single-channel-per-carrier (SCPC) transmission techniques work well in very small aperture terminal (VSAT) networks for multiple-access purposes while allowing the earth station antennas to remain small. Direct-sequence code-division multiple-access (DS-CDMA) is the simplest spread-spectrum technique to use in a VSAT network since a frequency synthesizer is not required for each terminal. An examination is made of the DS-CDMA and SCPC Ku-band VSAT satellite systems for low-density (64-kb/s or less) communications. A method for improving the standardf link analysis of DS-CDMA satellite-switched networks by including certain losses is developed. The performance of 50-channel full mesh and star network architectures is analyzed. The selection of operating conditions producing optimum performance is demonstrated.

  20. [Research on extraction method of water body with DS spectral enhancement based on HJ-1 images].

    Science.gov (United States)

    Deng, Rui; Huang, Jing-Feng; Wang, Fu-Min

    2011-11-01

    Natural disaster is one of the major global issues, and it is an important premise for disaster prevention and reduction to monitor it. In the present paper, multi-temporal HJ-1 images pre- and posto-typhoon Morakot were used. First, radiometric calibration and registration were done, then, decorrelation stretch (DS) was applied, and finally, maximum likelihood classification (MLC) was adopted to extract water body and monitor change of water body caused by typhoon Morakot. The results show that after DS spectral enhancement, the correlations among bands decrease and spectral differences increase, and it is helpful to identify surface features. The accuracy assessment demonstrates that the overall accuracies and Kappa coefficients of four phases are higher, above 96.0% and 0.94 respectively, than that of direct MLC without DS spectral enhancement. It is beneficial to scheduling flood discharge and ensuring the safety of reservoir downstream by comparing extracted multi-temporal water bodies.

  1. Conformational transitions of plasmid ds-DNA on ultrathin films of alkylamines on graphite

    Science.gov (United States)

    Falk, Caroline; Liang, Hua; Severin, Nikolai; Zhuang, Wei; Zauscher, Stefan; Rabe, Jürgen P.

    2015-03-01

    DNA replication is an important process in the human body. Replication of double-stranded (ds)-DNA requires its local melting into two single strands. DNA, when stretched in solution, overwinds and melts. This was argued to give insight onto the replication mechanism. It is difficult, however, to access the direct conformational changes during stretching in solution. Recent work demonstrated that this transition can be imaged with scanning force microscopy on a graphite surface that is coated with an alkylamine layer. ds-DNA can be controlled by an amphiphilic layer, since the DNA conformation depends on the amphiphile concentration. In particular we analyzed different DNA lengths on the same surface, and we found that at a specific concentration of octadecylamine the ds-DNA pUC19 plasmid ring splits into two single strands at one position. We will discuss methods to mark the DNA to determine the exact location at which the plasmid ring splits.

  2. A precision measurement of the D_s1(2536) meson mass and decay width

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, Y K; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    The decay width and the mass of the D_s1(2536) have been measured via the decay channel D_s1 -> D*+K_S using 232 fb^-1 of data collected with the BABAR detector at the PEP-II asymmetric-energy e+e- storage ring. The result for the decay width is (1.03 +- 0.05 +- 0.12) MeV/c^2, with the first error denoting the statistical uncertainty and the second one the systematic uncertainty. For the mass, a value of (2534.85 +- 0.02 +- 0.40) MeV/c^2 has been obtained. The systematic error is dominated by the uncertainty on the D*+ mass. The mass difference between the D_s1 and D*+ has been measured to be (524.85 +- 0.02 +- 0.04) MeV/c^2.

  3. Incidence of diverse dsRNA mycoviruses in Trichoderma spp. causing green mold disease of shiitake Lentinula edodes.

    Science.gov (United States)

    Yun, Suk-Hyun; Lee, Song Hee; So, Kum-Kang; Kim, Jung-Mi; Kim, Dae-Hyuk

    2016-09-22

    A total of 315 fungal isolates causing green mold disease were collected from contaminated artificial logs and sawdust bags used for cultivating shiitake Lentinula edodes in Korea and were analyzed for the presence of double-stranded RNA (dsRNA). dsRNA, which was purified using dsRNA-specific chromatography and verified by dsRNA-specific RNaseIII digestion, was detected in 32 isolates. The molecular taxonomy of dsRNA-infected isolates indicated that all isolates belonged to the Trichoderma spp.. The number and size of dsRNAs varied among isolates and the band patterns could be categorized into 15 groups. Although there were seven dsRNA groups observed in multiple isolates, eight groups were found to occur in single isolates. The most common dsRNA group, group VI, which contained a band of 10 kb, occurred in 10 isolates encompassing three species of Trichoderma Partial sequence analysis of two selected dsRNA groups revealed a high degree of similarity to sequences of a RNA-dependent RNA polymerase, hypothetical protein, and polyprotein genes of other hypoviruses such as Macrophomina phaseolina hypovirus 1, Trichoderma hypovirus, and Fusarium graminearum hypovirus 2, respectively, indicating the occurrence of mycoviruses in Trichoderma spp.. Northern blot analysis suggested that many different mycoviruses, which have not been identified yet, exist in Trichoderma. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Visualizing double-stranded RNA distribution and dynamics in living cells by dsRNA binding-dependent fluorescence complementation

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Xiaofei [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada); College of Life and Environmental Sciences, Hangzhou Normal University, Hangzhou, Zhejiang 310036 (China); Deng, Ping; Cui, Hongguang [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada); Wang, Aiming, E-mail: aiming.wang@agr.gc.ca [Southern Crop Protection and Food Research Centre, Agriculture and Agri-Food Canada, London, Ontario N5V 4T3 (Canada)

    2015-11-15

    Double-stranded RNA (dsRNA) is an important type of RNA that plays essential roles in diverse cellular processes in eukaryotic organisms and a hallmark in infections by positive-sense RNA viruses. Currently, no in vivo technology has been developed for visualizing dsRNA in living cells. Here, we report a dsRNA binding-dependent fluorescence complementation (dRBFC) assay that can be used to efficiently monitor dsRNA distribution and dynamics in vivo. The system consists of two dsRNA-binding proteins, which are fused to the N- and C-terminal halves of the yellow fluorescent protein (YFP). Binding of the two fusion proteins to a common dsRNA brings the split YFP halves in close proximity, leading to the reconstitution of the fluorescence-competent structure and restoration of fluorescence. Using this technique, we were able to visualize the distribution and trafficking of the replicative RNA intermediates of positive-sense RNA viruses in living cells. - Highlights: • A live-cell imaging system was developed for visualizing dsRNA in vivo. • It uses dsRNA binding proteins fused with two halves of a fluorescent protein. • Binding to a common dsRNA enables the reporter to become fluorescent. • The system can efficiently monitor viral RNA replication in living cells.

  5. Chitosan and its quaternized derivative as effective long dsRNA carriers targeting shrimp virus in Spodoptera frugiperda 9 cells.

    Science.gov (United States)

    Theerawanitchpan, Gatesara; Saengkrit, Nattika; Sajomsang, Warayuth; Gonil, Pattarapond; Ruktanonchai, Uracha; Saesoo, Somsak; Flegel, Timothy W; Saksmerprome, Vanvimon

    2012-08-31

    RNA interference (RNAi) is a promising strategy to combat shrimp viral pathogens at lab-scale experiments. Development of effective orally delivered agents for double-stranded (ds)RNA is necessary for RNAi application at farm level. Since continuous shrimp cell lines have not been established, we are developing a dsRNA-delivery system in Spodoptera frugiperda (Sf9) cells for studying in vitro RNAi-mediated gene silencing of shrimp virus. Sf9 cells challenged with yellow head virus (YHV) were used for validating nanoparticles as effective dsRNA carriers. Inexpensive and biodegradable polymers, chitosan and its quarternized derivative (QCH4), were formulated with long dsRNA (>100 bp) targeting YHV. Their morphology and physicochemical properties were examined. When treated with chitosan- and QCH4-dsRNA complexes, at least 50% reduction in YHV infection in Sf9 cells relative to the untreated control was evident at 24h post infection with low cytoxicity. Inhibitory effects of chitosan- and QCH4-dsRNA complexes were comparable to that of dsRNA formulated with Cellfectin(®), a commercial lipid-based transfection reagent. The natural and quaternized chitosan prepared in this study can be used for shrimp virus-specific dsRNA delivery in insect cultures, and have potential for future development of dsRNA carriers in shrimp feed. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Analyses of Sustained Vowels in Down Syndrome (DS): A Case Study Using Spectrograms and Perturbation Data to Investigate Voice Quality in Four Adults With DS.

    Science.gov (United States)

    Jeffery, Tracy; Cunningham, Stuart; Whiteside, Sandra P

    2017-09-21

    Automatic acoustic measures of voice quality in people with Down syndrome (DS) do not reliably reflect perceived voice qualities. This study used acoustic data and visual spectral data to investigate the relationship between perceived voice qualities and acoustic measures. Participants were four young adults (two males, two females; mean age 23.8 years) with DS and severe learning disabilities, at least one of whom had a hearing impairment. Participants imitated sustained /i/, /u/, and /a/ vowels at predetermined target pitches within their vocal range. Medial portions of vowels were analyzed, using Praat, for fundamental frequency, harmonics-to-noise ratio, jitter, and shimmer. Spectrograms were used to identify the presence and the duration of subharmonics at onset and offset, and mid-vowel. The presence of diplophonia was assessed by auditory evaluation. Perturbation data were highest for /a/ vowels and lowest for /u/ vowels. Intermittent productions of subharmonics were evident in spectrograms, some of which coincided with perceived diplophonia. The incidence, location, duration, and intensity of subharmonics differed between the four participants. Although the acoustic data do not clearly indicate atypical phonation, diplophonia and subharmonics reflect nonmodal phonation. The findings suggest that these may contribute to different perceived voice qualities in the study group and that these qualities may result from intermittent involvement of supraglottal structures. Further research is required to confirm the findings in the wider DS population, and to assess the relationships between voice quality, vowel type, and physiological measures. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  7. Antifungal properties of rhamnolipid produced by Pseudomonas aeruginosa DS9 against Colletotrichum falcatum.

    Science.gov (United States)

    Goswami, Debahuti; Borah, Siddhartha Narayan; Lahkar, Jiumoni; Handique, Pratap Jyoti; Deka, Suresh

    2015-11-01

    The rhamnolipid biosurfactant (RL-DS9) extracted from the bacterial strain Pseudomonas aeruginosa DS9 was evaluated for its antifungal activity against Colletotrichum falcatum that causes red rot in sugarcane. The surface tension (ST) reduction, biosurfactant production, and antifungal activity of biosurfactant against C. falcatum were investigated by using the medium with different carbon sources and it was found to be maximum in glucose. Moreover, highest reduction of ST and production of biosurfactant was achieved at 4.5% (w/v) concentration of glucose. The efficacy of RL-DS9 was compared with a commercially available rhamnolipid (RL-R95) using microtitre plate assay. Results showed that at 100 μg ml(-1) concentration RL-DS9 exhibited 86.6% inhibition against C. falcatum spore germination, and in the same concentration RL-R95 showed 83.3% inhibition. From liquid chromatography-mass spectrometry (LC-MS) analysis, it was revealed that only two similar congeners Rha-(C10 ) and Rha-Rha-(C10:1 ) were found to be in common among both the rhamnolipids. In the plant bioassay test, it was noted that red rot incidence was reduced on the sugarcane plants treated with RL-DS9. This is the first report that rhamnolipid biosurfactant produced by Pseudomonas aeruginosa DS9 could be able to control red rot disease of sugarcane caused due to the infection with the fungus Colletotrichum falcatum. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Reliability and validity of DS-ADHD: A decision support system on attention deficit hyperactivity disorders.

    Science.gov (United States)

    Chu, Kuo-Chung; Huang, Yu-Shu; Tseng, Chien-Fu; Huang, Hsin-Jou; Wang, Chih-Huan; Tai, Hsin-Yi

    2017-03-01

    The purpose of this study is to examine the reliability of the clinical use of the self-built decision support system, diagnosis-supported attention deficit hyperactivity disorder (DS-ADHD), in an effort to develop the DS-ADHD system, by probing into the development of indicating patterns of past screening support systems for ADHD. The study collected data based on 107 subjects, who were divided into two groups, non-ADHD and ADHD, based on the doctor's determination, using the DSM-IV diagnostic standards. The two groups then underwent Test of Variables of Attention (TOVA) and DS-ADHD testing. The survey and testing results underwent one-way ANOVA and split-half method statistical analysis, in order to further understand whether there were any differences between the DS-ADHD and the identification tools used in today's clinical trials. The results of the study are as follows: 1) The ROC area between the TOVA and the clinical identification rate is 0.787 (95% confidence interval: 0.701-0.872); 2) The ROC area between the DS-ADHD and the clinical identification rate is 0.867 (95% confidence interval: 0.801-0.933). The study results show that DS-ADHD has the characteristics of screening for ADHD, based on its reliability and validity. It does not display any statistical differences when compared with TOVA systems that are currently on the market. However, the system is more effective and the accuracy rate is better than TOVA. It is a good tool to screen ADHD not only in Chinese children, but also in western country. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  9. Maternal uterine NK cell–activating receptor KIR2DS1 enhances placentation

    Science.gov (United States)

    Xiong, Shiqiu; Sharkey, Andrew M.; Kennedy, Philippa R.; Gardner, Lucy; Farrell, Lydia E.; Chazara, Olympe; Bauer, Julien; Hiby, Susan E.; Colucci, Francesco; Moffett, Ashley

    2013-01-01

    Reduced trophoblast invasion and vascular conversion in decidua are thought to be the primary defect of common pregnancy disorders including preeclampsia and fetal growth restriction. Genetic studies suggest these conditions are linked to combinations of polymorphic killer cell Ig-like receptor (KIR) genes expressed by maternal decidual NK cells (dNK) and HLA-C genes expressed by fetal trophoblast. Inhibitory KIR2DL1 and activating KIR2DS1 both bind HLA-C2, but confer increased risk or protection from pregnancy disorders, respectively. The mechanisms underlying these genetic associations with opposing outcomes are unknown. We show that KIR2DS1 is highly expressed in dNK, stimulating strong activation of KIR2DS1+ dNK. We used microarrays to identify additional responses triggered by binding of KIR2DS1 or KIR2DL1 to HLA-C2 and found different responses in dNK coexpressing KIR2DS1 with KIR2DL1 compared with dNK only expressing KIR2DL1. Activation of KIR2DS1+ dNK by HLA-C2 stimulated production of soluble products including GM-CSF, detected by intracellular FACS and ELISA. We demonstrated that GM-CSF enhanced migration of primary trophoblast and JEG-3 trophoblast cells in vitro. These findings provide a molecular mechanism explaining how recognition of HLA class I molecules on fetal trophoblast by an activating KIR on maternal dNK may be beneficial for placentation. PMID:24091323

  10. BER analysis of DS-UWB system employing a laplace distribution model

    KAUST Repository

    Mehbodniya, Abolfazl

    2011-01-01

    This letter takes a new approach to extract a closed-form expression for the bit error rate (BER) of direct-sequence ultra wideband (DS-UWB) system. In the analysis, the main signal is impaired by multi-user interference (MUI) and an external source of interference originated by simultanously transmitting multiband orthogonal frequency division multiplexing (MB-OFDM) systems which are located in the vicinity of the DS-UWB receiver. All the transmission channels are affected by Nakagami-m fading. A Laplacian distribution is considered for MUI to comply more with real statistical behaviors of this kind of interference. © IEICE 2011.

  11. Characterization of a novel dsRNA mycovirus of Trichoderma atroviride NFCF028.

    Science.gov (United States)

    Lee, Song Hee; Yun, Suk-Hyun; Chun, Jeesun; Kim, Dae-Hyuk

    2017-04-01

    Molecular characterization of the most common dsRNA element from Trichoderma atroviride indicated that it comprised 8,566 bp and encoded two large open reading frames (ORF1 and 2). The two ORFs were found to overlap by 46 bp with a typical (-1) slippery heptanucelotide sequence. The deduced protein sequences of ORF1 and ORF2 showed significant similarities to those of known mycoviral structural proteins and RNA-dependent RNA polymerases, respectively. Phylogenetic analysis indicated that this dsRNA is a member of a distinct species related to a group of unclassified mycoviruses; therefore, it was named Trichoderma atroviride mycovirus 1 (TaMV1).

  12. Use of spatial phase shifting technique in digital speckle pattern interferometry (DSPI) and digital shearography (DS).

    Science.gov (United States)

    Bhaduri, Basanta; Mohan, N K; Kothiyal, M P; Sirohi, R S

    2006-11-27

    Digital speckle pattern interferometry (DSPI) and digital shearography (DS) are well known optical tools for qualitative as well as quantitative measurements of displacement components and its derivatives of engineering structures subjected either static or dynamic load. Spatial phase shifting (SPS) technique is useful for extracting quantitative displacement data from the system with only two frames. Optical configurations for DSPI and DS with a double aperture mask in front of the imaging lens for spatial phase shifting are proposed in this paper for the measurement of out-of-plane displacement and its first order derivative (slope) respectively. An error compensating four-phase step algorithm is used for quantitative fringe analysis.

  13. Where Do New US-Trained Science-Engineering PhDs come from?

    OpenAIRE

    Richard B. Freeman; Emily Jin; Chia-Yu Shen

    2004-01-01

    This study shows that the demographic and institutional origins of new US trained science and engineering PhDs changed markedly between the late 1960s-1970s to the 1990s-early 2000s. In 1966, 71% of science and engineering PhD graduates were US-born males, 6% were US-born females, and 23% were foreign born. In 2000, 36% of the graduates were US-born males, 25% were US-born females, and 39% were foreign born. Between 1970 and 2000 most of the growth in PhDs was in less prestigious smaller doct...

  14. A STUDY ON DETERMINING THE REFERENCE SPREADING SEQUENCES FOR A DS/CDMACOMMUNICATION SYSTEM

    Directory of Open Access Journals (Sweden)

    Cebrail ÇİFTLİKLİ

    2002-02-01

    Full Text Available In a direct sequence/code division multiple access (DS/CDMA system, the role of the spreading sequences (codes is crucial since the multiple access interference (MAI is the main performance limitation. In this study, we propose an accurate criterion which enables the determination of the reference spreading codes which yield lower bit error rates (BER's in a given code set for a DS/CDMA system using despreading sequences weighted by stepping chip waveforms. The numerical results show that the spreading codes determined by the proposed criterion are the most suitable codes for using as references.

  15. [The DS-DIF-KORINE kit to identify microorganisms corynebacterium, including C. diphtheriae].

    Science.gov (United States)

    Sorokina, G A; Zalesskikh, N V; Obriadina, A P; Ulanova, T I; Burkov, A N; Nekhorosheva, A G; Skala, L Z; Lukin, I N

    2012-07-01

    The DS-DIF-KORINE kit make it possible to identify 20 types of corynebacteriae entered the Bergi identification guide (1997) including biovars gravis and mitis and belfanti version of diphtheria agent. The possibility to determine its toxigenic characteristics is also provided The test system is ready to be applied since it has all needed components to implement bacteriologic analysis in search of diphtheroids and diagnostics of diphtheria. The presented data demonstrate high diagnostic effectiveness of the new DS-DIF-KORINE kit which has the state registration in Roszdravnadzor and is adapted for spectrophotometer automatic pickup and included into Microbe-Automate and Microbe-2 programs.

  16. Molecular-level Insight into the Spectral Tuning Mechanism of the DsRed Chromophore

    DEFF Research Database (Denmark)

    List, Nanna Holmgaard; Olsen, Jógvan Magnus Haugaard; Jensen, Hans Jørgen Aagaard

    2012-01-01

    We present a detailed study of the protein environmental effects on the one- and twophoton absorption (1PA and 2PA, respectively) properties of the S0-S1 transition in the DsRed protein using the polarizable embedding density functional theory formalism. We find that steric factors and chromophore...... the protein. Our results indicate that this mainly is attributable to counter-directional contributions stemming from Lys163 and the conserved Arg95 with the former additionally identified as a key residue in the color tuning mechanism. The results provide new insights into the tuning mechanism of Ds...

  17. Use of spatial phase shifting technique in digital speckle pattern interferometry (DSPI) and digital shearography (DS)

    Science.gov (United States)

    Bhaduri, Basanta; Mohan, N. K.; Kothiyal, M. P.; Sirohi, R. S.

    2006-11-01

    Digital speckle pattern interferometry (DSPI) and digital shearography (DS) are well known optical tools for qualitative as well as quantitative measurements of displacement components and its derivatives of engineering structures subjected either static or dynamic load. Spatial phase shifting (SPS) technique is useful for extracting quantitative displacement data from the system with only two frames. Optical configurations for DSPI and DS with a double aperture mask in front of the imaging lens for spatial phase shifting are proposed in this paper for the measurement of out-of-plane displacement and its first order derivative (slope) respectively. An error compensating four-phase step algorithm is used for quantitative fringe analysis.

  18. Comparison between TRMM PR and

    Indian Academy of Sciences (India)

    first active satellite microwave instrument for measuring three-dimensional ... This study considered Brazilian regions where there was a dense ANEEL rain gauge concentration. However, it is instructive to investigate the potentialities and limitations of ... validate TRMM PR rainfall estimates over specific continental regions ...

  19. Credibility Discourse of PR Agencies

    DEFF Research Database (Denmark)

    Isaksson, Maria; Jørgensen, Poul Erik Flyvholm

    2008-01-01

    to giving assurance of their expertise, trustworthiness and empathy, thus confirming our overall expectation that corporate credibility discourse is relatively uniform from a European perspective. However, contrary to our assumptions, the results of our study show that PR credibility discourse demonstrates...

  20. Digitized analog boomer seismic-reflection data collected during U.S. Geological Survey cruises Erda 90-1_HC, Erda 90-1_PBP, and Erda 91-3 in Mississippi Sound, June 1990 and September 1991

    Science.gov (United States)

    Bosse, Stephen T.; Flocks, James G.; Forde, Arnell S.

    2017-04-21

    The U.S. Geological Survey (USGS) Coastal and Marine Geology Program has actively collected geophysical and sedimentological data in the northern Gulf of Mexico for several decades, including shallow subsurface data in the form of high-resolution seismic-reflection profiles (HRSP). Prior to the mid-1990s most HRSP data were collected in analog format as paper rolls of continuous profiles up to 25 meters long. A large portion of this data resides in a single repository with minimal metadata. As part of the National Geological and Geophysical Data Preservation Program, scientists at the USGS St. Petersburg Coastal and Marine Science Center are converting the analog paper records to digital format using a large-format continuous scanner.This report, along with the accompanying USGS data release (Bosse and others, 2017), serves as an archive of seismic profiles with headers, converted Society of Exploration Geophysicists Y format (SEG-Y) files, navigation data, and geographic information system data files for digitized boomer seismic-reflection data collected from the Research Vessel (R/V) Erda during two cruises in 1990 and 1991. The Erda 90-1 geophysical cruise was conducted in two legs. The first leg included seismic data collected from the Hancock County region of the Mississippi Sound (Erda 90-1_HC) from June 4 to June 6, 1990. The second leg included seismic data collected from the Petit Bois Pass area of Mississippi Sound (Erda 90-1_PBP) from June 8 to June 9, 1990. The Erda 91-3 cruise occurred between September 12 and September 23, 1991, and surveyed the Mississippi Sound region just west of Horn Island, Mississippi.

  1. Decision-Making Algorithm for Multisensor Fusion Based on Grey Relation and DS Evidence Theory

    Directory of Open Access Journals (Sweden)

    Fang Ye

    2016-01-01

    Full Text Available Decision-making algorithm, as the key technology for uncertain data fusion, is the core to obtain reasonable multisensor information fusion results. DS evidence theory is a typical and widely applicable decision-making method. However, DS evidence theory makes decisions without considering the sensors’ difference, which may lead to illogical results. In this paper, we present a novel decision-making algorithm for uncertain fusion based on grey relation and DS evidence theory. The proposed algorithm comprehensively takes consideration of sensor’s credibility and evidence’s overall discriminability, which can solve the uncertainty problems caused by inconsistence of sensors themselves and complexity of monitoring environment and simultaneously ensure the validity and accuracy of fusion results. The innovative decision-making algorithm firstly obtains the sensor’s credibility through the introduction of grey relation theory and then defines two impact factors as sensor’s credibility and evidence’s overall discriminability according to the focal element analyses and evidence’s distance analysis, respectively; after that, it uses the impact factors to modify the evidences and finally gets more reasonable and effective results through DS combination rule. Simulation results and analyses demonstrate that the proposed algorithm can overcome the trouble caused by large evidence conflict and one-vote veto, which indicates that it can improve the ability of target judgment and enhance precision of uncertain data fusion. Thus the novel decision-making method has a certain application value.

  2. Fluorescent cyanine dyes for the quantification of low amounts of dsDNA.

    Science.gov (United States)

    Bruijns, B B; Tiggelaar, R M; Gardeniers, J G E

    2016-10-15

    In this research six cyanine fluorophores for the quantification of dsDNA in the pg-ng range, without amplification, are compared under exactly identical conditions: EvaGreen, SYBR Green, PicoGreen, AccuClear, AccuBlue NextGen and YOYO-1. The fluorescence intensity as a function of the amount of dsDNA is measured at the optimal wavelengths for excitation and emission and for each dye the limit of detection and the response linearity at low levels of dsDNA are determined. No linear range was found for SYBR Green and YOYO-1 for pg-ng quantities of dsDNA. EvaGreen, PicoGreen, AccuClear and AccuBlue NextGen show good linearity in the pg-ng range. AccuClear exhibits the widest linear range of 3 pg-200 ng, whereas AccuBlue NextGen turned out to have the highest sensitivity of the tested dyes with a limit of detection of 50 pg. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. LED Current Balance Using a Variable Voltage Regulator with Low Dropout vDS Control

    Directory of Open Access Journals (Sweden)

    Hung-I Hsieh

    2017-02-01

    Full Text Available A cost-effective light-emitting diode (LED current balance strategy using a variable voltage regulator (VVR with low dropout vDS control is proposed. This can regulate the multiple metal-oxide-semiconductor field-effect transistors (MOSFETs of the linear current regulators (LCR, maintaining low dropout vDS on the flat vGS-characteristic curves and making all drain currents almost the same. Simple group LCRs respectively loaded with a string LED are employed to implement the theme. The voltage VVdc from a VVR is synthesized by a string LED voltage NvD, source voltage vR, and a specified low dropout vDS = VQ. The VVdc updates instantly, through the control loop of the master LCR, which means that all slave MOSFETs have almost the same biases on their flat vGS-characteristic curves. This leads to all of the string LED currents being equal to each other, producing an almost even luminance. An experimental setup with microchip control is built to verify the estimations. Experimental results show that the luminance of all of the string LEDs are almost equal to one another, with a maximum deviation below 1% during a wide dimming range, while keeping all vDS of the MOSFETs at a low dropout voltage, as expected.

  4. Use of geological mapping tools to improve the hydraulic performance of SuDS

    DEFF Research Database (Denmark)

    Bockhorn, Britta; Klint, Knud Erik; Jensen, Marina Bergen

    2015-01-01

    drainage systems (SuDS). We have tested methods to reveal geological heterogeneity at field scale to identify the most suitable sites for the placement of infiltration elements and to minimize their required size. We assessed the geological heterogeneity of a clay till plain in Eastern Jutland, Denmark...

  5. 49 CFR 178.47 - Specification 4DS welded stainless steel cylinders for aircraft use.

    Science.gov (United States)

    2010-10-01

    ... procedure. A heat of steel made under the specifications in table 1 in this paragraph (b), check chemical... abrupt change in wall thickness is permitted. Welding procedures and operators must be qualified in... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 4DS welded stainless steel cylinders...

  6. SuDS for managing surface water in Diepsloot informal settlement ...

    African Journals Online (AJOL)

    Sustainable drainage systems (SuDS) imitate natural water management processes in catchments that have been degraded due to urbanisation. The aim is to reduce the quantity of stormwater runoff and improve water quality. Management of rainwater in the informal settlement of Diepsloot in Johannesburg is ...

  7. A DS106 Thing Happened on the Way to the 3M Tech Forum

    Science.gov (United States)

    Lockridge, Rochelle; Levine, Alan; Funes, Mariana

    2014-01-01

    This case study illustrates how DS106, a computer science course in Digital Storytelling from the University of Mary Washington (UMW) and accessible as an open course on the web, is being explored in a corporate environment at 3M, an American multinational corporation based in St. Paul, Minnesota, to build community, collaboration, and more…

  8. KiDS-450: tomographic cross-correlation of galaxy shear with Planck lensing

    Science.gov (United States)

    Harnois-Déraps, Joachim; Tröster, Tilman; Chisari, Nora Elisa; Heymans, Catherine; van Waerbeke, Ludovic; Asgari, Marika; Bilicki, Maciej; Choi, Ami; Erben, Thomas; Hildebrandt, Hendrik; Hoekstra, Henk; Joudaki, Shahab; Kuijken, Konrad; Merten, Julian; Miller, Lance; Robertson, Naomi; Schneider, Peter; Viola, Massimo

    2017-10-01

    We present the tomographic cross-correlation between galaxy lensing measured in the Kilo Degree Survey (KiDS-450) with overlapping lensing measurements of the cosmic microwave background (CMB), as detected by Planck 2015. We compare our joint probe measurement to the theoretical expectation for a flat Λ cold dark matter cosmology, assuming the best-fitting cosmological parameters from the KiDS-450 cosmic shear and Planck CMB analyses. We find that our results are consistent within 1σ with the KiDS-450 cosmology, with an amplitude re-scaling parameter AKiDS = 0.86 ± 0.19. Adopting a Planck cosmology, we find our results are consistent within 2σ, with APlanck = 0.68 ± 0.15. We show that the agreement is improved in both cases when the contamination to the signal by intrinsic galaxy alignments is accounted for, increasing A by ∼0.1. This is the first tomographic analysis of the galaxy lensing - CMB lensing cross-correlation signal, and is based on five photometric redshift bins. We use this measurement as an independent validation of the multiplicative shear calibration and of the calibrated source redshift distribution at high redshifts. We find that constraints on these two quantities are strongly correlated when obtained from this technique, which should therefore not be considered as a stand-alone competitive calibration tool.

  9. Transactivation of Ds by Ac-transposase gene fusions in tobacco

    NARCIS (Netherlands)

    Rommens, Caius M.T.; Haaren, Mark J.J. van; Buchel, Annemarie S.; Mol, Joseph N.M.; Tunen, Arjen J. van; Nijkamp, H. John J.; Hille, Jacques

    1992-01-01

    To study regulation of the (Ds) transposition process in heterologous plant species, the transposase gene of Ac was fused to several promoters that are active late during plant development. These promoters are the flower-specific chalcone synthase A promoter (CHS A), the anther-specific chalcone

  10. Comparative effects of Apron plus 50DS and soil amendment on the ...

    African Journals Online (AJOL)

    Comparative effects of Apron plus 50DS and soil amendment on the growth, yield and food components of soybean. ... Biochemical analysis of harvested seeds showed an increase in protein content of seeds treated with recommended dose of Apron plus, planted on amended soil. Seeds treated with less than the ...

  11. Distinguishing cytosine methylation using electrochemical, label-free detection of DNA hybridization and ds-targets.

    Science.gov (United States)

    Zhu, Bicheng; Booth, Marsilea A; Shepherd, Phillip; Sheppard, Allan; Travas-Sejdic, Jadranka

    2015-02-15

    In this communication we report on two important effects related to the detection of DNAs. Firstly, we investigate the sensor response to target DNA when the target is in a double stranded (ds) form and compare the response to single stranded (ss) target DNA. The importance in evaluating such an effect lies in the fact that most biological DNA targets are found in ds form. Secondly, we use synthetic ds targets to investigate the effect of DNA methylation on the sensor response. DNA methylation is known to affect functional properties of DNA and is related to a number of diseases, including various cancers. In these studies, we utilize our previously developed sensor platform, which is based on the use of a glassy carbon electrode-confined conducting polymer that is covalently modified with DNA probe sequences. The signal detection methodology we use is measuring a change in the reaction kinetics of ferro-ferricyanide redox couple at the electrode upon hybridization by means of electrical impedance spectroscopy (EIS). Additionally, EIS is utilized to study the kinetics of the hybridization of the conducting polymer-bound probe with methylated vs. non-methylated ds-DNA. Preliminary results are proving valuable as a guide to the future design of sensors for gene methylation. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. 22 CFR 62.71 - Control and production of the electronic Form DS-2019.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Control and production of the electronic Form DS-2019. 62.71 Section 62.71 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES EXCHANGE VISITOR PROGRAM Student and Exchange Visitor Information System (SEVIS) § 62.71 Control and...

  13. Low Complexity Iterative Joint Channel Estimation and Multiuser Detection for DS-CDMA

    DEFF Research Database (Denmark)

    Christensen, Søren Skovgård; Kocian, Alexander; Fleury, Bernard Henri

    2004-01-01

    Previously the SAGE algorithm was applied to sub-optimal yet efficient Joint data Detection and channel Estimation (JDE) for DS-CDMA of moderate time complexity. Modifying the expectation and maximization steps of the SAGE-JDE scheme, it is possible to obtain an efficient receiver architecture...

  14. DsRed gene expression by doxycycline in porcine fibroblasts and ...

    African Journals Online (AJOL)

    Goo

    2013-05-22

    May 22, 2013 ... After the maturation of the oocytes, genetic materials of oocytes were removed under the nuclear staining and a. DsRed expressing cell was micro-injected into enucleated oocytes. The reconstructed oocytes were fused and electrically activated as follows; the fusion medium was 0.26 M mannitol solution ...

  15. Solar Deployment System (SolarDS) Model: Documentation and Sample Results

    Energy Technology Data Exchange (ETDEWEB)

    Denholm, P.; Drury, E.; Margolis, R.

    2009-09-01

    The Solar Deployment System (SolarDS) model is a bottom-up, market penetration model that simulates the potential adoption of photovoltaics (PV) on residential and commercial rooftops in the continental United States through 2030. NREL developed SolarDS to examine the market competitiveness of PV based on regional solar resources, capital costs, electricity prices, utility rate structures, and federal and local incentives. The model uses the projected financial performance of PV systems to simulate PV adoption for building types and regions then aggregates adoption to state and national levels. The main components of SolarDS include a PV performance simulator, a PV annual revenue calculator, a PV financial performance calculator, a PV market share calculator, and a regional aggregator. The model simulates a variety of installed PV capacity for a range of user-specified input parameters. PV market penetration levels from 15 to 193 GW by 2030 were simulated in preliminary model runs. SolarDS results are primarily driven by three model assumptions: (1) future PV cost reductions, (2) the maximum PV market share assumed for systems with given financial performance, and (3) PV financing parameters and policy-driven assumptions, such as the possible future cost of carbon emissions.

  16. A KiDS weak lensing analysis of assembly bias in GAMA galaxy groups

    NARCIS (Netherlands)

    Dvornik, Andrej; Cacciato, Marcello; Kuijken, Konrad; Viola, Massimo; Hoekstra, Henk; Nakajima, Reiko; van Uitert, Edo; Brouwer, Margot; Choi, Ami; Erben, Thomas; Fenech Conti, Ian; Farrow, Daniel J.; Herbonnet, Ricardo; Heymans, Catherine; Hildebrandt, Hendrik; Hopkins, Andrew. M.; McFarland, John; Norberg, Peder; Schneider, Peter; Sifón, Cristóbal; Valentijn, Edwin; Wang, Lingyu

    2017-01-01

    We investigate possible signatures of halo assembly bias for spectroscopically selected galaxy groups from the GAMA survey using weak lensing measurements from the spatially overlapping regions of the deeper, high-imaging-quality photometric KiDS survey. We use GAMA groups with an apparent richness

  17. Joint IRCTR/TNO-DS&S measurement campaign for AP-mine detection with VIR GPR

    NARCIS (Netherlands)

    Kovalenko, V.; Yarovoy, A.; Ligthart, L.P.; Hakkaart, P.; Rhebergen, J.B.

    2005-01-01

    The results of the measurement campaign held during the autumn of 2004 in a sand pit located at the TNO-DS&S (formerly known as TNO Physics and Electronics Laboratory (FEL)) GPR test facility "Waalsdorp" in The Hague, The Netherlands, are presented. Some contamination of the sand in the pit with

  18. 75 FR 25307 - 30-Day Notice of Proposed Information Collection: DS-4100, Iran Program Grants Vetting...

    Science.gov (United States)

    2010-05-07

    ... Notice of Proposed Information Collection: DS-4100, Iran Program Grants Vetting, Information Collection... Department conduct a vetting of potential Iran programs grantees and sub-grantees for counter-terrorism purposes. To conduct this vetting the Department envisions collecting information from grantees and sub...

  19. 75 FR 2181 - 60-Day Notice of Proposed Information Collection: DS-4100, Iran Program Grants Vetting...

    Science.gov (United States)

    2010-01-14

    ... Notice of Proposed Information Collection: DS-4100, Iran Program Grants Vetting, Information Collection... Foreign Assets Control (OFAC) mandates that the Department conduct a vetting of potential Iran programs grantees and sub-grantees for counter-terrorism purposes. To conduct this vetting the Department envisions...

  20. DsRed gene expression by doxycycline in porcine fibroblasts and ...

    African Journals Online (AJOL)

    DsRed gene expression by doxycycline in porcine fibroblasts and cloned embryos using transposon. SuJin Kim, JoonHo Moon, BegoRoibas da Torre, Islam M Saadeldin, JungTaek Kang, JiYei Choi, SolJi Park, Byeong-Chun Lee, Goo Jang Goo Jang ...

  1. 48 CFR 9903.202-9 - Illustration of Disclosure Statement Form, CASB-DS-1.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Illustration of Disclosure Statement Form, CASB-DS-1. 9903.202-9 Section 9903.202-9 Federal Acquisition Regulations System COST... PRACTICES AND COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-9 Illustration...

  2. 48 CFR 9903.202-10 - Illustration of Disclosure Statement Form, CASB DS-2.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Illustration of Disclosure Statement Form, CASB DS-2. 9903.202-10 Section 9903.202-10 Federal Acquisition Regulations System COST... PRACTICES AND COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-10 Illustration...

  3. 77 FR 39318 - 30-Day Notice of Proposed Information Collection: DS-5513, Supplemental Questionnaire To...

    Science.gov (United States)

    2012-07-02

    ... facts surrounding an applicant's birth in order to accommodate the various situations in which Americans... birth circumstances that is needed prior to passport issuance. ] Additional Information The DS-5513 is... concentrate around the time of the applicant's birth and there are no longer any questions seeking information...

  4. Measurement of CP asymmetries in D-+/- -> eta 'pi(+/-) and D-S(+/-) -> eta 'pi(+/-) decays

    NARCIS (Netherlands)

    Dufour, L.; Mulder, M; Onderwater, C. J. G.; Pellegrino, A.; Tolk, S.; van Veghel, M.

    2017-01-01

    A search for CP violation in D-+/- -> eta 'pi(+/-) and D-S(+/-) -> eta 'pi(+/-) decays is performed using proton-proton collision data, corresponding to an integrated luminosity of 3 fb(-1), recorded by the LHCb experiment at centre-of-mass energies of 7 and 8 TeV. The measured CP-violating charge

  5. Review of dWindDS Model Initial Results; NREL (National Renewable Energy Laboratory)

    Energy Technology Data Exchange (ETDEWEB)

    Baring-Gould, Ian; Gleason, Michael; Preus, Robert; Sigrin, Ben

    2015-06-17

    The dWindDS model analyses the market diffusion of distributed wind generation for behind the meter applications. It is consumer decision based and uses a variety of data sets including a high resolution wind data set. It projects market development through 2050 based on input on specified by the user. This presentation covers some initial runs with draft base case assumptions.

  6. Field Test of a Remote Multi-Path CLaDS Methane Sensor

    Directory of Open Access Journals (Sweden)

    Genevieve Plant

    2015-08-01

    Full Text Available Existing technologies for quantifying methane emissions are often limited to single point sensors, making large area environmental observations challenging. We demonstrate the operation of a remote, multi-path system using Chirped Laser Dispersion Spectroscopy (CLaDS for quantification of atmospheric methane concentrations over extended areas, a technology that shows potential for monitoring emissions from wetlands.

  7. Dietary risk assessment of v-ATPase A dsRNAs on monarch butterfly larvae

    Science.gov (United States)

    The goal of this study is to assess the risks of RNA interference (RNAi)-based genetically engineered crops on a non-target arthropod, monarch butterfly, Danaus plexippus. We hypothesize that an insecticidal double-stranded (ds) RNA targeting western corn rootworm, Diabrotica virgifera virgifera, ha...

  8. 76 FR 70804 - 30-Day Notice of Proposed Information Collection: DS-7656; Affidavit of Relationship (AOR)

    Science.gov (United States)

    2011-11-15

    ...). Form Number: DS-7656. Respondents: Persons admitted to the United States as refugees or granted asylum in the United States requesting that their spouses, unmarried children under age 21, and/or parents...-- Family Reunification category of the United States Refugee Admissions Program (USRAP)--by persons of...

  9. Use of the fluorescent timer DsRED-E5 as reporter to monitor dynamics of gene activity in plants

    NARCIS (Netherlands)

    Mirabella, R.; Franken, C.; Krogt, van der G.N.M.; Bisseling, T.; Geurts, R.

    2004-01-01

    Fluorescent proteins, such as green fluorescent protein and red fluorescent protein (DsRED), have become frequently used reporters in plant biology. However, their potential to monitor dynamic gene regulation is limited by their high stability. The recently made DsRED-E5 variant overcame this

  10. VizieR Online Data Catalog: KiDS-ESO-DR2 multi-band source catalog (de Jong+, 2015)

    NARCIS (Netherlands)

    de Jong, J. T. A.; Verdoes Kleijn, G. A.; Boxhoorn, D. R.; Buddelmeijer, H.; Capaccioli, M.; Getman, F.; Grado, A.; Helmich, E.; Huang, Z.; Irisarri, N.; Kuijken, K.; La Barbera, F.; McFarland, J. P.; Napolitano, N. R.; Radovich, M.; Sikkema, G.; Valentijn, E. A.; Begeman, K. G.; Brescia, M.; Cavuoti, S.; Choi, A.; Cordes, O.-M.; Covone, G.; Dall'Ora, M.; Hildebrandt, H.; Longo, G.; Nakajima, R.; Paolillo, M.; Puddu, E.; Rifatto, A.; Tortora, C.; van Uitert, E.; Buddendiek, A.; Harnois-Deraps, J.; Erben, T.; Eriksen, M. B.; Heymans, C.; Hoekstra, H.; Joachimi, B.; Kitching, T. D.; Klaes, D.; Koopmans, L. V. E.; Koehlinger, F.; Roy, N.; Sifon, C.; Schneider, P.; Sutherland, W. J.; Viola, M.; Vriend, W.-J.

    2017-01-01

    KiDS data releases consist of ~1 square degree tiles that have been successfully observed in all four survey filters (u,g,r,i). The second data release (KiDS-ESO-DR2) was available in February 2015 and contains imaging data, masks and single-band source lists for all tiles observed in all four

  11. 76 FR 16850 - 60-Day Notice of Proposed Information Collection: Agency Form DS-4127, NEA/PI Online Performance...

    Science.gov (United States)

    2011-03-25

    ... Notice of Proposed Information Collection: Agency Form DS- 4127, NEA/PI Online Performance Reporting... of 1995. Title of Information Collection: NEA/PI Online Performance Reporting System (PRS). OMB Control Number: 1405-0183. Type of Request: Renewal. Originating Office: NEA/PI. Form Number: DS-4127...

  12. KiDS-450: testing extensions to the standard cosmological model

    Science.gov (United States)

    Joudaki, Shahab; Mead, Alexander; Blake, Chris; Choi, Ami; de Jong, Jelte; Erben, Thomas; Fenech Conti, Ian; Herbonnet, Ricardo; Heymans, Catherine; Hildebrandt, Hendrik; Hoekstra, Henk; Joachimi, Benjamin; Klaes, Dominik; Köhlinger, Fabian; Kuijken, Konrad; McFarland, John; Miller, Lance; Schneider, Peter; Viola, Massimo

    2017-10-01

    We test extensions to the standard cosmological model with weak gravitational lensing tomography using 450 deg2 of imaging data from the Kilo Degree Survey (KiDS). In these extended cosmologies, which include massive neutrinos, non-zero curvature, evolving dark energy, modified gravity and running of the scalar spectral index, we also examine the discordance between KiDS and cosmic microwave background (CMB) measurements from Planck. The discordance between the two data sets is largely unaffected by a more conservative treatment of the lensing systematics and the removal of angular scales most sensitive to non-linear physics. The only extended cosmology that simultaneously alleviates the discordance with Planck and is at least moderately favoured by the data includes evolving dark energy with a time-dependent equation of state (in the form of the w0 - wa parametrization). In this model, the respective S_8=σ _8√{Ω m/0.3} constraints agree at the 1σ level, and there is 'substantial concordance' between the KiDS and Planck data sets when accounting for the full parameter space. Moreover, the Planck constraint on the Hubble constant is wider than in Λ cold dark matter (ΛCDM) and in agreement with the Riess et al. (2016) direct measurement of H0. The dark energy model is moderately favoured as compared to ΛCDM when combining the KiDS and Planck measurements, and marginalized constraints in the w0-wa plane are discrepant with a cosmological constant at the 3σ level. KiDS further constrains the sum of neutrino masses to 4.0 eV (95% CL), finds no preference for time or scale-dependent modifications to the metric potentials, and is consistent with flatness and no running of the spectral index.

  13. Structural basis for the dsRNA specificity of the Lassa virus NP exonuclease.

    Science.gov (United States)

    Hastie, Kathryn M; King, Liam B; Zandonatti, Michelle A; Saphire, Erica Ollmann

    2012-01-01

    Lassa virus causes hemorrhagic fever characterized by immunosuppression. The nucleoprotein of Lassa virus, termed NP, binds the viral genome. It also has an additional enzymatic activity as an exonuclease that specifically digests double-stranded RNA (dsRNA). dsRNA is a strong signal to the innate immune system of viral infection. Digestion of dsRNA by the NP exonuclease activity appears to cause suppression of innate immune signaling in the infected cell. Although the fold of the NP enzyme is conserved and the active site completely conserved with other exonucleases in its DEDDh family, NP is atypical among exonucleases in its preference for dsRNA and its strict specificity for one substrate. Here, we present the crystal structure of Lassa virus NP in complex with dsRNA. We find that unlike the exonuclease in Klenow fragment, the double-stranded nucleic acid in complex with Lassa NP remains base-paired instead of splitting, and that binding of the paired complementary strand is achieved by "relocation" of a basic loop motif from its typical exonuclease position. Further, we find that just one single glycine that contacts the substrate strand and one single tyrosine that stacks with a base of the complementary, non-substrate strand are responsible for the unique substrate specificity. This work thus provides templates for development of antiviral drugs that would be specific for viral, rather than host exonucleases of similar fold and active site, and illustrates how a very few amino acid changes confer alternate specificity and biological phenotype to an enzyme.

  14. Structural basis for the dsRNA specificity of the Lassa virus NP exonuclease.

    Directory of Open Access Journals (Sweden)

    Kathryn M Hastie

    Full Text Available Lassa virus causes hemorrhagic fever characterized by immunosuppression. The nucleoprotein of Lassa virus, termed NP, binds the viral genome. It also has an additional enzymatic activity as an exonuclease that specifically digests double-stranded RNA (dsRNA. dsRNA is a strong signal to the innate immune system of viral infection. Digestion of dsRNA by the NP exonuclease activity appears to cause suppression of innate immune signaling in the infected cell. Although the fold of the NP enzyme is conserved and the active site completely conserved with other exonucleases in its DEDDh family, NP is atypical among exonucleases in its preference for dsRNA and its strict specificity for one substrate. Here, we present the crystal structure of Lassa virus NP in complex with dsRNA. We find that unlike the exonuclease in Klenow fragment, the double-stranded nucleic acid in complex with Lassa NP remains base-paired instead of splitting, and that binding of the paired complementary strand is achieved by "relocation" of a basic loop motif from its typical exonuclease position. Further, we find that just one single glycine that contacts the substrate strand and one single tyrosine that stacks with a base of the complementary, non-substrate strand are responsible for the unique substrate specificity. This work thus provides templates for development of antiviral drugs that would be specific for viral, rather than host exonucleases of similar fold and active site, and illustrates how a very few amino acid changes confer alternate specificity and biological phenotype to an enzyme.

  15. Behavioral phenotype in children with 22q11DS: agreement between parents and teachers.

    Science.gov (United States)

    Klaassen, Petra W J; Duijff, Sasja N; Sinnema, Gerben; Beemer, Frits A; Swanenburg de Veye, Henriëtte F N; Vorstman, Jacob A S

    2015-03-01

    Patients with the 22q11-deletion syndrome (22q11DS) are at an increased risk of developing schizophrenia. Besides the effects of genetic variation, environmental factors could also be important in modifying the risk of schizophrenia in 22q11DS patients. In particular, previous studies have shown the importance of stress as a precipitating factor of psychosis. An incongruence between the perceived and actual severity of behavioral and cognitive domains could lead caregivers, and even the children themselves, to make demands that are insufficiently adapted to the child's abilities, causing stress and anxiety. Here, we investigate whether such diagnostic discrepancies are indeed present by comparing parent and teacher reports on behavioral concerns in children with 22q11DS. Behavioral questionnaires (CBCL and TRF) were prepared for both parents and teachers of 146 children with 22q11DS. We found that in line with previous reports, internalizing behavior was more frequently reported than externalizing behavior. While the behavioral profiles reported by parents and teachers were remarkably similar, the teachers' ratings were significantly lower (Total problem score p = .002). Age and IQ were not significantly associated with the severity of reported concerns. Our results indicate that indeed a disparity often exists between parents' and teachers' perceptions of the severity of a child's behavioral deficits. This may result in (substantially) different demands and expectations being placed on the child from the two fronts. We speculate that the stress resulting from this lack of cohesion between parents and teachers could precipitate, at least in some 22q11DS children, the emergence of psychosis. 2015 APA, all rights reserved

  16. Assembly-driven activation of the AIM2 foreign-dsDNA sensor provides a polymerization template for downstream ASC

    Science.gov (United States)

    Morrone, Seamus R.; Matyszewski, Mariusz; Yu, Xiong; Delannoy, Michael; Egelman, Edward H.; Sohn, Jungsan

    2015-07-01

    AIM2 recognizes foreign dsDNA and assembles into the inflammasome, a filamentous supramolecular signalling platform required to launch innate immune responses. We show here that the pyrin domain of AIM2 (AIM2PYD) drives both filament formation and dsDNA binding. In addition, the dsDNA-binding domain of AIM2 also oligomerizes and assists in filament formation. The ability to oligomerize is critical for binding dsDNA, and in turn permits the size of dsDNA to regulate the assembly of the AIM2 polymers. The AIM2PYD oligomers define the filamentous structure, and the helical symmetry of the AIM2PYD filament is consistent with the filament assembled by the PYD of the downstream adaptor ASC. Our results suggest that the role of AIM2PYD is not autoinhibitory, but generating a structural template by coupling ligand binding and oligomerization is a key signal transduction mechanism in the AIM2 inflammasome.

  17. Analysis of the strong decays Ds3 *(2860) → DK, D*K with QCD sum rules

    Science.gov (United States)

    Wang, Zhi-Gang

    2016-10-01

    In this article, we assign the D_{s3}^{ast}(2860) to be a D-wave c bar{s} meson, study the hadronic coupling constants G_{D_{s3}^{ast}(2860)DK} and G_{D_{s3}^{ast} (2860)D^{ast}K} with the three-point QCD sum rules, and calculate the partial decay widths Γ (D_{s3}^{ast} (2860) → D^{ast}K) and Γ (D_{s3}^{ast}(2860) → DK) . The predicted ratio R = Γ (D_{s3}^{ast} (2860)→ D^{ast}K)/Γ (D_{s3}^{ast} (2860)→ DK) = 0.57± 0.38 cannot reproduce the experimental value R = Br(D_{sJ}^{ast} (2860)→ D^{ast}K)/Br (D_{sJ}^{ast} (2860)→ DK) = 1.10 ± 0.15 ± 0.19.

  18. Interaction of calf thymus dsDNA with anti-tumor drug tamoxifen studied by zero current potentiometry.

    Science.gov (United States)

    Guo, Xiao-xia; Song, Zhang-jun; Sun, Jie-juan; Song, Jun-feng

    2011-06-15

    Since the electrochemical oxidation peaks of both DNA and anti-tumor drug tamoxifen (TAM) overlapped with each other, the known electrochemical methods were limited in the study of the interactions between DNA and TAM. In this paper, zero current potentiometry, a new electrochemical method, was used to study the interaction of calf thymus dsDNA with TAM. The dsDNA was immobilized on the surface of carbon paste (dsDNA/CP). The dsDNA/CP connected in series between the clips of working and counter electrodes of a potentiostat and a reference electrode were immersed in aqueous solution containing TAM, the interaction of dsDNA with TAM produced a change in interfacial potential at the dsDNA/CP/solution interface. When linear sweep potential was applied to the dsDNA/CP and the corresponding I-E curve was recorded, interfacial potential offset applied potential partially, making the I-E curve displace along potential axis. Zero current potential where circuit current I was equal to zero in the I-E curve was measured to check the displacement of the I-E curve. Based on the displacement, the thermodynamic constants of the interaction between dsDNA and TAM were determined. The binding ratio of dsDNA with TAM was found to be 1:1 and the apparent binding constant was (6.85±0.20)×10(6) M(-1). As zero current potentiometry was independent of the changes in redox potential or current of both dsDNA and TAM themselves, the interaction was studied in their natural forms without damage. Moreover, TAM can be determined. The detection limit was 1.1×10(-7) M. Copyright © 2011 Elsevier B.V. All rights reserved.

  19. KIR3DS1-Mediated Recognition of HLA-*B51: Modulation of KIR3DS1 Responsiveness by Self HLA-B Allotypes and Effect on NK Cell Licensing

    Directory of Open Access Journals (Sweden)

    Simona Carlomagno

    2017-05-01

    Full Text Available Several studies described an association between killer-cell immunoglobulin-like receptor (KIR/HLA gene combinations and clinical outcomes in various diseases. In particular, an important combined role for KIR3DS1 and HLA-B Bw4-I80 in controlling viral infections and a higher protection against leukemic relapses in donor equipped with activating KIRs in haplo-HSCT has been described. Here, we show that KIR3DS1 mediates positive signals upon recognition of HLA-B*51 (Bw4-I80 surface molecules on target cells and that this activation occurs only in Bw4-I80neg individuals, including those carrying particular KIR/HLA combination settings. In addition, killing of HLA-B*51 transfected target cells mediated by KIR3DS1+/NKG2A+ natural killer (NK cell clones from Bw4-I80neg donors could be partially inhibited by antibody-mediated masking of KIR3DS1. Interestingly, KIR3DS1-mediated recognition of HLA-B*51 could be better appreciated under experimental conditions in which the function of NKG2D was reduced by mAb-mediated blocking. This experimental approach may mimic the compromised function of NKG2D occurring in certain viral infections. We also show that, in KIR3DS1+/NKG2A+ NK cell clones derived from an HLA-B Bw4-T80 donor carrying 2 KIR3DS1 gene copy numbers, the positive signal generated by the engagement of KIR3DS1 by HLA-B*51 resulted in a more efficient killing of HLA-B*51-transfected target cells. Moreover, in these clones, a direct correlation between KIR3DS1 and NKG2D surface density was detected, while the expression of NKp46 was inversely correlated with that of KIR3DS1. Finally, we analyzed KIR3DS1+/NKG2A+ NK cell clones from a HLA-B Bw4neg donor carrying cytoplasmic KIR3DL1. Although these clones expressed lower levels of surface KIR3DS1, they displayed responses comparable to those of NK cell clones derived from HLA-B Bw4neg donors that expressed surface KIR3DL1. Altogether these data suggest that, in particular KIR/HLA combinations, KIR3DS1

  20. KIR3DS1-Mediated Recognition of HLA-*B51: Modulation of KIR3DS1 Responsiveness by Self HLA-B Allotypes and Effect on NK Cell Licensing.

    Science.gov (United States)

    Carlomagno, Simona; Falco, Michela; Bono, Maria; Alicata, Claudia; Garbarino, Lucia; Mazzocco, Michela; Moretta, Lorenzo; Moretta, Alessandro; Sivori, Simona

    2017-01-01

    Several studies described an association between killer-cell immunoglobulin-like receptor (KIR)/HLA gene combinations and clinical outcomes in various diseases. In particular, an important combined role for KIR3DS1 and HLA-B Bw4-I80 in controlling viral infections and a higher protection against leukemic relapses in donor equipped with activating KIRs in haplo-HSCT has been described. Here, we show that KIR3DS1 mediates positive signals upon recognition of HLA-B*51 (Bw4-I80) surface molecules on target cells and that this activation occurs only in Bw4-I80(neg) individuals, including those carrying particular KIR/HLA combination settings. In addition, killing of HLA-B*51 transfected target cells mediated by KIR3DS1(+)/NKG2A(+) natural killer (NK) cell clones from Bw4-I80(neg) donors could be partially inhibited by antibody-mediated masking of KIR3DS1. Interestingly, KIR3DS1-mediated recognition of HLA-B*51 could be better appreciated under experimental conditions in which the function of NKG2D was reduced by mAb-mediated blocking. This experimental approach may mimic the compromised function of NKG2D occurring in certain viral infections. We also show that, in KIR3DS1(+)/NKG2A(+) NK cell clones derived from an HLA-B Bw4-T80 donor carrying 2 KIR3DS1 gene copy numbers, the positive signal generated by the engagement of KIR3DS1 by HLA-B*51 resulted in a more efficient killing of HLA-B*51-transfected target cells. Moreover, in these clones, a direct correlation between KIR3DS1 and NKG2D surface density was detected, while the expression of NKp46 was inversely correlated with that of KIR3DS1. Finally, we analyzed KIR3DS1(+)/NKG2A(+) NK cell clones from a HLA-B Bw4(neg) donor carrying cytoplasmic KIR3DL1. Although these clones expressed lower levels of surface KIR3DS1, they displayed responses comparable to those of NK cell clones derived from HLA-B Bw4(neg) donors that expressed surface KIR3DL1. Altogether these data suggest that, in particular KIR/HLA combinations, KIR3

  1. Cancer de la próstata

    OpenAIRE

    Mendoza, Lupi Alejandro; Fundación Valle de Lili; Gutierrez, María Carolina; López Cardona, Arturo

    1997-01-01

    ¿Qué es la próstata?/¿Qué es la hiperplasia benigna de próstata?/El cáncer de próstata/¿Se hereda el cáncer de próstata?/¿Cómo se presenta y hacia donde se disemina el cáncer de próstata?/¿Cómo de descubre el cáncer de próstata?/¿Qué estudia la ultrasonografía transrectal o ecografía a través de recto?/¿Cómo se analizan los niveles de PSA?/¿Cómo se clasifica el cáncer de próstata?¿Cómo se determina la terapia más adecuada para un cáncer de próstata?/¿Cuáles son las opciones de tratamiento par...

  2. Competency profile of PR professional in sport

    OpenAIRE

    Gazdíková, Lenka

    2013-01-01

    Title: Competency profile of PR professional in sport Objective: The objective is to identify competencies required to a position of PR professional in sport. The aim of a survey is to verify the level of competencies which follows compiling competency profile and comparison with existing profile of PR specialist. Methods: The objective is achieved using survey, interview and analysis of competency models database. Results: The result of this paper is competency profile of PR professional in ...

  3. Bruken av nasjonale prøver

    DEFF Research Database (Denmark)

    Skov, Poul

    2010-01-01

    Artiklen beskriver resultater fra en omfattende evaluering af brugen af de nationale prøver i norsk grundskole. De nationale prøver er blevet modtaget positivt af mange kommuner og skoleledere og i mindre grad af lærerne. Resultaterne viser også, at prøverne er styrende for undervisningen, at bru...

  4. Study of the $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$ decays with the ATLAS detector

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Bansil, Hardeep Singh; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James Baker; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Kathrin; Becker, Maurice; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozic, Ivan; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bruscino, Nello; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Cardillo, Fabio; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Childers, John Taylor; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; French, Sky; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooft van Huysduynen, Loek; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; König, Sebastian; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Mapelli, Livio; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morton, Alexander; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Pan, Yibin; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pitt, Michael; Pizio, Caterina; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Ptacek, Elizabeth; Puddu, Daniele; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Saddique, Asif; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saimpert, Matthias; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitt, Stefan; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simoniello, Rosa; Sinervo, Pekka; Sinev, Nikolai; Siragusa, Giovanni; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Bruno; Sopko, Vit; Sorin, Veronica; Sosa, David; Sosebee, Mark; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spanò, Francesco; Spearman, William Robert; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; Spreitzer, Teresa; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Velz, Thomas; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, Alan; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamada, Miho; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz

    2016-01-05

    The decays $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$ are studied with the ATLAS detector at the LHC using a dataset corresponding to integrated luminosities of 4.9 fb$^{-1}$ and 20.6 fb$^{-1}$ of $pp$ collisions collected at centre-of-mass energies $\\sqrt{s} = 7$ TeV and 8 TeV, respectively. Signal candidates are identified through $J/\\psi\\to\\mu^+\\mu^-$ and $D_s^{(*)+}\\to\\phi\\pi^+(\\gamma/\\pi^0)$ decays. With a two-dimensional likelihood fit involving the $B_c^+$ reconstructed invariant mass and an angle between the $\\mu^+$ and $D_s^+$ candidate momenta in the muon pair rest frame, the yields of $B_c^+ \\to J/\\psi D_s^+$ and $B_c^+ \\to J/\\psi D_s^{*+}$, and the transverse polarisation fraction in $B_c^+ \\to J/\\psi D_s^{*+}$ decay are measured. The transverse polarisation fraction is determined to be $\\Gamma_{\\pm\\pm}(B_c^+ \\to J/\\psi D_s^{*+})/\\Gamma(B_c^+ \\to J/\\psi D_s^{*+}) = 0.38 \\pm 0.23 \\pm 0.07$, and the derived ratio of the branching fractions of the two modes is $\\mathcal{B}_{B_c^+ \\to J/...

  5. The translation research in a dental setting (TRiaDS programme protocol

    Directory of Open Access Journals (Sweden)

    McKee Lorna

    2010-07-01

    Full Text Available Abstract Background It is well documented that the translation of knowledge into clinical practice is a slow and haphazard process. This is no less true for dental healthcare than other types of healthcare. One common policy strategy to help promote knowledge translation is the production of clinical guidance, but it has been demonstrated that the simple publication of guidance is unlikely to optimise practice. Additional knowledge translation interventions have been shown to be effective, but effectiveness varies and much of this variation is unexplained. The need for researchers to move beyond single studies to develop a generalisable, theory based, knowledge translation framework has been identified. For dentistry in Scotland, the production of clinical guidance is the responsibility of the Scottish Dental Clinical Effectiveness Programme (SDCEP. TRiaDS (Translation Research in a Dental Setting is a multidisciplinary research collaboration, embedded within the SDCEP guidance development process, which aims to establish a practical evaluative framework for the translation of guidance and to conduct and evaluate a programme of integrated, multi-disciplinary research to enhance the science of knowledge translation. Methods Set in General Dental Practice the TRiaDS programmatic evaluation employs a standardised process using optimal methods and theory. For each SDCEP guidance document a diagnostic analysis is undertaken alongside the guidance development process. Information is gathered about current dental care activities. Key recommendations and their required behaviours are identified and prioritised. Stakeholder questionnaires and interviews are used to identify and elicit salient beliefs regarding potential barriers and enablers towards the key recommendations and behaviours. Where possible routinely collected data are used to measure compliance with the guidance and to inform decisions about whether a knowledge translation intervention is

  6. Measurement of $B^0 \\to D_s^- K^0_S\\pi^+$ and $B^+ \\to D_s^- K^+K^+$ branching fractions

    CERN Document Server

    Wiechczynski, J; Abdesselam, A; Adachi, I; Adamczyk, K; Aihara, H; Said, S Al; Arinstein, K; Asner, D M; Aulchenko, V; Aushev, T; Ayad, R; Bakich, A M; Bansal, V; Bhardwaj, V; Bhuyan, B; Bobrov, A; Bondar, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Červenkov, D; Chekelian, V; Cheon, B G; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Dalseno, J; Danilov, M; Dingfelder, J; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Farhat, H; Fast, J E; Ferber, T; Frost, O; Gaur, V; Gabyshev, N; Ganguly, S; Garmash, A; Getzkow, D; Gillard, R; Goh, Y M; Grzymkowska, O; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; He, X H; Hou, W -S; Huschle, M; Hyun, H J; Iijima, T; Ishikawa, A; Itoh, R; Iwasaki, Y; Jaegle, I; Joffe, D; Joo, K K; Julius, T; Kang, K H; Kato, E; Kawasaki, T; Kichimi, H; Kim, D Y; Kim, J B; Kim, J H; Kim, M J; Kim, S H; Kim, Y J; Kinoshita, K; Ko, B R; Kodyš, P; Križan, P; Krokovny, P; Kuhr, T; Kumita, T; Kuzmin, A; Kwon, Y -J; Lange, J S; Lee, I S; Li, Y; Gioi, L Li; Libby, J; Liventsev, D; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mori, T; Mussa, R; Nakao, M; Nanut, T; Natkaniec, Z; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Pedlar, T K; Petrič, M; Piilonen, L E; Ribežl, E; Ritter, M; Rostomyan, A; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Senyo, K; Seon, O; Sevior, M E; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Solovieva, E; Starič, M; Steder, M; Sumihama, M; Tamponi, U; Tanida, K; Tatishvili, G; Teramoto, Y; Thorne, F; Trabelsi, K; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Usov, Y; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Wang, C H; Wang, M -Z; Wang, P; Watanabe, M; Watanabe, Y; Williams, K M; Won, E; Yamaoka, J; Yashchenko, S; Yook, Y; Yusa, Y; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2014-01-01

    We report a measurement of the $B^0$ and $B^+$ meson decays to the $D_s^-K^0_S \\pi^+$ and $D_s^- K^+K^+$ final states, respectively, using $657 \\times 10^{6} B\\overline{B}$ pairs collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB asymmetric-energy $e^+e^-$ collider. Using the $D_s^-\\to \\phi\\pi^-$, $K^{*}(892)^0 K^-$ and $K^0_S K^-$ decay modes for the $D_s$ reconstruction, we measure the following branching fractions: ${\\cal B}(B^0\\to D_s^{-}K^0_S\\pi^+)=[0.47 \\pm 0.06 (\\mathrm {stat}) \\pm 0.05 (\\mathrm {syst})]\\times 10^{-4}$ and ${\\cal B}(B^+\\to D_s^-K^+K^+)= [0.93 \\pm 0.22 (\\mathrm {stat})\\pm 0.10 (\\mathrm {syst})]\\times 10^{-5}$. We find the ratio of the branching fraction of $B^+\\to D_s^-K^+K^+$ to that of the analogous Cabibbo favored $B^+\\to D_s^-K^+\\pi^+$ decay to be ${\\cal R}_{\\cal B} = 0.054 \\pm 0.013 ({\\rm stat}) \\pm 0.006 ({\\rm syst})$, which is consistent with the na\\"{\\i}ve factorization model. We also observe a deviation from the three-body phase-space model for both s...

  7. Complete genome sequence of a novel dsRNA mycovirus isolated from the phytopathogenic fungus Fusarium oxysporum f. sp. dianthi.

    Science.gov (United States)

    Lemus-Minor, Carlos G; Cañizares, M Carmen; García-Pedrajas, María D; Pérez-Artés, Encarnación

    2015-09-01

    A novel double-stranded RNA (dsRNA) mycovirus, designated Fusarium oxysporum f. sp. dianthi mycovirus 1 (FodV1), was isolated from a strain of the phytopathogenic fungus F. oxysporum f. sp. dianthi. The FodV1 genome had four dsRNA segments, designated, from the largest to the smallest one, dsRNA 1, 2 3, and 4. Each one of these segments contained a single open reading frame (ORF). dsRNA 1 (3555 bp) and dsRNA 3 (2794 bp) encoded a putative RNA-dependent RNA polymerase (RdRp) and a putative coat protein (CP), respectively. dsRNA 2 (2809 bp) and dsRNA 4 (2646 bp) contained ORFs encoding hypothetical proteins (named P2 and P4, respectively) with unknown functions. Analysis of its genomic structure, homology searches of the deduced amino acid sequences, and phylogenetic analysis all indicated that FodV1 is a new member of the family Chrysoviridae. This is the first report of the complete genomic characterization of a mycovirus identified in the plant pathogen Fusarium oxysporum.

  8. Imaging of caspase-3 activation by a novel FRET probe composed of CFP and DsRed

    Science.gov (United States)

    Lin, Juquiang; Zhang, Zhihong; Liu, Bifeng; Luo, Qingming

    2006-01-01

    Caspases-3 is a kind of cysteine proteases and plays an important role in cell apoptosis. It has been reported that caspase-3 activation can be real-time detected in living cells by fluorescence resonance energy transfer (FRET) between an enhanced cyan fluorescent protein and enhanced yellow fluorescent protein. However, the large spectral overlap between cyan fluorescent protein (CFP) and yellow fluorescent protein (YFP) emission and the highly sensitivity to pH of YFP restricted their detecting sensitivity and reliability. CFP and red fluorescent protein (DsRed) possess superb wavelength separation of donor and acceptor emission spectra and DsRed was insensitive to pH, so the FRET probe composed of CFP and DsRed would be more suitable for imaging caspase-3 activation than the FRET probe composed of CFP and YFP. We constructed a vector that encoded CRS (caspase-3 recognition site) fused with CFP and DsRed (CFP-CRS-DsRed). In CFP-CRS-DsRed expressing tumor cells, FRET from CFP to DsRed could be detected. In the Clinical applications of cancer chemotherapy, cisplatin is one of the most broadly used drugs. It was already confirmed that caspase-3 was activated in HeLa cell treated by cisplatin. When the cells were stimulated with cisplatin, we found that the FRET efficient was remarkably decreased and then disappeared. It indicated that actived caspase-3 cleaved the CFP-CRS-DsRed fusion protein at CRS site. Thus, the FRET probe of CFP-CRS-DsRed could sensitively and reliably monitor caspase-3 activation in living cell. This probe will be highly useful for rapid-screening potential drugs that may target the apoptotic process and for imaging tumors in vivo.

  9. The Structure of PrPSc Prions

    Directory of Open Access Journals (Sweden)

    Holger Wille

    2018-02-01

    Full Text Available PrPSc (scrapie isoform of the prion protein prions are the infectious agent behind diseases such as Creutzfeldt–Jakob disease in humans, bovine spongiform encephalopathy in cattle, chronic wasting disease in cervids (deer, elk, moose, and reindeer, as well as goat and sheep scrapie. PrPSc is an alternatively folded variant of the cellular prion protein, PrPC, which is a regular, GPI-anchored protein that is present on the cell surface of neurons and other cell types. While the structure of PrPC is well studied, the structure of PrPSc resisted high-resolution determination due to its general insolubility and propensity to aggregate. Cryo-electron microscopy, X-ray fiber diffraction, and a variety of other approaches defined the structure of PrPSc as a four-rung β-solenoid. A high-resolution structure of PrPSc still remains to be solved, but the four-rung β-solenoid architecture provides a molecular framework for the autocatalytic propagation mechanism that gives rise to the alternative conformation of PrPSc. Here, we summarize the current knowledge regarding the structure of PrPSc and speculate about the molecular conversion mechanisms that leads from PrPC to PrPSc.

  10. The Structure of PrPScPrions.

    Science.gov (United States)

    Wille, Holger; Requena, Jesús R

    2018-02-07

    PrP Sc (scrapie isoform of the prion protein) prions are the infectious agent behind diseases such as Creutzfeldt-Jakob disease in humans, bovine spongiform encephalopathy in cattle, chronic wasting disease in cervids (deer, elk, moose, and reindeer), as well as goat and sheep scrapie. PrP Sc is an alternatively folded variant of the cellular prion protein, PrP C , which is a regular, GPI-anchored protein that is present on the cell surface of neurons and other cell types. While the structure of PrP C is well studied, the structure of PrP Sc resisted high-resolution determination due to its general insolubility and propensity to aggregate. Cryo-electron microscopy, X-ray fiber diffraction, and a variety of other approaches defined the structure of PrP Sc as a four-rung β-solenoid. A high-resolution structure of PrP Sc still remains to be solved, but the four-rung β-solenoid architecture provides a molecular framework for the autocatalytic propagation mechanism that gives rise to the alternative conformation of PrP Sc . Here, we summarize the current knowledge regarding the structure of PrP Sc and speculate about the molecular conversion mechanisms that leads from PrP C to PrP Sc .

  11. Non-specific dsRNA-mediated antiviral response in the honey bee.

    Directory of Open Access Journals (Sweden)

    Michelle L Flenniken

    Full Text Available Honey bees are essential pollinators of numerous agricultural crops. Since 2006, honey bee populations have suffered considerable annual losses that are partially attributed to Colony Collapse Disorder (CCD. CCD is an unexplained phenomenon that correlates with elevated incidence of pathogens, including RNA viruses. Honey bees are eusocial insects that live in colonies of genetically related individuals that work in concert to gather and store nutrients. Their social organization provides numerous benefits, but also facilitates pathogen transmission between individuals. To investigate honey bee antiviral defense mechanisms, we developed an RNA virus infection model and discovered that administration of dsRNA, regardless of sequence, reduced virus infection. Our results suggest that dsRNA, a viral pathogen associated molecular pattern (PAMP, triggers an antiviral response that controls virus infection in honey bees.

  12. Performance of Turbo Interference Cancellation Receivers in Space-Time Block Coded DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    Emmanuel Oluremi Bejide

    2008-07-01

    Full Text Available We investigate the performance of turbo interference cancellation receivers in the space time block coded (STBC direct-sequence code division multiple access (DS-CDMA system. Depending on the concatenation scheme used, we divide these receivers into the partitioned approach (PA and the iterative approach (IA receivers. The performance of both the PA and IA receivers is evaluated in Rayleigh fading channels for the uplink scenario. Numerical results show that the MMSE front-end turbo space-time iterative approach receiver (IA effectively combats the mixture of MAI and intersymbol interference (ISI. To further investigate the possible achievable data rates in the turbo interference cancellation receivers, we introduce the puncturing of the turbo code through the use of rate compatible punctured turbo codes (RCPTCs. Simulation results suggest that combining interference cancellation, turbo decoding, STBC, and RCPTC can significantly improve the achievable data rates for a synchronous DS-CDMA system for the uplink in Rayleigh flat fading channels.

  13. Bacterium-Expressed dsRNA Downregulates Microsporidia Nosema bombycis Gene Expression.

    Science.gov (United States)

    Pan, Qiuling; Wang, Ling; Dang, Xiaoqun; Ma, Zhengang; Zhang, Xiaoyan; Chen, Shiliang; Zhou, Zeyang; Xu, Jinshan

    2017-03-01

    The microsporidia Nosema bombycis is the insect pathogen of pebrine disease severely destructive to sericulture production. Here, we describe the use of Escherichia coli HT115 strain (DE3) to express double-strand RNAs targeting the gene encoding ADP/ATP protein in N. bombycis. The results showed that dsRNAs deferentially suppressed the gene expression during N. bombycis infection in the silkworm, and the effect waned gradually. Our results, for the first time, provide a tool to utilize the dsRNA expressed by recombinant E. coli to control the pebrine disease of the domestic silkworm. © 2016 The Author(s) Journal of Eukaryotic Microbiology © 2016 International Society of Protistologists.

  14. Simulations of Micro Gas Flows by the DS-BGK Method

    KAUST Repository

    Li, Jun

    2011-01-01

    For gas flows in micro devices, the molecular mean free path is of the same order as the characteristic scale making the Navier-Stokes equation invalid. Recently, some micro gas flows are simulated by the DS-BGK method, which is convergent to the BGK equation and very efficient for low-velocity cases. As the molecular reflection on the boundary is the dominant effect compared to the intermolecular collisions in micro gas flows, the more realistic boundary condition, namely the CLL reflection model, is employed in the DS-BGK simulation and the influence of the accommodation coefficients used in the molecular reflection model on the results are discussed. The simulation results are verified by comparison with those of the DSMC method as criteria. Copyright © 2011 by ASME.

  15. Cheating the CHA2DS2-VASc Score: Thromboembolism in Apical Hypertrophic Cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Robin A. P. Weir

    2014-01-01

    Full Text Available Atrial fibrillation increases the risk of systemic thromboembolism in general and stroke in particular. Not all patients who develop atrial fibrillation are at significantly heightened risk of thromboembolic complications, however, with the development of risk scoring systems aiding clinicians in determining whether formal anticoagulation is mandated. The most commonly used contemporary scoring systems—CHADS2 and CHA2DS2-VASc—provide a reliable means of assessing stroke risk, but certain cardiac conditions are associated with an increased incidence of thromboembolism without impacting on these risk scores. Hypertrophic cardiomyopathy, with its apical variant, is such a condition. We present a case of a patient with apical hypertrophic cardiomyopathy and atrial fibrillation who suffered dire thromboembolic consequences despite a reassuringly low CHA2DS2-VASc score and suggest that this scoring system is modified to incorporate the thromboembolic risk inherent to certain cardiomyopathies irrespective of impairment of left ventricular systolic dysfunction or clinical heart failure.

  16. Design of RF Heat Therapy System Based on DS18B20 and FPGA

    Directory of Open Access Journals (Sweden)

    Liangyu Su

    2014-09-01

    Full Text Available In the process of research and development of this subject, it compares the three major heat physics technology. According to the organizational characteristics of glioma, it uses radiofrequency capacitive heating method. For conventional temperature sensor’s interchangeability and unstable control method faults, it designed an implement RF heat treatment temperature field measure and temperature control system which use high precision digital temperature sensor DS18B20 and programmable logic device FPGA. This system contains temperature setting, temperature display, control algorithm, the FPGA chip configuration, signal power amplifier and the control of DS18B20 function. Finally, this system is used for pork to record the temperature field of heating experiments of center, edge and surface temperature.

  17. Simulated Measurement of the Ds Meson Semileptonic Decay Form Factor with the P¯ANDA Detector

    Science.gov (United States)

    Cao, Lu; Ritman, James; P¯ANDA Collaboration

    2016-04-01

    We simulate the anti-proton and proton interaction to evaluate the P¯ANDA detector performance in the measurement of the semileptonic decay form factor of Ds+ →e+νe η. The kinematics of the neutrino have been reconstructed with a complete simulation model of the detector and reconstruction tools. With theoretical predictions of the cross section, we obtain a preliminary estimate of the expected count rate for the future data taking.

  18. HEaDS-UP Phase IV Assessment: Headgear Effects on Auditory Perception

    Science.gov (United States)

    2015-02-01

    ARL-TR-7203 ● FEB 2015 US Army Research Laboratory HEaDS-UP Phase IV Assessment: Headgear Effects on Auditory Perception...Assessment: Headgear Effects on Auditory Perception by Angelique A Scharine Human Research and Engineering Directorate, ARL...Assessment: Headgear Effects on Auditory Perception 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Angelique A

  19. Simulated Lidar Images of Human Pose using a 3DS Max Virtual Laboratory

    Science.gov (United States)

    2015-12-01

    AFRL-RH-WP-TR-2015-0089 SIMULATED LIDAR IMAGES OF HUMAN POSE USING A 3DS MAX VIRTUAL LABORATORY Jeanne Smith Isiah Davenport Infoscitex Corp...MM-YYYY) 11-12-2015 2. REPORT TYPE Interim 3. DATES COVERED (From - To) March 2013 – April 2015 4. TITLE AND SUBTITLE Simulated LIDAR ...Cleared: 88ABW-2016-0242, 25 January 2016 Report contains color 14. ABSTRACT Large sets of 3D Simulated LIDAR (Light Detection and

  20. Non-Invasive Delivery of dsRNA into De-Waxed Tick Eggs by Electroporation

    Science.gov (United States)

    Ruiz, Newton; de Abreu, Leonardo Araujo; Parizi, Luís Fernando; Kim, Tae Kwon; Mulenga, Albert; Braz, Gloria Regina Cardoso; Vaz, Itabajara da Silva; Logullo, Carlos

    2015-01-01

    RNA interference-mediated gene silencing was shown to be an efficient tool for validation of targets that may become anti-tick vaccine components. Here, we demonstrate the application of this approach in the validation of components of molecular signaling cascades, such as the Protein Kinase B (AKT) / Glycogen Synthase Kinase (GSK) axis during tick embryogenesis. It was shown that heptane and hypochlorite treatment of tick eggs can remove wax, affecting corium integrity and but not embryo development. Evidence of AKT and GSK dsRNA delivery into de-waxed eggs of via electroporation is provided. Primers designed to amplify part of the dsRNA delivered into the electroporated eggs dsRNA confirmed its entry in eggs. In addition, it was shown that electroporation is able to deliver the fluorescent stain, 4',6-diamidino-2-phenylindole (DAPI). To confirm gene silencing, a second set of primers was designed outside the dsRNA sequence of target gene. In this assay, the suppression of AKT and GSK transcripts (approximately 50% reduction in both genes) was demonstrated in 7-day-old eggs. Interestingly, silencing of GSK in 7-day-old eggs caused 25% reduction in hatching. Additionally, the effect of silencing AKT and GSK on embryo energy metabolism was evaluated. As expected, knockdown of AKT, which down regulates GSK, the suppressor of glycogen synthesis, decreased glycogen content in electroporated eggs. These data demonstrate that electroporation of de-waxed R. microplus eggs could be used for gene silencing in tick embryos, and improve the knowledge about arthropod embryogenesis. PMID:26091260

  1. Control of excision frequency of maize transposable element Ds in Petunia protoplasts.

    OpenAIRE

    Becker, D.; Lütticke, R; Li, M; Starlinger, P

    1992-01-01

    The complete coding region of maize transposable element Ac and truncated but active derivatives of it were placed under the control of promoters of different strength and tested for the ability to excise transposable element Ds from a beta-glucuronidase reporter gene in a cotransfection assay in Petunia protoplasts. The highest excision values (5% of the protoplasts able to express the beta-glucuronidase gene in a control experiment) were observed with a truncated version of the Ac coding re...

  2. Successive Interference Cancellation for DS-CDMA Systems with Transmit Diversity

    Directory of Open Access Journals (Sweden)

    Li Wei

    2004-01-01

    Full Text Available We introduce a new successive interference cancellation (SIC technique for direct sequence code division multiple access (DS-CDMA systems with transmit diversity. The transmit diversity is achieved with a space-time block code (STBC. In our work we first consider hard decision SIC with an STBC, and then investigate the performance of soft decision SIC with an STBC. System performance over a Rayleigh fading channel is investigated and the analysis is confirmed by simulation.

  3. EURISOL-DS MULTI-MW TARGET ISSUES: BEAM WINDOW AND TRANSVERSE FILM TARGET

    CERN Document Server

    Adonai Herrera-Martínez, Yacine Kadi

    The analysis of the EURISOL-DS Multi_MW target precise geometry (Fig.1) has proved that large fission yields can be achieved with a 4 MW, providing a technically feasible design to evacuate the power deposited in the liquid mercury. Different designs for the mercury flow have been proposed, which maintain its temperature below the boiling point with moderate flow speeds (maximum 4 m/s).

  4. Non-Invasive Delivery of dsRNA into De-Waxed Tick Eggs by Electroporation.

    Directory of Open Access Journals (Sweden)

    Newton Ruiz

    Full Text Available RNA interference-mediated gene silencing was shown to be an efficient tool for validation of targets that may become anti-tick vaccine components. Here, we demonstrate the application of this approach in the validation of components of molecular signaling cascades, such as the Protein Kinase B (AKT/Glycogen Synthase Kinase (GSK axis during tick embryogenesis. It was shown that heptane and hypochlorite treatment of tick eggs can remove wax, affecting corium integrity and but not embryo development. Evidence of AKT and GSK dsRNA delivery into de-waxed eggs of via electroporation is provided. Primers designed to amplify part of the dsRNA delivered into the electroporated eggs dsRNA confirmed its entry in eggs. In addition, it was shown that electroporation is able to deliver the fluorescent stain, 4',6-diamidino-2-phenylindole (DAPI. To confirm gene silencing, a second set of primers was designed outside the dsRNA sequence of target gene. In this assay, the suppression of AKT and GSK transcripts (approximately 50% reduction in both genes was demonstrated in 7-day-old eggs. Interestingly, silencing of GSK in 7-day-old eggs caused 25% reduction in hatching. Additionally, the effect of silencing AKT and GSK on embryo energy metabolism was evaluated. As expected, knockdown of AKT, which down regulates GSK, the suppressor of glycogen synthesis, decreased glycogen content in electroporated eggs. These data demonstrate that electroporation of de-waxed R. microplus eggs could be used for gene silencing in tick embryos, and improve the knowledge about arthropod embryogenesis.

  5. Design of RF Heat Therapy System Based on DS18B20 and FPGA

    OpenAIRE

    Liangyu Su

    2014-01-01

    In the process of research and development of this subject, it compares the three major heat physics technology. According to the organizational characteristics of glioma, it uses radiofrequency capacitive heating method. For conventional temperature sensor’s interchangeability and unstable control method faults, it designed an implement RF heat treatment temperature field measure and temperature control system which use high precision digital temperature sensor DS18B20 and programmable logic...

  6. Graphical Interface for Measuring and Recording Temperature with the DS18B20 Digital Output Sensor

    OpenAIRE

    Viorel POPA; Elena POPA

    2013-01-01

    The article presents the authors’ two originalgraphical interfaces made in Borland Delphi anddesigned to measure and record (with the DS18B20sensor) a wide range of negative and positivetemperatures. The first interface allows the readingof a sensor’s unique code and then themeasurement and recording of temperature. Thesecond interface can work with a variable numberof such sensors once their unique code has beenentered.The interfaces have been conceived for thestudy of the slow variations of...

  7. Strong lens search in the ESO public Survey KiDS

    NARCIS (Netherlands)

    Napolitano, N. R.; Covone, G.; Roy, N.; Tortora, C.; Barbera, F. La; Radovich, M.; Getman, F.; Capaccioli, M.; Colonna, A.; Paolillo, M.; Kleijn, G. A. Verdoes; Koopmans, L. V. E.; Valentijn, E; Napolitano, Nicola R.; Longo, Giuseppe; Marconi, Marcella; Paolillo, Maurizio; Lodice, Enrichetta

    2015-01-01

    We have started a systematic search for strong lens candidates in the ESO public survey KiDS based on the visual inspection of massive galaxies in the redshift range 0. 1 < z < 0. 5. As a pilot program we have inspected 100 deg2, which overlap with SDSS and where there are known lenses to use as a

  8. Depurador de programas y kit de desarrollo para el microcontrolador DS5000T

    OpenAIRE

    González González, Fabio; Moreno Flores, César; Montalvo Ramírez, Luis

    2007-01-01

    Se presenta la realización de un depurador de programas y un kit de desarrollo para el microcontrolador DS5000T. El conjunto de estas herramientas es capaz de simular, ejecutar en forma controlada y cargar serialmente un programa para dicho microcontrolador mediante la utilización de un computador personal IBM o compatible. El depurador fue desarrollado en forma modular utilizando el lenguaje Assembly del microcontrolador i8086.

  9. Proline Affects Brain Function in 22q11DS Children with the Low Activity COMT158 Allele

    OpenAIRE

    Vorstman, Jacob As; Turetsky, Bruce I.; Sijmens-Morcus, Monique EJ; de Sain, Monique G; Dorland, Bert; Sprong, Mirjam; Rappaport, Eric F.; Beemer, Frits A; Emanuel, Beverly S.; Kahn, René S; van Engeland, Herman; Kemner, Chantal

    2008-01-01

    The association between the 22q11.2 deletion syndrome (22q11DS) and psychiatric disorders, particularly psychosis, suggests a causal relationship between 22q11DS genes and abnormal brain function. The genes catechol-O-methyl-transferase (COMT) and proline dehydrogenase both reside within the commonly deleted region of 22q11.2. COMT activity and proline levels may therefore be altered in 22q11DS individuals. Associations of both COMT158 genotype and elevated serum proline levels with abnormal ...

  10. Increased incidence of anti-dsDNA autoantibody concentration in sera of workers occupationally exposed to diisocyanates.

    Science.gov (United States)

    Czuppon, A B; Marczynski, B; Scheer, E; Hartmann, R; Baur, X

    1993-01-01

    Sera of 87 industrial workers with a history of occupational exposition to various diisocyanates, toluene diisocyanate, hexamethylene diisocyanate and methylene-diphenyl diisocyanate were analyzed for antibodies to isocyanate-conjugated human serum albumin and for anti-dsDNA autoantibodies. Ten workers (approx. 11%) were shown to have elevated anti-dsDNA autoantibody concentrations and 13 revealed antibodies to isocyanate-modified human serum albumin. The overlap of both tests being positive was calculated at about 40%. It would seem, therefore, that routine estimation of anti-dsDNA autoantibodies could provide additional useful information for the clinical diagnosis of occupational health impairment due to isocyanate exposure.

  11. Differential Space-Time Block Code Modulation for DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    Liu Jianhua

    2002-01-01

    Full Text Available A differential space-time block code (DSTBC modulation scheme is used to improve the performance of DS-CDMA systems in fast time-dispersive fading channels. The resulting scheme is referred to as the differential space-time block code modulation for DS-CDMA (DSTBC-CDMA systems. The new modulation and demodulation schemes are especially studied for the down-link transmission of DS-CDMA systems. We present three demodulation schemes, referred to as the differential space-time block code Rake (D-Rake receiver, differential space-time block code deterministic (D-Det receiver, and differential space-time block code deterministic de-prefix (D-Det-DP receiver, respectively. The D-Det receiver exploits the known information of the spreading sequences and their delayed paths deterministically besides the Rake type combination; consequently, it can outperform the D-Rake receiver, which employs the Rake type combination only. The D-Det-DP receiver avoids the effect of intersymbol interference and hence can offer better performance than the D-Det receiver.

  12. Diversity of dsRNA Viruses Infecting Rice Sheath Blight Fungus Rhizoctonia solani AG-1 IA

    Directory of Open Access Journals (Sweden)

    Zheng Li

    2018-01-01

    Full Text Available Rice sheath blight, caused by Rhizoctonia solani (Kühn, is a notorious soil-borne disease prevalent in many rice-growing regions. Although several sporadic studies of mycoviruses in R. solani AG-1 IA have been reported for single strain of R. solani AG-1 IA, there have been no reports describing the distribution and diversity of mycoviruses in natural populations. In this study, 43 R. solani AG-1 IA strains collected from different locations in China were examined for the presence of dsRNA elements to confirm the presence of viral infections. Electrophoretypes showed that 16 of the 43 fungal strains (37.2% contained dsRNAs that can be characterized as viruses. Furthermore, the species-specific reverse transcription PCR (RT-PCR showed dsRNA bands with similar sizes do not always contain the same virus but exist as mixed mycoviral infections. Thus, our findings indicate mycoviruses infecting R. solani AG-1 IA in China are diverse, widespread and universal.

  13. Mechanochemical synthesis of dodecyl sulfate anion (DS-) intercalated Cu-Al layered double hydroxide

    Science.gov (United States)

    Qu, Jun; He, Xiaoman; Lei, Zhiwu; Zhang, Qiwu; Liu, Xinzhong

    2017-12-01

    Dodecyl sulfate anion (DS-) was successfully intercalated into the gallery space of Cu-Al layered double hydroxides (LDH) by a non-heating mechanochemical route, in which basic cupric carbonate (Cu2(OH)2CO3) and aluminum hydroxide (Al(OH)3) were first dry ground and then agitated in SDS solution under ambient environment. The organics modified Cu-Al LDH showed good adsorption ability toward 2,4-dichlorophenoxyacetic acid (2, 4-D). The prepared samples were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), CHS elemental analysis and Scanning electron microscopy (SEM). The LDH precursor prepared by ball-milling could directly react with SDS molecules forming a pure phase of DS- pillared Cu-Al LDH, which was not observed with the LDH product through the ion-exchange of DS- at room temperature. The process introduced here may be applied to manufacture other types of organic modified composites for pollutants removal and other applications.

  14. Smart-DS: Synthetic Models for Advanced, Realistic Testing: Distribution Systems and Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, Venkat K [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Palmintier, Bryan S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hodge, Brian S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hale, Elaine T [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Elgindy, Tarek [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bugbee, Bruce [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Rossol, Michael N [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lopez, Anthony J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Krishnamurthy, Dheepak [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Vergara, Claudio [MIT; Domingo, Carlos Mateo [IIT Comillas; Postigo, Fernando [IIT Comillas; de Cuadra, Fernando [IIT Comillas; Gomez, Tomas [IIT Comillas; Duenas, Pablo [MIT; Luke, Max [MIT; Li, Vivian [MIT; Vinoth, Mohan [GE Grid Solutions; Kadankodu, Sree [GE Grid Solutions

    2017-08-09

    The National Renewable Energy Laboratory (NREL) in collaboration with Massachusetts Institute of Technology (MIT), Universidad Pontificia Comillas (Comillas-IIT, Spain) and GE Grid Solutions, is working on an ARPA-E GRID DATA project, titled Smart-DS, to create: 1) High-quality, realistic, synthetic distribution network models, and 2) Advanced tools for automated scenario generation based on high-resolution weather data and generation growth projections. Through these advancements, the Smart-DS project is envisioned to accelerate the development, testing, and adoption of advanced algorithms, approaches, and technologies for sustainable and resilient electric power systems, especially in the realm of U.S. distribution systems. This talk will present the goals and overall approach of the Smart-DS project, including the process of creating the synthetic distribution datasets using reference network model (RNM) and the comprehensive validation process to ensure network realism, feasibility, and applicability to advanced use cases. The talk will provide demonstrations of early versions of synthetic models, along with the lessons learnt from expert engagements to enhance future iterations. Finally, the scenario generation framework, its development plans, and co-ordination with GRID DATA repository teams to house these datasets for public access will also be discussed.

  15. Design, Implementation, and Evaluation of a Hybrid DS/FFH Spread-Spectrum Radio Transceiver

    Energy Technology Data Exchange (ETDEWEB)

    Olama, Mohammed M [ORNL; Killough, Stephen M [ORNL; Kuruganti, Teja [ORNL; Carroll, Thomas E. [Pacific Northwest National Laboratory (PNNL)

    2014-01-01

    In recent years there has been great interest in using hybrid spread-spectrum (HSS) techniques for commercial applications, particularly in the Smart Grid, in addition to their inherent uses in military communications. This is because HSS can accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this transmission technique for many types of command, control, and sensing applications is the specific code-related combination of standard direct-sequence modulation with "fast" frequency-hopping, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper, we present the efforts carried out at Oak Ridge National Laboratory toward exploring the design, implementation, and evaluation of a hybrid DS/FFH spread-spectrum radio transceiver using a single Field Programmable Gate Array (FPGA). The FPGA allows the various subsystems to quickly communicate with each other and thereby maintain tight synchronization. We also investigate various hopping sequences against robustness to interference and jamming. Experimental results are presented that show the receiver sensitivity, radio data-rate/bit-error evaluations, and jamming and interference rejection capabilities of the implemented hybrid DS/FFH spread-spectrum system under widely varying design parameters.

  16. Investigation of structural transition of dsDNA on various substrates studied by atomic force microscopy.

    Science.gov (United States)

    Nguyen, T H; Kim, Y U; Kim, K J; Choi, S S

    2009-03-01

    Structural transition of single dsDNA molecule which is immobilized on 3-aminopropyltriethoxysilane (APTES) treated substrate (APTES/substrate) or alkylthiol treated substrate (alkylthiol/substrate) has been investigated by atomic force microscopy (AFM). The obtained force versus distance (F-D) curves are used to dissect the transition from B-form to S-form, the melting from double stranded (ds) to single stranded (ss) DNA, and its Young's modulus as well as persistence length. The melt from dsDNA to ssDNA is evidenced by fitting with freely jointed chain (FJC) model. FJC fit and Young's modulus or persistence length values when the molecules are fixed on alkylthiol/substrate are more agreeable with other studies than those on APTES. We have clarified the different results of those experiments by analyzing the binding force between DNA molecules and APTES or alkylthiol linkers on the substrate. The DNA binding to APTES linker is much stronger than that on alkylthiol/substrate.

  17. Research on the lesion segmentation of breast tumor MR images based on FCM-DS theory

    Science.gov (United States)

    Zhang, Liangbin; Ma, Wenjun; Shen, Xing; Li, Yuehua; Zhu, Yuemin; Chen, Li; Zhang, Su

    2017-03-01

    Magnetic resonance imaging (MRI) plays an important role in the treatment of breast tumor by high intensity focused ultrasound (HIFU). The doctors evaluate the scale, distribution and the statement of benign or malignancy of breast tumor by analyzing variety modalities of MRI, such as the T2, DWI and DCE images for making accurate preoperative treatment plan and evaluating the effect of the operation. This paper presents a method of lesion segmentation of breast tumor based on FCM-DS theory. Fuzzy c-means clustering (FCM) algorithm combined with Dempster-Shafer (DS) theory is used to process the uncertainty of information, segmenting the lesion areas on DWI and DCE modalities of MRI and reducing the scale of the uncertain parts. Experiment results show that FCM-DS can fuse the DWI and DCE images to achieve accurate segmentation and display the statement of benign or malignancy of lesion area by Time-Intensity Curve (TIC), which could be beneficial in making preoperative treatment plan and evaluating the effect of the therapy.

  18. West Nile virus envelope protein inhibits dsRNA-induced innate immune responses.

    Science.gov (United States)

    Arjona, Alvaro; Ledizet, Michel; Anthony, Karen; Bonafé, Nathalie; Modis, Yorgo; Town, Terrence; Fikrig, Erol

    2007-12-15

    The immune response against viral infection relies on the early production of cytokines that induce an antiviral state and trigger the activation of immune cells. This response is initiated by the recognition of virus-associated molecular patterns such as dsRNA, a viral replication intermediate recognized by TLR3 and certain RNA helicases. Infection with West Nile virus (WNV) can lead to lethal encephalitis in susceptible individuals and constitutes an emerging health threat. In this study, we report that WNV envelope protein (WNV-E) specifically blocks the production of antiviral and proinflammatory cytokines induced by dsRNA in murine macrophages. This immunosuppressive effect was not dependent on TLR3 or its adaptor molecule Trif. Instead, our experiments show that WNV-E acts at the level of receptor-interacting protein 1. Our results also indicate that WNV-E requires a certain glycosylation pattern, specifically that of dipteran cells, to inhibit dsRNA-induced cytokine production. In conclusion, these data show that the major structural protein of WNV impairs the innate immune response and suggest that WNV exploits differential vector/host E glycosylation profiles to evade antiviral mechanisms.

  19. Ds0⁎±(2317 and KD scattering from Bs0 decay

    Directory of Open Access Journals (Sweden)

    Miguel Albaladejo

    2015-06-01

    Full Text Available We study the B¯s0→Ds−(KD+ weak decay, and look at the KD invariant mass distribution, for which we use recent lattice QCD results for the KD interaction from where the Ds0⁎(2317 resonance appears as a KD bound state. Since there are not yet experimental data on this reaction, in a second step we propose an analysis method to obtain information on the Ds0⁎(2317 resonance from the future experimental KD mass distribution in this decay. For this purpose, we generate synthetic data taking a few points from our theoretical distribution, to which we add a 5% or 10% error. With this analysis method, we prove that one can obtain from these “data” the existence of a bound KD state, the KD scattering length and effective range, and most importantly, the KD probability in the wave function of the bound state obtained, which was found to be largely dominant in lattice QCD studies. This means that one can obtain information on the nature of the Ds0⁎+(2317 resonance from the implementation of this experiment, in the line of finding the structure of resonances, which is one of the main aims in hadron spectroscopy.

  20. Use of geological mapping tools to improve the hydraulic performance of SuDS.

    Science.gov (United States)

    Bockhorn, Britta; Klint, Knud Erik Strøyberg; Jensen, Marina Bergen; Møller, Ingelise

    2015-01-01

    Most cities in Denmark are situated on low permeable clay rich deposits. These sediments are of glacial origin and range among the most heterogeneous, with hydraulic conductivities spanning several orders of magnitude. This heterogeneity has obvious consequences for the sizing of sustainable urban drainage systems (SuDS). We have tested methods to reveal geological heterogeneity at field scale to identify the most suitable sites for the placement of infiltration elements and to minimize their required size. We assessed the geological heterogeneity of a clay till plain in Eastern Jutland, Denmark measuring the shallow subsurface resistivity with a geoelectrical multi-electrode system. To confirm the resistivity data we conducted a spear auger mapping. The exposed sediments ranged from clay tills over sandy clay tills to sandy tills and correspond well to the geoelectrical data. To verify the value of geological information for placement of infiltration elements we carried out a number of infiltration tests on geologically different areas across the field, and we observed infiltration rates two times higher in the sandy till area than in the clay till area, thus demonstrating that the hydraulic performance of SuDS can be increased considerably and oversizing avoided if field geological heterogeneity is revealed before placing SuDS.

  1. dsRNA-induced gene silencing in Moniliophthora perniciosa, the causal agent of witches' broom disease of cacao.

    Science.gov (United States)

    Caribé dos Santos, A C; Sena, J A L; Santos, S C; Dias, C V; Pirovani, C P; Pungartnik, C; Valle, R R; Cascardo, J C M; Vincentz, M

    2009-11-01

    The genome sequence of the hemibiotrophic fungus Moniliophthora perniciosa revealed genes possibly participating in the RNAi machinery. Therefore, studies were performed in order to investigate the efficiency of gene silencing by dsRNA. We showed that the reporter gfp gene stably introduced into the fungus genome can be silenced by transfection of in vitro synthesized gfpdsRNA. In addition, successful dsRNA-induced silencing of endogenous genes coding for hydrophobins and a peroxiredoxin were also achieved. All genes showed a silencing efficiency ranging from 18% to 98% when compared to controls even 28d after dsRNA treatment, suggesting systemic silencing. Reduction of GFP fluorescence, peroxidase activity levels and survival responses to H(2)O(2) were consistent with the reduction of GFP and peroxidase mRNA levels, respectively. dsRNA transformation of M. perniciosa is shown here to efficiently promote genetic knockdown and can thus be used to assess gene function in this pathogen.

  2. Divergent patterns of social cognition performance in autism and 22q11.2 deletion syndrome (22q11DS).

    Science.gov (United States)

    McCabe, Kathryn L; Melville, Jessica L; Rich, Dominique; Strutt, Paul A; Cooper, Gavin; Loughland, Carmel M; Schall, Ulrich; Campbell, Linda E

    2013-08-01

    Individuals with developmental disorders frequently report a range of social cognition deficits including difficulties identifying facial displays of emotion. This study examined the specificity of face emotion processing deficits in adolescents with either autism or 22q11DS compared to typically developing (TD) controls. Two tasks (face emotion recognition and weather scene recognition) were used to explore group differences in visual scanpath strategy and concurrent recognition accuracy. For faces, the autism and 22q11DS groups demonstrated lower emotion recognition accuracy and fewer fixations compared to the TD group. Individuals with autism demonstrated fewer fixations to some weather scene stimuli compared to 22q11DS and TD groups, yet achieved a level of recognition accuracy comparable to the TD group. These findings provide evidence for a divergent pattern of social cognition dysfunction in autism and 22q11DS.

  3. Adjuvants and the vaccine response to the DS-Cav1-stabilized fusion glycoprotein of respiratory syncytial virus

    Science.gov (United States)

    Chen, Man; Joyce, M. Gordon; Kong, Wing-Pui; Chuang, Gwo-Yu; Ko, Kiyoon; Kumar, Azad; Silacci, Chiara; Thom, Michelle; Salazar, Andres M.; Corti, Davide; Lanzavecchia, Antonio; Taylor, Geraldine; Mascola, John R.; Graham, Barney S.

    2017-01-01

    Appropriate adjuvant selection may be essential to optimize the potency and to tailor the immune response of subunit vaccines. To induce protective responses against respiratory syncytial virus (RSV)—a highly prevalent childhood pathogen without a licensed vaccine—we previously engineered a pre-fusion-stabilized trimeric RSV F (pre-F) “DS-Cav1” immunogen, which induced high titer RSV-neutralizing antibodies, in mice and non-human primates, when formulated with adjuvants Poly (I:C) and Poly (IC:LC), respectively. To assess the impact of different adjuvants, here we formulated RSV F DS-Cav1 with multiple adjuvants and assessed immune responses. Very high RSV-neutralizing antibody responses (19,006 EC50) were observed in naïve mice immunized with 2 doses of DS-Cav1 adjuvanted with Sigma adjuvant system (SAS), an oil-in-water adjuvant, plus Carbopol; high responses (3658–7108) were observed with DS-Cav1 adjuvanted with Alum, SAS alone, Adjuplex, Poly (I:C) and Poly (IC:LC); and moderate responses (1251–2129) were observed with DS-Cav1 adjuvanted with the TLR4 agonist MPLA, Alum plus MPLA or AddaVax. In contrast, DS-Cav1 without adjuvant induced low-level responses (6). A balanced IgG1 and IgG2a (Th2/Th1) immune response was elicited in most of the high to very high response groups (all but Alum and Adjuplex). We also tested the immune response induced by DS-Cav1 in elderly mice with pre-existing DS-Cav1 immunity; we observed that DS-Cav1 adjuvanted with SAS plus Carbopol boosted the response 2-3-fold, whereas DS-Cav1 adjuvanted with alum boosted the response 5-fold. Finally, we tested whether a mixture of ISA 71 VG and Carbopol would enhanced the antibody response in DS-Cav1 immunized calves. While pre-F-stabilized bovine RSV F induced very high titers in mice when adjuvanted with SAS plus Carbopol, the addition of Carbopol to ISA 71 VG did not enhance immune responses in calves. The vaccine response to pre-F-stabilized RSV F is augmented by adjuvant, but

  4. Adjuvants and the vaccine response to the DS-Cav1-stabilized fusion glycoprotein of respiratory syncytial virus.

    Directory of Open Access Journals (Sweden)

    Mallika Sastry

    Full Text Available Appropriate adjuvant selection may be essential to optimize the potency and to tailor the immune response of subunit vaccines. To induce protective responses against respiratory syncytial virus (RSV-a highly prevalent childhood pathogen without a licensed vaccine-we previously engineered a pre-fusion-stabilized trimeric RSV F (pre-F "DS-Cav1" immunogen, which induced high titer RSV-neutralizing antibodies, in mice and non-human primates, when formulated with adjuvants Poly (I:C and Poly (IC:LC, respectively. To assess the impact of different adjuvants, here we formulated RSV F DS-Cav1 with multiple adjuvants and assessed immune responses. Very high RSV-neutralizing antibody responses (19,006 EC50 were observed in naïve mice immunized with 2 doses of DS-Cav1 adjuvanted with Sigma adjuvant system (SAS, an oil-in-water adjuvant, plus Carbopol; high responses (3658-7108 were observed with DS-Cav1 adjuvanted with Alum, SAS alone, Adjuplex, Poly (I:C and Poly (IC:LC; and moderate responses (1251-2129 were observed with DS-Cav1 adjuvanted with the TLR4 agonist MPLA, Alum plus MPLA or AddaVax. In contrast, DS-Cav1 without adjuvant induced low-level responses (6. A balanced IgG1 and IgG2a (Th2/Th1 immune response was elicited in most of the high to very high response groups (all but Alum and Adjuplex. We also tested the immune response induced by DS-Cav1 in elderly mice with pre-existing DS-Cav1 immunity; we observed that DS-Cav1 adjuvanted with SAS plus Carbopol boosted the response 2-3-fold, whereas DS-Cav1 adjuvanted with alum boosted the response 5-fold. Finally, we tested whether a mixture of ISA 71 VG and Carbopol would enhanced the antibody response in DS-Cav1 immunized calves. While pre-F-stabilized bovine RSV F induced very high titers in mice when adjuvanted with SAS plus Carbopol, the addition of Carbopol to ISA 71 VG did not enhance immune responses in calves. The vaccine response to pre-F-stabilized RSV F is augmented by adjuvant, but the

  5. Noncytotoxic orange and red/green derivatives of DsRed-Express2 for whole-cell labeling

    OpenAIRE

    Glick Benjamin S; Bhattacharyya Dibyendu; Strack Rita L; Keenan Robert J

    2009-01-01

    Abstract Background Whole-cell labeling is a common application of fluorescent proteins (FPs), but many red and orange FPs exhibit cytotoxicity that limits their use as whole-cell labels. Recently, a tetrameric red FP called DsRed-Express2 was engineered for enhanced solubility and was shown to be noncytotoxic in bacterial and mammalian cells. Our goal was to create derivatives of this protein with different spectral properties. Results Building on previous studies of DsRed mutants, we create...

  6. Knocking-down Meloidogyne incognita proteases by plant-delivered dsRNA has negative pleiotropic effect on nematode vigor.

    Science.gov (United States)

    Antonino de Souza Júnior, José Dijair; Ramos Coelho, Roberta; Tristan Lourenço, Isabela; da Rocha Fragoso, Rodrigo; Barbosa Viana, Antonio Américo; Lima Pepino de Macedo, Leonardo; Mattar da Silva, Maria Cristina; Gomes Carneiro, Regina Maria; Engler, Gilbert; de Almeida-Engler, Janice; Grossi-de-Sa, Maria Fatima

    2013-01-01

    The root-knot nematode Meloidogyne incognita causes serious damage and yield losses in numerous important crops worldwide. Analysis of the M. incognita genome revealed a vast number of proteases belonging to five different catalytic classes. Several reports indicate that M. incognita proteases could play important roles in nematode parasitism, besides their function in ordinary digestion of giant cell contents for feeding. The precise roles of these proteins during parasitism however are still unknown, making them interesting targets for gene silencing to address protein function. In this study we have knocked-down an aspartic (Mi-asp-1), a serine (Mi-ser-1) and a cysteine protease (Mi-cpl-1) by RNAi interference to get an insight into the function of these enzymes during a host/nematode interaction. Tobacco lines expressing dsRNA for Mi-ser-1 (dsSER), Mi-cpl-1 (dsCPL) and for the three genes together (dsFusion) were generated. Histological analysis of galls did not show clear differences in giant cell morphology. Interestingly, nematodes that infected plants expressing dsRNA for proteases produced a reduced number of eggs. In addition, nematode progeny matured in dsSER plants had reduced success in egg hatching, while progeny resulting from dsCPL and dsFusion plants were less successful to infect wild-type host plants. Quantitative PCR analysis confirmed a reduction in transcripts for Mi-cpl-1 and Mi-ser-1 proteases. Our results indicate that these proteases are possibly involved in different processes throughout nematode development, like nutrition, reproduction and embryogenesis. A better understanding of nematode proteases and their possible role during a plant-nematode interaction might help to develop new tools for phytonematode control.

  7. Enhancing the Economic Value of Large Investments in Sustainable Drainage Systems (SuDS through Inclusion of Ecosystems Services Benefits

    Directory of Open Access Journals (Sweden)

    Santiago Urrestarazu Vincent

    2017-10-01

    Full Text Available Although Sustainable Drainage Systems (SuDS are used in cities across the world as effective flood adaptation responses, their economic viability has frequently been questioned. Inclusion of the monetary value of ecosystem services (ES provided by SuDS can increase the rate of return on investments made. Hence, this paper aims at reviewing the enhancement of the economic value of large-scale investments in SuDS through inclusion of ecosystem services. This study focuses on the flood reduction capacity and the ES benefits of green roofs and rain barrels in the combined sewerage network of Montevideo Municipality in Uruguay. The methodology comprises a cost–benefit analysis—with and without monetised ES provided by SuDS—of two drainage network configurations comprising: (i SuDS; and (ii SuDS and detention storage. The optimal drainage design for both these drainage configurations have been determined using SWMM-EA, a tool which uses multi-objective optimisation based evolutionary algorithm (EA and the storm water management model (SWMM. In both design configurations, total benefits comprising both flood reduction and ES benefits are always higher than their costs. The use of storage along with SuDS provides greater benefits with a larger reduction in flooding, and thus is more cost-effective than using SuDS alone. The results show that, for both of the drainage configurations, the larger investments are not beneficial unless ES benefits are taken into account. Hence, it can be concluded that the inclusion of ES benefits is necessary to justify large-scale investments in SuDS.

  8. Usefulness of the CHA2DS2-VASC Score to Predict Adverse Outcomes in Patients Having Percutaneous Coronary Intervention.

    Science.gov (United States)

    Orvin, Katia; Bental, Tamir; Assali, Abid; Lev, Eli Israel; Vaknin-Assa, Hana; Kornowski, Ran

    2016-05-01

    The application of the CHA2DS2-VASC score as a novel risk stratification tool for predicting outcome in clinical applications other than atrial fibrillation and stroke prevention has been previously examined. However, its usefulness in a population of patients with coronary artery disease after percutaneous coronary intervention (PCI) has not been explored. We investigated 12,785 consecutive patients who underwent PCI in a tertiary medical center from April 2004 to August 2014 (mean follow-up 6.5 years) and computed the CHA2DS2-VASC score on their index PCI. We assessed the relation between the CHA2DS2-VASC score and clinical outcomes (for example, all-cause mortality and mortality or myocardial infarction) at 1 and 5 years. The mean CHA2DS2-VASC score was 3.7 ± 1.7, 59.1% of patients obtained a score of 3 to 5. Both the primary and secondary outcomes at 1 and 5 years were significantly more frequent as the CHA2DS2-VASC score increased. Overall, the mortality rate after PCI was 10 times higher for patients with a CHA2DS2-VASC score of 5 compared with a score of 1 at both 1-and 5-year follow-up. The CHA2DS2-VASC score predicted all-cause mortality and death or nonfatal myocardial infarction in a significant (p <0.001, C-index 0.73 and 0.72) and linear fashion. In conclusion, the CHA2DS2-VASC score can be used as a simple and effective tool to predict long-term clinical outcomes in patients undergoing PCI. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Quelle préposition ?

    CERN Document Server

    Grevisse, Maurice

    1996-01-01

    Pour bien parler ou bien écrire, il faut avant tout posséder un bon vocabulaire, puis savoir bien remuer les mots, leur faire exprimer quelque chose et agencer adroitement les propositions. Il faut aussi - et cela n'est pas négligeable - amener congrûment les divers compléments des noms, des adjectifs ou des verbes ; quand ces compléments sont de construction indirecte, c'est-à-dire quand ils doivent être introduits par une préposition, on hésite parfois sur la bonne manière de les accrocher. Ne pas négliger le bon choix! Cela ne crée pas le style, sans doute, mais peut, pour une part, témoigner de sa bonne qualité.

  10. In vitro digestibility of specific dsRNA by enzymes of digestive tract of shrimp Litopenaeus vannamei

    Directory of Open Access Journals (Sweden)

    Ana R Álvarez-Sánchez

    2017-05-01

    Full Text Available Objective. The digestibility of specific dsRNA by action of the enzymes of digestive tract of the whiteleg shrimp Litopenaeus vannamei was determined in vitro. Materials and methods. Digestive enzyme activity (amylase, lipase, protease, DNase and RNase was measured in the stomach, digestive gland, and anterior, middle, and posterior intestine of juvenile shrimp, and the digestibility of DNA, RNA and the dsRNA-ORF89, specific to WSSV, was determined by in vitro assays, as well as electrophoretic and densitometric analyses. Results. The highest enzymatic activity was found in the digestive gland: amylase (81.41%, lipase (92.60%, protease (78.20%, DNase (90.85%, and RNase (93.14%. The highest digestive capacity against DNA, RNA, and dsRNA was found in the digestive gland (5.11 ng of DNA per minute, 8.55 ng of RNA per minute, and 1.48 ng dsRNA per minute. Conclusions. The highest digestibility of dsRNA-ORF89, specific to WSSV, was found in the digestive gland, whereas the lowest digestibility was observed in the posterior intestine. This is the first report regarding the digestibility of dsRNA-ORF89 by whiteleg shrimp digestive tract enzymes, with potential therapeutic importance in shrimp culture to prevent WSSV disease through balanced feed.

  11. First observation of $\\overline{B}^{0}_{s} \\to D^{*+}_{s2}X\\mu^{-}\\overline{\

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Agari, M; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Amoraal, J; Anderson, J; Antunes Nobrega, R; Appleby, R B; Aquines Gutierrez, O; Arefyev, A; Arrabito, L; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Basiladze, S; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belous, K; Belyaev, I; Benayoun, M; Bencivenni, G; Bernet, R; Bettler, M-O; van Beuzekom, M; Bifani, S; Bizzeti, A; Björnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bos, E; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Cameron, W; Camilleri, L; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Cheng, J; Chiapolini, N; Chlopik, A; Christiansen, J; Ciambrone, P; Cid Vidal, X; Clark, P J; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Constantin, F; Conti, G; Contu, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; D'Antone, I; Da Silva, W; Dané, E; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Dima, M; Donleavy, S; Dornan, P; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Eklund, L; d'Enterria, D G; Esperante Pereira, D; Estève, L; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Flegel, W; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Fungueirino Pazos, J L; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garrido, L; Gaspar, C; Gassner, J; Gauvin, N; Gavillet, P; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Haefeli, G; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, P F; He, J; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hilke, H J; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Iakovenko, V; Iglesias Escudero, C; Ilgner, C; Ilten, P; Imong, J; Jacobsson, R; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kapusta, F; Karbach, T M; Kashchuk, A; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Konoplyannikov, A; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, R W; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lehner, F; Leroy, O; Lesiak, T; Li, L; Li, Y Y; Li Gioi, L; Libby, J; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Löchner, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; M'charek, B; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maier, A; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martin Sanchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Matveev, V; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Merkin, M; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Morris, J V; Moscicki, J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Murtas, F; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nawrot, A; Nedos, M; Needham, M; Neufeld, N; Neustroev, P; Nicol, M; Nies, S; Niess, V; Nikitin, N; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Pal, B; Palacios, J; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pauna, E; Pauna, C; Pavel, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Pessina, G; Petrella, A; Petrolini, A; Pie Valls, B; Pietrzyk, B; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Pozzi, S; du Pree, T; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Raniuk, I; Raven, G; Redford, S; Reece, W; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Cobo, C; Rodriguez Perez, P; Rogers, G J; Romanovsky, V; Rouvinet, J; Ruf, T; Ruiz, H; Rusinov, V; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sambade Varela, A; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schune, M -H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Serra, N; Serrano, J; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Simioni, E; Skottowe, H P; Skwarnicki, T; Smale, N; Smith, A; Smith, A C; Sobczak, K; Soler, F J P; Solomin, A; Somogy, P; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spiridenkov, E; Spradlin, P; Srednicki, A; Stagni, F; Steiner, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straumann, U; Styles, N; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Talanov, V; Tarkovskiy, E; Teodorescu, E; Terrier, H; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M T; Traynor, S; Trunk, U; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Vorobyev, An; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Ybeles Smit, G; Young, R; Yushchenko, O; Zavertyaev, M; Zeng, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E

    2011-01-01

    Using data collected with the LHCb detector in proton-proton collisions at a centre-of-mass energy of 7 TeV, the semileptonic decays Bs -> Ds+ X mu nu and Bs -> D0 K+ X mu nu are detected. Two structures are observed in the D0 K+ mass spectrum at masses consistent with the known D^+_{s1}(2536) and $D^{*+}_{s2}(2573) mesons. The measured branching fractions relative to the total Bs semileptonic rate are B(Bs -> D_{s2}^{*+} X mu nu)/B(Bs -> X mu nu)= (3.3\\pm 1.0\\pm 0.4)%, and B(Bs -> D_{s1}^+ X munu)/B(Bs -> X mu nu)= (5.4\\pm 1.2\\pm 0.5)%, where the first uncertainty is statistical and the second is systematic. This is the first observation of the D_{s2}^{*+} state in Bs decays; we also measure its mass and width.

  12. Visualizing double-stranded RNA distribution and dynamics in living cells by dsRNA binding-dependent fluorescence complementation.

    Science.gov (United States)

    Cheng, Xiaofei; Deng, Ping; Cui, Hongguang; Wang, Aiming

    2015-11-01

    Double-stranded RNA (dsRNA) is an important type of RNA that plays essential roles in diverse cellular processes in eukaryotic organisms and a hallmark in infections by positive-sense RNA viruses. Currently, no in vivo technology has been developed for visualizing dsRNA in living cells. Here, we report a dsRNA binding-dependent fluorescence complementation (dRBFC) assay that can be used to efficiently monitor dsRNA distribution and dynamics in vivo. The system consists of two dsRNA-binding proteins, which are fused to the N- and C-terminal halves of the yellow fluorescent protein (YFP). Binding of the two fusion proteins to a common dsRNA brings the split YFP halves in close proximity, leading to the reconstitution of the fluorescence-competent structure and restoration of fluorescence. Using this technique, we were able to visualize the distribution and trafficking of the replicative RNA intermediates of positive-sense RNA viruses in living cells. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  13. ESO PR Highlights in 2003

    Science.gov (United States)

    2004-01-01

    Among the many astronomical highlights of 2003, the Transit of Mercury certainly attracted great attention as shown by the record number of hits the ESO web page received on that day. But this was a mere rehearsal of an even bigger event we will enjoy in 2004: the Venus Transit. ESO, in partnership with several institutions, is organising a major educational event in connection with it. During 2003, the ESO Educational Office was also involved in various other programmes. They included the web-based "Catch a Star!" and the "Physics and Life" projects, organised with EC sponsorship in connection with the 2003 European Science and Technology Week. The ALMA project, an European-North American collaboration to build an array of 64 12-m submillimetre antennas, moved forward with the signature of the agreement between ESO and the NSF and with the Ground-breaking at Chajnantor. Conceptual studies of a 100-m optical/infrared telescope (OWL) also proceeded well. Several new instruments were installed at ESO telescopes, e.g. HARPS . And the VLT Interferometer (VLTI) received a powerful Adaptive Optics System and made the first detection through infrared interferometry of an extragalactic object. A rapidly increasing number of new scientific results were obtained on the basis of data from ESO telescopes, some of which were highlighted in ESO Press Releases. A number of beautiful images were published. Many of these developments are described in ESO's Press Releases, most with Press Photos, cf. the 2003 PR Index. Some of last year's ESO PR highlights may be accessed directly via the clickable image above.

  14. Full Genome Characterization of Novel DS-1-Like G8P[8] Rotavirus Strains that Have Emerged in Thailand: Reassortment of Bovine and Human Rotavirus Gene Segments in Emerging DS-1-Like Intergenogroup Reassortant Strains.

    Directory of Open Access Journals (Sweden)

    Ratana Tacharoenmuang

    Full Text Available The emergence and rapid spread of unusual DS-1-like intergenogroup reassortant rotavirus strains have been recently reported in Asia, Australia, and Europe. During rotavirus surveillance in Thailand in 2013-2014, novel DS-1-like intergenogroup reassortant strains having G8P[8] genotypes (i.e., strains KKL-17, PCB-79, PCB-84, PCB-85, PCB-103, SKT-107, SWL-12, NP-130, PCB-656, SKT-457, SSKT-269, and SSL-55 were identified in stool samples from hospitalized children with severe diarrhea. In this study, we determined and characterized the complete genomes of these 12 strains (seven strains, KKL-17, PCB-79, PCB-84, PCB-85, PCB-103, SKT-107, and SWL-12, found in 2013 (2013 strains, and five, NP-130, PCB-656, SKT-457, SSKT-269, and SSL-55, in 2014 (2014 strains. On full genomic analysis, all 12 strains showed a unique genotype constellation comprising a mixture of genogroup 1 and 2 genes: G8-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2. With the exception of the G genotype, the unique genotype constellation of the 12 strains (P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 was found to be shared with DS-1-like intergenogroup reassortant strains. On phylogenetic analysis, six of the 11 genes of the 2013 strains (VP4, VP2, VP3, NSP1, NSP3, and NSP5 appeared to have originated from DS-1-like intergenogroup reassortant strains, while the remaining four (VP7, VP6, VP1, and NSP2 and one (NSP4 gene appeared to be of bovine and human origin, respectively. Thus, the 2013 strains appeared to be reassortant strains as to DS-1-like intergenogroup reassortant, bovine, bovine-like human, and/or human rotaviruses. On the other hand, five of the 11 genes of the 2014 strains (VP4, VP2, VP3, NSP1, and NSP3 appeared to have originated from DS-1-like intergenogroup reassortant strains, while three (VP7, VP1, and NSP2 and one (NSP4 were assumed to be of bovine and human origin, respectively. Notably, the remaining two genes, VP6 and NSP5, of the 2014 strains appeared to have originated from locally

  15. The AGAAAAGA palindrome in PrP is required to generate a productive PrPSc-PrPC complex that leads to prion propagation.

    Science.gov (United States)

    Norstrom, Eric M; Mastrianni, James A

    2005-07-22

    The molecular hallmark of prion disease is the conversion of normal prion protein (PrPC) to an insoluble, proteinase K-resistant, pathogenic isoform (PrPSc). Once generated, PrPSc propagates by complexing with, and transferring its pathogenic conformation onto, PrPC. Defining the specific nature of this PrPSc-PrPC interaction is critical to understanding prion genesis. To begin to approach this question, we employed a prion-infected neuroblastoma cell line (ScN2a) combined with a heterologous yeast expression system to independently model PrPSc generation and propagation. We additionally applied fluorescence resonance energy transfer analysis to the latter to specifically study PrP-PrP interactions. In this report we focus on an N-terminal hydrophobic palindrome of PrP (112-AGAAAAGA-119) thought to feature intimately in prion generation via an unclear mechanism. We found that, in contrast to wild type (wt) PrP, PrP lacking the palindrome (PrPDelta112-119) neither converted to PrPSc when expressed in ScN2a cells nor generated proteinase K-resistant PrP when expressed in yeast. Furthermore, PrPDelta112-119 was a dominant-negative inhibitor of wtPrP in ScN2a cells. Both wtPrP and PrPDelta112-119 were highly insoluble when expressed in yeast and produced distinct cytosolic aggregates when expressed as fluorescent fusion proteins (PrP::YFP). Although self-aggregation was evident, fluorescence resonance energy transfer studies in live yeast co-expressing PrPSc-like protein and PrPDelta112-119 indicated altered interaction properties. These results suggest that the palindrome is required, not only for the attainment of the PrPSc conformation but also to facilitate the proper association of PrPSc with PrPC to effect prion propagation.

  16. Calretinin-Immunoreactive Hypoinnervation in Down Syndrome (DS): Report of an Infant with Very Short-Segment Hirschsprung Disease and Comparison to Biopsy Findings in 20 Normal Infants and 11 Infants with DS and Chronic Constipation.

    Science.gov (United States)

    Warren, Mikako; Kaul, Ajay; Bove, Kevin E

    2016-01-01

    In Down syndrome (DS) constipation is common, and the incidence of Hirschsprung disease (HD) is 1-2%. Rectal suction biopsies (RSBs) in DS may show discordant features; calretinin immunoreactivity (CRir) often helps resolve discrepancies. We report a case of unequivocal very short-segment HD (vsHD) in an infant with DS who had aganglionosis with abnormal acetylcholine esterase (AChE) activity in 3 RSBs. The CRir patterns were scanty positive rather than the expected absent CRir innervation in the lamina propria (LP). The resection specimen was grossly typical for short-segment HD, with a 5.5-cm, narrow but normally ganglionated segment proximal to the verified very short distal anganglionic zone. Unequivocal calretinin hypoinnervation was limited to the distal 2 cm, substantiating the warning of Kapur that small numbers of CRir nerves in the LP do not exclude a diagnosis of vsHD. We evaluated RSBs from 11 DS and 20 randomly selected normal infants <6 months of age with chronic constipation. The normal infants had abundant mucosal calretinin innervation and AChE histochemistry. We observed variable CRir hypoinnervation in RSBs in DS infants (including 6/7 with "normal" original diagnosis and 1/4 with HD). Our findings caution against overdependence on "normal" calretinin immunohistochemistry and suggest that AChE may be more reliable than CRir in the context of DS. An unknown number of patients with DS may have enteric nervous system disorders functionally similar to HD, which are possibly related to abnormal or imbalanced autonomic innervation, of which distal calretinin hypoinnervation is one manifestation, despite the presence of ganglia.

  17. An Ac/Ds-mediated gene trap system for functional genomics in barley

    Directory of Open Access Journals (Sweden)

    Lazarow Katina

    2009-01-01

    Full Text Available Abstract Background Gene trapping is a powerful tool for gene discovery and functional genomics in both animals and plants. Upon insertion of the gene trap construct into an expressed gene, splice donor and acceptor sites facilitate the generation of transcriptional fusions between the flanking sequence and the reporter. Consequently, detection of reporter gene expression allows the identification of genes based on their expression pattern. Up to now rice is the only cereal crop for which gene trap approaches exist. In this study we describe a gene trap system in barley (Hordeum vulgare L. based on the maize transposable elements Ac/Ds. Results We generated gene trap barley lines by crossing Ac transposase expressing plants with multiple independent transformants carrying the Ds based gene trap construct GTDsB. Upstream of the β-Glucuronidase start codon GTDsB carries splice donor and acceptor sites optimized for monocotyledonous plants. DNA blot analysis revealed GTDsB transposition frequencies of 11% and 26% in the F1 and F2 generation of gene trap lines and perpetuation of transposition activity in later generations. Furthermore, analysis of sequences flanking transposed GTDsB elements evidenced preferential insertion into expressed regions of the barley genome. We screened leaves, nodes, immature florets, pollinated florets, immature grains and seedlings of F2 plants and detected GUS expression in 51% (72/141 of the plants. Thus, reporter gene expression was found in 24 of the 28 F1 lines tested and in progeny of all GTDsB parental lines. Conclusion Due to the frequent transposition of GTDsB and the efficient expression of the GUS reporter gene, we conclude that this Ac/Ds-based gene trap system is an applicable approach for gene discovery in barley. The successful introduction of a gene trap construct optimized for monocots in barley contributes a novel functional genomics tool for this cereal crop.

  18. Searching dark-matter halos in the GaBoDS survey

    Science.gov (United States)

    Maturi, M.; Schirmer, M.; Meneghetti, M.; Bartelmann, M.; Moscardini, L.

    2007-02-01

    Context: We apply the linear filter for the weak-lensing signal of dark-matter halos developed in Maturi et al. (2005, A&A, 442, 851) to the cosmic-shear data extracted from the Garching-Bonn-Deep-Survey (GaBoDS). Aims: We wish to search for dark-matter halos through weak-lensing signatures which are significantly above the random and systematic noise level caused by intervening large-scale structures. Methods: We employ a linear matched filter which maximises the signal-to-noise ratio by minimising the number of spurious detections caused by the superposition of large-scale structures (LSS). This is achieved by suppressing those spatial frequencies dominated by the LSS contamination. Results: We confirm the improved stability and reliability of the detections achieved with our new filter compared to the commonly-used aperture mass (Schneider 1996, MNRAS, 283, 837; Schneider et al. 1998, MNRAS, 296, 873) and to the aperture mass based on the shear profile expected for NFW haloes (see e.g. Schirmer et al. 2004, A&A, 420, 75; Hennawi & Spergel 2005, ApJ, 624, 59). Schirmer et al. (2006, [arXiv:astro-ph/0607022]) achieved results comparable to our filter, but probably only because of the low average redshift of the background sources in GaBoDS, which keeps the LSS contamination low. For deeper data, the difference will be more important, as shown by Maturi et al. (2005). Conclusions: .We detect fourteen halos on about eighteen square degrees selected from the survey. Five are known clusters, two are associated with over-densities of galaxies visible in the GaBoDS image, and seven have no known optical or X-ray counterparts.

  19. Initiation of RNA Polymerization and Polymerase Encapsidation by a Small dsRNA Virus.

    Directory of Open Access Journals (Sweden)

    Aaron M Collier

    2016-04-01

    Full Text Available During the replication cycle of double-stranded (ds RNA viruses, the viral RNA-dependent RNA polymerase (RdRP replicates and transcribes the viral genome from within the viral capsid. How the RdRP molecules are packaged within the virion and how they function within the confines of an intact capsid are intriguing questions with answers that most likely vary across the different dsRNA virus families. In this study, we have determined a 2.4 Å resolution structure of an RdRP from the human picobirnavirus (hPBV. In addition to the conserved polymerase fold, the hPBV RdRP possesses a highly flexible 24 amino acid loop structure located near the C-terminus of the protein that is inserted into its active site. In vitro RNA polymerization assays and site-directed mutagenesis showed that: (1 the hPBV RdRP is fully active using both ssRNA and dsRNA templates; (2 the insertion loop likely functions as an assembly platform for the priming nucleotide to allow de novo initiation; (3 RNA transcription by the hPBV RdRP proceeds in a semi-conservative manner; and (4 the preference of virus-specific RNA during transcription is dictated by the lower melting temperature associated with the terminal sequences. Co-expression of the hPBV RdRP and the capsid protein (CP indicated that, under the conditions used, the RdRP could not be incorporated into the recombinant capsids in the absence of the viral genome. Additionally, the hPBV RdRP exhibited higher affinity towards the conserved 5'-terminal sequence of the viral RNA, suggesting that the RdRP molecules may be encapsidated through their specific binding to the viral RNAs during assembly.

  20. Computationally Efficient Blind Code Synchronization for Asynchronous DS-CDMA Systems with Adaptive Antenna Arrays

    Directory of Open Access Journals (Sweden)

    Chia-Chang Hu

    2005-04-01

    Full Text Available A novel space-time adaptive near-far robust code-synchronization array detector for asynchronous DS-CDMA systems is developed in this paper. There are the same basic requirements that are needed by the conventional matched filter of an asynchronous DS-CDMA system. For the real-time applicability, a computationally efficient architecture of the proposed detector is developed that is based on the concept of the multistage Wiener filter (MWF of Goldstein and Reed. This multistage technique results in a self-synchronizing detection criterion that requires no inversion or eigendecomposition of a covariance matrix. As a consequence, this detector achieves a complexity that is only a linear function of the size of antenna array (J, the rank of the MWF (M, the system processing gain (N, and the number of samples in a chip interval (S, that is, 𝒪(JMNS. The complexity of the equivalent detector based on the minimum mean-squared error (MMSE or the subspace-based eigenstructure analysis is a function of 𝒪((JNS3. Moreover, this multistage scheme provides a rapid adaptive convergence under limited observation-data support. Simulations are conducted to evaluate the performance and convergence behavior of the proposed detector with the size of the J-element antenna array, the amount of the L-sample support, and the rank of the M-stage MWF. The performance advantage of the proposed detector over other DS-CDMA detectors is investigated as well.

  1. Data Analysis Details (DS) - Metabolonote | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us Metabol...information). Data file File name: metabolonote_data_analysis_details.zip File URL: ftp://ftp.biosciencedbc.jp/archive/metabol...onote/LATEST/metabolonote_data_analysis_details.zip File size: 67 KB Simple search URL htt...p://togodb.biosciencedbc.jp/togodb/view/metabolonote_data_analysis_details#en Dat...nse Update History of This Database Site Policy | Contact Us Data Analysis Details (DS) - Metabolonote | LSDB Archive ...

  2. Gamma measurements in Bs->DsK and other tree-level decays

    CERN Multimedia

    CERN. Geneva

    2014-01-01

    The angle gamma is the least constrained parameter in the CKM unitarity triangle. Its determination in decays induced by tree-level b -> u transitions is largely unaffected by potential new physics contributions. This allows for a consistency check of the unitarity triangle, but also of comparisons with gamma determinations from modes with loop-diagrams. We present here a new precise determination of gamma using a time-dependent flavour-tagged analysis of Bs -> Ds K decays with the LHCb experiment. New developments in flavour tagging are presented.

  3. LHCb Sensitivity to $\\gamma$ with $B_s \\to D_s K$

    CERN Document Server

    Rodrigues, E

    2004-01-01

    The decay channels $B_s^0 \\to D_s^{\\pm}K ^{\\mp}$ and $B_s^0 \\to D_s^- \\pi^+$ can be used to extract the CKM-matrix $\\gamma$ angle, a parameter of the Standard Model not yet directly measured. The strategy of the LHCb experiment for such a measurement is described. We also outline the event selection criteria, the expected annual yields and background-over-signal $B/S$ ratii, and the expected precision on the CKM $\\gamma$ measurement.

  4. 89. Estudio multicéntrico español de la capacidad predictiva de las escalas de riesgo CHADS2 y CHA2DS2vasc en el accidente cerebrovascular tras cirugía coronaria aislada

    Directory of Open Access Journals (Sweden)

    E. Martín

    2012-04-01

    Resultados: Veinte mil novecientos ochenta pacientes incluidos, 282 desarrollaron ACV postoperatorio (1,34%. La incidencia de ACV fue superior en pacientes con insuficiencia cardíaca congestiva (ICC y/o fracción de eyección inferior al 40% (4,10 vs 0,83%, diabéticos (1,70 vs 1,11%, hipertensos (1,60 vs 0,98%, ACV previo (2,72 vs 1,26% y a enfermedad arterial periférica (EAP (3,04 vs 1,04%; p < 0,05. En el análisis multivariante, ICCC (odds ratio [OR]: 4,06, ACV previo (OR: 1,48, EAP (OR: 1,49 constituyeron factores de riesgo independientes para el desarrollo de ACV postoperatorio (p < 0,05. El AUC para CHADS2 fue 0,666, y para CHA2DS2VASc 0,655 (p < 0,0001. La distribución de las tasas de ACV postoperatorio según las puntuaciones de las anteriores escalas se recoge en la figura 1 (p < 0,0001. Conclusiones: Las escalas de riesgo CHADS2 y CHA2DS-2VASC pueden resultar útiles en la práctica clínica para estratificar el riesgo de desarrollo de ACV postoperatorio en pacientes sometidos a CCA.

  5. Impact of chromatin structure on PR signaling

    DEFF Research Database (Denmark)

    Grøntved, Lars; Hager, Gordon L

    2012-01-01

    The progesterone receptor (PR) interacts with chromatin in a highly dynamic manner that requires ongoing chromatin remodeling, interaction with chaparones and activity of the proteasome. Here we discuss dynamic interaction of steroid receptor with chromatin, with special attention not only to PR ...

  6. PrDK: protocol programming with automata

    NARCIS (Netherlands)

    S.-S.T.Q. Jongmans (Sung-Shik); F. Arbab (Farhad)

    2016-01-01

    textabstractWe present PrDK: a development kit for programming protocols. PrDK is based on syntactic separation of process code, presumably written in an existing general-purpose language, and protocol code, written in a domain-specific language with explicit, high-level elements of syntax for

  7. Proline affects brain function in 22q11DS children with the low activity COMT 158 allele.

    Science.gov (United States)

    Vorstman, Jacob A S; Turetsky, Bruce I; Sijmens-Morcus, Monique E J; de Sain, Monique G; Dorland, Bert; Sprong, Mirjam; Rappaport, Eric F; Beemer, Frits A; Emanuel, Beverly S; Kahn, René S; van Engeland, Herman; Kemner, Chantal

    2009-02-01

    The association between the 22q11.2 deletion syndrome (22q11DS) and psychiatric disorders, particularly psychosis, suggests a causal relationship between 22q11DS genes and abnormal brain function. The genes catechol-O-methyl-transferase (COMT) and proline dehydrogenase both reside within the commonly deleted region of 22q11.2. COMT activity and proline levels may therefore be altered in 22q11DS individuals. Associations of both COMT(158) genotype and elevated serum proline levels with abnormal brain function have been reported. Fifty-six 22q11DS children and 75 healthy controls were assessed on physiological measures of brain function, including prepulse inhibition (PPI) of startle, P50 auditory sensory gating and smooth pursuit eye movements (SPEM). COMT(158) genotype and plasma proline levels were determined in the 22q11DS children. We hypothesized an interaction between the COMT(158) genotype and proline, predicting the strongest negative effect of high proline on brain function to occur in 22q11DS children who are carriers of the COMT(met) allele. Of the three physiological measures, only SPEM and PPI were abnormal in the patient sample. With regard to the SPEM performance, there was a significant interaction between the COMT(158) genotype and proline level with significantly decreased SPEM performance in children with high plasma proline levels and the low activity COMT(met) allele. A similar interaction effect was not observed with regard to PPI. These findings are consistent with a model in which elevated proline negatively affects brain function by an increase in dopamine in the prefrontal cortex. 22q11DS patients with low dopamine catabolic capacity are therefore especially vulnerable to this functional disruption.

  8. Usefulness of the CHA2DS2-VASc Score to Predict Outcome in Patients Who Underwent Transcatheter Aortic Valve Implantation.

    Science.gov (United States)

    Orvin, Katia; Levi, Amos; Landes, Uri; Bental, Tamir; Sagie, Alexander; Shapira, Yaron; Vaknin-Assa, Hana; Assali, Abid; Kornowski, Ran

    2017-10-19

    Risk assessment for transcatheter aortic valve implantation (TAVI) patients remains challenging, especially in elderly and high-risk candidates. Although several risk factors contribute to increased morbidity and mortality after TAVI, simple risk scores for routine use are lacking. Applying the CHA2DS2-VASC (congestive heart failure, hypertension, age ≥ 75 years, diabetes, prior stroke, vascular disease, age 65-74 years, sex [female] category) score as a novel risk stratification tool for conditions other than atrial fibrillation and stroke prevention has been previously examined; however, its usefulness in a population of patients with aortic stenosis after TAVI has not been established. Thus, we investigated 633 consecutive patients who underwent TAVI between November 2008 and May 2017, and calculated the CHA2DS2-VASC score. Patients were stratified according to their CHA2DS2-VASC score into 3 categories (0 to 3, 4 to 6, 7 to 9), and the association between CHA2DS2-VASC score and 1-year clinical outcomes (stroke, all-cause mortality, and combined outcome of stroke or mortality) was evaluated. We found that both stroke and mortality at 1 year were significantly more frequent with increasing CHA2DS2-VASC score (p = 0.012 and p = 0.025, respectively). Each single-point rise in CHA2DS2-VASC score was associated with a 38% increase in the 1-year combined outcome of mortality or stroke (p = 0.022; C index 0.615). In conclusion, CHA2DS2-VASC score can be used as a simple and effective tool to predict 1-year clinical outcomes including death and stroke in patients who underwent TAVI. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Evolutionary genomics of mycovirus-related dsRNA viruses reveals cross-family horizontal gene transfer and evolution of diverse viral lineages.

    Science.gov (United States)

    Liu, Huiquan; Fu, Yanping; Xie, Jiatao; Cheng, Jiasen; Ghabrial, Said A; Li, Guoqing; Peng, Youliang; Yi, Xianhong; Jiang, Daohong

    2012-06-20

    Double-stranded (ds) RNA fungal viruses are typically isometric single-shelled particles that are classified into three families, Totiviridae, Partitiviridae and Chrysoviridae, the members of which possess monopartite, bipartite and quadripartite genomes, respectively. Recent findings revealed that mycovirus-related dsRNA viruses are more diverse than previously recognized. Although an increasing number of viral complete genomic sequences have become available, the evolution of these diverse dsRNA viruses remains to be clarified. This is particularly so since there is little evidence for horizontal gene transfer (HGT) among dsRNA viruses. In this study, we report the molecular properties of two novel dsRNA mycoviruses that were isolated from a field strain of Sclerotinia sclerotiorum, Sunf-M: one is a large monopartite virus representing a distinct evolutionary lineage of dsRNA viruses; the other is a new member of the family Partitiviridae. Comprehensive phylogenetic analysis and genome comparison revealed that there are at least ten monopartite, three bipartite, one tripartite and three quadripartite lineages in the known dsRNA mycoviruses and that the multipartite lineages have possibly evolved from different monopartite dsRNA viruses. Moreover, we found that homologs of the S7 Domain, characteristic of members of the genus phytoreovirus in family Reoviridae are widely distributed in diverse dsRNA viral lineages, including chrysoviruses, endornaviruses and some unclassified dsRNA mycoviruses. We further provided evidence that multiple HGT events may have occurred among these dsRNA viruses from different families. Our study provides an insight into the phylogeny and evolution of mycovirus-related dsRNA viruses and reveals that the occurrence of HGT between different virus species and the development of multipartite genomes during evolution are important macroevolutionary mechanisms in dsRNA viruses.

  10. Evolutionary genomics of mycovirus-related dsRNA viruses reveals cross-family horizontal gene transfer and evolution of diverse viral lineages

    Directory of Open Access Journals (Sweden)

    Liu Huiquan

    2012-06-01

    Full Text Available Abstract Background Double-stranded (ds RNA fungal viruses are typically isometric single-shelled particles that are classified into three families, Totiviridae, Partitiviridae and Chrysoviridae, the members of which possess monopartite, bipartite and quadripartite genomes, respectively. Recent findings revealed that mycovirus-related dsRNA viruses are more diverse than previously recognized. Although an increasing number of viral complete genomic sequences have become available, the evolution of these diverse dsRNA viruses remains to be clarified. This is particularly so since there is little evidence for horizontal gene transfer (HGT among dsRNA viruses. Results In this study, we report the molecular properties of two novel dsRNA mycoviruses that were isolated from a field strain of Sclerotinia sclerotiorum, Sunf-M: one is a large monopartite virus representing a distinct evolutionary lineage of dsRNA viruses; the other is a new member of the family Partitiviridae. Comprehensive phylogenetic analysis and genome comparison revealed that there are at least ten monopartite, three bipartite, one tripartite and three quadripartite lineages in the known dsRNA mycoviruses and that the multipartite lineages have possibly evolved from different monopartite dsRNA viruses. Moreover, we found that homologs of the S7 Domain, characteristic of members of the genus phytoreovirus in family Reoviridae are widely distributed in diverse dsRNA viral lineages, including chrysoviruses, endornaviruses and some unclassified dsRNA mycoviruses. We further provided evidence that multiple HGT events may have occurred among these dsRNA viruses from different families. Conclusions Our study provides an insight into the phylogeny and evolution of mycovirus-related dsRNA viruses and reveals that the occurrence of HGT between different virus species and the development of multipartite genomes during evolution are important macroevolutionary mechanisms in dsRNA viruses.

  11. The Human dsRNA binding protein PACT is unable to functionally substitute for the Drosophila dsRNA binding protein R2D2 [v1; ref status: indexed, http://f1000r.es/201

    Directory of Open Access Journals (Sweden)

    Benjamin K Dickerman

    2013-10-01

    Full Text Available The primary function of the dsRNA binding protein (dsRBP PACT/RAX is to activate the dsRNA dependent protein kinase PKR in response to stress signals.  Additionally, it has been identified as a component of the small RNA processing pathway.  A role for PACT/RAX in this pathway represents an important interplay between two modes of post-transcriptional gene regulation.  The function of PACT/RAX in this context is poorly understood.  Thus, additional models are required to clarify the mechanism by which PACT/RAX functions.  In this study, Drosophila melanogaster was employed to identify functionally orthologous dsRNA-binding proteins.  Transgenic Drosophila expressing human PACT were generated to determine whether PACT is capable of functionally substituting for the Drosophila dsRBP R2D2, which has a well-defined role in small RNA biogenesis.  Results presented here indicate that PACT is unable to substitute for R2D2 at the whole organism level.

  12. Prácticas de crianza, temperamento y comportamiento prosocial de estudiantes de educación básica

    Directory of Open Access Journals (Sweden)

    Eduardo Aguirre-Dávila

    2015-02-01

    Full Text Available En este artículo presento los resultados de la investigación en la que indago por la relación entre las prácticas de crianza, el temperamento de los niños y niñas, y su comportamiento prosocial. La muestra fue de 281 padres y madres (M = 40.1 años y DS = 7.0 de familia con hijos e hijas (M = 11.3 años y DS = 0.9 que cursaban quinto y sexto grado de la educación básica, pertenecientes a diferentes estratos socioeconómicos. Apliqué tres instrumentos: el Cuestionario de Prácticas de Crianza (CPC-P versión padres, el Inventario de Temperamento y Carácter Juvenil (JTCI versión padres, y la Escala de Comportamiento Prosocial para adolescentes. Para el análisis de los resultados utilicé la regresión logística. Los resultados muestran que la asociación entre las variables prácticas de crianza y temperamento de los niños y niñas predicen su comportamiento prosocial.

  13. Electrochemical biosensor modified with dsDNA monolayer for restriction enzyme activity determination.

    Science.gov (United States)

    Zajda, Joanna; Górski, Łukasz; Malinowska, Elżbieta

    2016-06-01

    A simple and cost effective method for the determination of restriction endonuclease activity is presented. dsDNA immobilized at a gold electrode surface is used as the enzymatic substrate, and an external cationic redox probe is employed in voltammetric measurements for analytical signal generation. The assessment of enzyme activity is based on a decrease of a current signal derived from reduction of methylene blue which is present in the sample solution. For this reason, the covalent attachment of the label molecule is not required which significantly reduces costs of the analysis and simplifies the entire determination procedure. The influence of buffer components on utilized dsDNA/MCH monolayer stability and integrity is also verified. Electrochemical impedance spectroscopy measurements reveal that due to pinhole formation during enzyme activity measurement the presence of any surfactants should be avoided. Additionally, it is shown that the sensitivity of the electrochemical biosensor can be tuned by changing the restriction site location along the DNA length. Under optimal conditions the proposed biosensor exhibits a linear response toward PvuII activity within a range from 0.25 to 1.50 U/μL. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. A novel monopartite dsRNA virus isolated from the entomopathogenic and nematophagous fungus Purpureocillium lilacinum.

    Science.gov (United States)

    Herrero, Noemi

    2016-12-01

    Purpureocillium lilacinum is a ubiquitous saprophytic fungus commonly isolated from soils and widely known as a biological control agent against phytopathogenic nematodes and pest insects. Mycoviruses infect a wide number of fungal species, but the study of viruses infecting entomopathogenic fungi is still quite recent. In this study, a total of 86 P. lilacinum isolates collected from soil in natural and cultivated habitats throughout the Czech Republic were analyzed; 22 % of the isolates harbored double-stranded RNA (dsRNA) elements with viral characteristics. These results suggest that mycoviruses are common in P. lilacinum. One of the most common dsRNA elements detected in the survey was completely sequenced and corresponded to the 2,864-bp genome of a previously undescribed mycovirus, designated Purpureocillium lilacinum nonsegmented virus 1 (PlNV-1). Phylogenetic analysis of the RNA-dependent RNA polymerase of PlNV-1 indicated that this virus might belong to a new taxon related to the family Partitiviridae.

  15. Improving performance of DS-CDMA systems using chaotic complex Bernoulli spreading codes

    Science.gov (United States)

    Farzan Sabahi, Mohammad; Dehghanfard, Ali

    2014-12-01

    The most important goal of spreading spectrum communication system is to protect communication signals against interference and exploitation of information by unintended listeners. In fact, low probability of detection and low probability of intercept are two important parameters to increase the performance of the system. In Direct Sequence Code Division Multiple Access (DS-CDMA) systems, these properties are achieved by multiplying the data information in spreading sequences. Chaotic sequences, with their particular properties, have numerous applications in constructing spreading codes. Using one-dimensional Bernoulli chaotic sequence as spreading code is proposed in literature previously. The main feature of this sequence is its negative auto-correlation at lag of 1, which with proper design, leads to increase in efficiency of the communication system based on these codes. On the other hand, employing the complex chaotic sequences as spreading sequence also has been discussed in several papers. In this paper, use of two-dimensional Bernoulli chaotic sequences is proposed as spreading codes. The performance of a multi-user synchronous and asynchronous DS-CDMA system will be evaluated by applying these sequences under Additive White Gaussian Noise (AWGN) and fading channel. Simulation results indicate improvement of the performance in comparison with conventional spreading codes like Gold codes as well as similar complex chaotic spreading sequences. Similar to one-dimensional Bernoulli chaotic sequences, the proposed sequences also have negative auto-correlation. Besides, construction of complex sequences with lower average cross-correlation is possible with the proposed method.

  16. The nuclear receptor DHR3 modulates dS6 kinase-dependent growth in Drosophila.

    Directory of Open Access Journals (Sweden)

    Jacques Montagne

    2010-05-01

    Full Text Available S6 kinases (S6Ks act to integrate nutrient and insulin signaling pathways and, as such, function as positive effectors in cell growth and organismal development. However, they also have been shown to play a key role in limiting insulin signaling and in mediating the autophagic response. To identify novel regulators of S6K signaling, we have used a Drosophila-based, sensitized, gain-of-function genetic screen. Unexpectedly, one of the strongest enhancers to emerge from this screen was the nuclear receptor (NR, Drosophila hormone receptor 3 (DHR3, a critical constituent in the coordination of Drosophila metamorphosis. Here we demonstrate that DHR3, through dS6K, also acts to regulate cell-autonomous growth. Moreover, we show that the ligand-binding domain (LBD of DHR3 is essential for mediating this response. Consistent with these findings, we have identified an endogenous DHR3 isoform that lacks the DBD. These results provide the first molecular link between the dS6K pathway, critical in controlling nutrient-dependent growth, and that of DHR3, a major mediator of ecdysone signaling, which, acting together, coordinate metamorphosis.

  17. Reklamen som pastiche. Om Dansk Sygeplejeråds annoncekampagne efteråret 1986

    Directory of Open Access Journals (Sweden)

    Gunhild Agger

    1989-08-01

    Full Text Available Der er flere og flere medieproducenter, der anser modtagerne for at besidde en vis tekstuel intelligens. Fra detektivpasticher som Dick Spanner og Batman over den konstant genreparodierende "Moon- lighting" (De heldige helte til Poul og Nulles respektløse faktion "I sandhedens Tjeneste" leges der med betydningsdannelsen. Seerne/læserne indbydes til selv at spille ping-pong med billeder og tekst. Gunhild Agger analyserer her denne tendens, sådan som den kom- mer til udtryk inden for reklamen: Anker Jørgensen som James Bond, og kondomer til Prinsessen på Ærten! Mest indgående beskæftiger hun sig med Dansk Sygeplejeråds brug af myten om sygeplejersken i en annoncekampagne op mod overenskomstforhandlingerne i 1987. Gunhild Agger nøjes ikke med en indholdsanalyse af annoncerne, men beskriver hele kampagnen: Dansk Sygeplejeråds hensigter med frem- stødet, kampagnens lancering over for den tre-dobbelte målgruppe, læsernes formodede reception, og kampagnens politiske og holdnings- mæssige effekter.

  18. An Evaluation Method of Underwater Ocean Environment Safety Situation Based on D-S Evidence Theory

    Directory of Open Access Journals (Sweden)

    Yuxin Zhao

    2015-01-01

    Full Text Available Because of complex ocean environment, underwater vehicles are facing many challenges in navigation safety and precise navigation. Aiming at the requirements of underwater navigation safety, this paper presents an evaluation method of underwater ocean environment safety situation based on Dempster-Shafer (D-S evidence theory. Firstly, the vital ocean environment factors which affect the underwater navigation safety are taken into account, and a novel basic probability assignment (BPA construction method of ocean environment factors is proposed according to their characteristics. Then, a new transformation method of BPA to decision-making probability is put forward to deal with the uncertainty degree. Furthermore, the super-standard weight is applied to preprocess the BPA, and D-S combination rule is used to acquire the evaluation result by fusing the preprocessed BPA. Ocean environment safety situation index is obtained by quantizing the evaluation grades. Finally, experimental results show that the method proposed has the superior practicability and reliability in actual applications.

  19. Study of $B^0_s$ oscillations and lifetime using fully reconstructed $D^-_s$ decays

    CERN Document Server

    Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Boix, G; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Becker, U; Bright-Thomas, P G; Casper, David William; Cattaneo, M; Cerutti, F; Ciulli, V; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Lehraus, Ivan; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Boccali, T; Focardi, E; Parrini, G; Zachariadou, K; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Lynch, J G; Negus, P; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Marinelli, N; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Williams, M I; Giehl, I; Greene, A M; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Etienne, F; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Mannert, C; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Choi, Y; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Grupen, Claus; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G

    1998-01-01

    A search for B0s oscillations is performed using approximately 4 million Z --> qqbar events collected by the ALEPH experiment during 1991-1995. B0s candidates are partially reconstructed by combining tracks with fully reconstructed Ds- candidates. The B0s production flavour is estimated from the sign of the opposite hemisphere charge, a fragmentation kaon in the same hemisphere, or a lepton in the opposite hemisphere. From a total sample of 1620 candidates, with a B0s purity estimated to be 22%, all values of Delta(m_s) below 3.9 ps-1 and between 6.5 and 8.8 ps-1 are excluded at 95% CL. From the same sample, the B0s lifetime is measured to be tau_s = 1.47 +- 0.14 (stat) +- 0.08 (syst) ps. This analysis selects mainly hadronic B0s decays and is statistically independent of a previous ALEPH analysis selecting B0s --> Ds(*)- l+ nu candidates. Combining these two analyses yields Delta(m_s) > 7.9 ps-1 at 95% CL and tau_s = 1.51 +- 0.11 ps.

  20. Condition Evaluation of Storage Equipment Based on Improved D-S Evidence Theory

    Directory of Open Access Journals (Sweden)

    Zhang Xiao-yu

    2017-01-01

    Full Text Available Assessment and prediction of the storage equipment’s condition is always a difficult aspect in PHM technology. The current Condition evaluation of equipment lacks of the state level, and a single test data can’t reflect the change of equipment’s state. To solve the problem, this paper proposes an evaluation method based on improved D-S evidence theory. Firstly, use analytic hierarchy process (AHP to establish a hierarchical structure model of equipment and divide the qualified state into 4 grades. Then respectively compare the test data with the last test value, historical test mean value and standard value. And the triangular fuzzy function to calculate the index membership degree, combined with D-S evidence theory to fuse information from multiple sources, to achieve such equipment real-time state assessment. Finally, the model is used to a servo mechanism. The result shows that this method has a good performance in condition evaluation for the storage equipment

  1. 3DS-colorimeter based on a mobile phone camera for industrial applications

    Science.gov (United States)

    Miettinen, Jari; Martinkauppi, J. Birgitta; Suopajärvi, Pekka

    2013-02-01

    Colour gives an essential finishing touch to many products. Consumers find it as an important factor, for example, when selecting doors, furniture, parquet and coated metal products. Currently, colour evaluation is often carried out by looking at the product. Since people's memory for an exact colour is poor, this method often produces unsatisfactory results in industrial quality control. In this paper, we discuss how to solve this problem by the use of a colour measurement technology for mobile phones equipped with a suitable accessory. Mobile phones provide a suitable monitor platform even for laymen as people are increasingly using their mobile devices for purposes of entertainment, communication and business, thus making them a familiar device to use. Our 3DS-colorimeter is a new, handheld, low-cost consumer/industrial-level prototype combining both a colorimeter feature and 3D surface measurement feature. In this paper, we describe its colorimeter features shortly and demonstrate its performance in measurement repeatability and colorimetric accuracy. As an application example, we show its usefulness for monitoring the colour appearance of painted doors. This study indicates that the 3DS-colorimeter is applicable to industrial quality control.

  2. Influence of dsDNA fragment length on particle binding in an evanescent field biosensing system.

    Science.gov (United States)

    Koets, Marjo; van Ommering, Kim; Wang, Liqin; Testori, Emilie; Evers, Toon H; Prins, Menno W J

    2014-04-07

    Particle labels are widely used in affinity-based biosensing due to the high detection signal per label, the high stability, and the convenient biofunctionalization of particles. In this paper we address the question how the time-course of particle binding and the resulting signals depend on the length of captured target molecules. As a model system we used fragments of dsDNA with lengths of 105 bp (36 nm), 290 bp (99 nm) and 590 bp (201 nm), detected in an evanescent-field optomagnetic biosensing system. On both ends the fragments were provided with small-molecule tags to allow binding of the fragments to protein-coated particles and to the capture molecules at the sensor surface. For isolated single particles bound to the surface, we observe that the optical scattering signal per particle depends only weakly on the fragment length, which we attribute to the pivoting motion that allows the particles to get closer to the surface. Our data show a strong influence of the fragment length on the particle binding: the binding rate of particles to the sensor surface is an order of magnitude higher for the longest dsDNA fragments compared to the smallest fragment studied in this paper. We attribute the enhanced binding rate to the length and motional freedom of the fragments. These results generate a new dimension for the design of assays and systems in particle-based biosensing.

  3. Graphical Interface for Measuring and Recording Temperature with the DS18B20 Digital Output Sensor

    Directory of Open Access Journals (Sweden)

    Viorel POPA

    2013-06-01

    Full Text Available The article presents the authors’ two originalgraphical interfaces made in Borland Delphi anddesigned to measure and record (with the DS18B20sensor a wide range of negative and positivetemperatures. The first interface allows the readingof a sensor’s unique code and then themeasurement and recording of temperature. Thesecond interface can work with a variable numberof such sensors once their unique code has beenentered.The interfaces have been conceived for thestudy of the slow variations of air temperatureinside chambers or wood, in timber freezing,heating or drying processes.To achieve the purpose we have alsoexperimented on other variants of temperaturesensors, but finally we have adopted the variantthat uses the DS18B20 digital output sensormanufactured by Dallas Company. This sensor hasthe following advantages:- a small size (it can be easily inserted into a 4mm diameter hole made in the wood piece;- it measures temperatures between -55°Cand +125°C;- it can relatively easily connect to the RS232serial port of a computer;- with only two wires one can ensure datainsertion and transmission from a numberof 4 ÷ 10 sensors of this type.

  4. Effect of PEG biofunctional spacers and TAT peptide on dsRNA loading on gold nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Sanz, Vanesa; Conde, Joao; Hernandez, Yulan [Universidad de Zaragoza, Instituto de Nanociencia de Aragon (Spain); Baptista, Pedro V. [Universidade Nova de Lisboa, Departamento de Ciencias da Vida, Faculdade de Ciencias e Tecnologia, Centro de Investigacao em Genetica Molecular Humana (Portugal); Ibarra, M. R.; Fuente, Jesus M. de la, E-mail: jmfuente@unizar.es [Universidad de Zaragoza, Instituto de Nanociencia de Aragon (Spain)

    2012-06-15

    The surface chemistry of gold nanoparticles (AuNPs) plays a critical role in the self-assembly of thiolated molecules and in retaining the biological function of the conjugated biomolecules. According to the well-established gold-thiol interaction the undefined ionic species on citrate-reduced gold nanoparticle surface can be replaced with a self-assembled monolayer of certain thiolate derivatives and other biomolecules. Understanding the effect of such derivatives in the functionalization of several types of biomolecules, such as PEGs, peptides or nucleic acids, has become a significant challenge. Here, an approach to attach specific biomolecules to the AuNPs ({approx}14 nm) surface is presented together with a study of their effect in the functionalization with other specific derivatives. The effect of biofunctional spacers such as thiolated poly(ethylene glycol) (PEG) chains and a positive peptide, TAT, in dsRNA loading on AuNPs is reported. Based on the obtained data, we hypothesize that loading of oligonucleotides onto the AuNP surface may be controlled by ionic and weak interactions positioning the entry of the oligo through the PEG layer. We demonstrate that there is a synergistic effect of the TAT peptide and PEG chains with specific functional groups on the enhancement of dsRNA loading onto AuNPs.

  5. Methodology and Implementation on DSP of Heuristic Multiuser DS/CDMA Detectors

    Directory of Open Access Journals (Sweden)

    Alex Miyamoto Mussi

    2010-12-01

    Full Text Available The growing number of users of mobile communications networks and the scarcity of the electromagnetic spectrum make the use of diversity techniques and detection/decoding efficient, such as the use of multiple antennas at the transmitter and/or receiver, multiuser detection (MuD – Multiuser Detection, among others, have an increasingly prominent role in the telecommunications landscape. This paper presents a design methodology based on digital signal processors (DSP – Digital Signal Processor with a view to the implementation of multiuser heuristics detectors in systems DS/CDMA (Direct Sequence Code Division Multiple Access. Heuristics detection techniques result in near-optimal performance in order to approach the performance of maximum-likelihood (ML. In this work, was employed the DSP development platform called the C6713 DSK, which is based in Texas TMS320C6713 processor. The heuristics techniques proposed are based on well established algorithms in the literature. The efficiency of the algorithms implemented in DSP has been evaluated numerically by computing the measure of bit error rate (BER. Finally, the feasibility of implementation in DSP could then be verified by comparing results from multiple Monte-Carlo simulation in Matlab, with those obtained from implementation on DSP. It also demonstrates the effective increase in performance and system capacity of DS/CDMA with the use of heuristic multiuser detection techniques, implemented directly in the DSP.

  6. A cooperative approach among methods for photometric redshifts estimation: an application to KiDS data

    Science.gov (United States)

    Cavuoti, S.; Tortora, C.; Brescia, M.; Longo, G.; Radovich, M.; Napolitano, N. R.; Amaro, V.; Vellucci, C.; La Barbera, F.; Getman, F.; Grado, A.

    2017-04-01

    Photometric redshifts (photo-z) are fundamental in galaxy surveys to address different topics, from gravitational lensing and dark matter distribution to galaxy evolution. The Kilo Degree Survey (KiDS), i.e. the European Southern Observatory (ESO) public survey on the VLT Survey Telescope (VST), provides the unprecedented opportunity to exploit a large galaxy data set with an exceptional image quality and depth in the optical wavebands. Using a KiDS subset of about 25000 galaxies with measured spectroscopic redshifts, we have derived photo-z using (i) three different empirical methods based on supervised machine learning; (ii) the Bayesian photometric redshift model (or BPZ); and (iii) a classical spectral energy distribution (SED) template fitting procedure (LE PHARE). We confirm that, in the regions of the photometric parameter space properly sampled by the spectroscopic templates, machine learning methods provide better redshift estimates, with a lower scatter and a smaller fraction of outliers. SED fitting techniques, however, provide useful information on the galaxy spectral type, which can be effectively used to constrain systematic errors and to better characterize potential catastrophic outliers. Such classification is then used to specialize the training of regression machine learning models, by demonstrating that a hybrid approach, involving SED fitting and machine learning in a single collaborative framework, can be effectively used to improve the accuracy of photo-z estimates.

  7. Emergence and Characterization of Unusual DS-1-Like G1P[8] Rotavirus Strains in Children with Diarrhea in Thailand.

    Directory of Open Access Journals (Sweden)

    Satoshi Komoto

    Full Text Available The emergence and rapid spread of unusual DS-1-like G1P[8] rotaviruses in Japan have been recently reported. During rotavirus surveillance in Thailand, three DS-1-like G1P[8] strains (RVA/Human-wt/THA/PCB-180/2013/G1P[8], RVA/Human-wt/THA/SKT-109/2013/G1P[8], and RVA/Human-wt/THA/SSKT-41/2013/G1P[8] were identified in stool specimens from hospitalized children with severe diarrhea. In this study, we sequenced and characterized the complete genomes of strains PCB-180, SKT-109, and SSKT-41. On whole genomic analysis, all three strains exhibited a unique genotype constellation including both genogroup 1 and 2 genes: G1-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2. This novel genotype constellation is shared with Japanese DS-1-like G1P[8] strains. Phylogenetic analysis revealed that the G/P genes of strains PCB-180, SKT-109, and SSKT-41 appeared to have originated from human Wa-like G1P[8] strains. On the other hand, the non-G/P genes of the three strains were assumed to have originated from human DS-1-like strains. Thus, strains PCB-180, SKT-109, and SSKT-41 appeared to be derived through reassortment event(s between Wa-like G1P[8] and DS-1-like human rotaviruses. Furthermore, strains PCB-180, SKT-109, and SSKT-41 were found to have the 11-segment genome almost indistinguishable from one another in their nucleotide sequences and phylogenetic lineages, indicating the derivation of the three strains from a common origin. Moreover, all the 11 genes of the three strains were closely related to those of Japanese DS-1-like G1P[8] strains. Therefore, DS-1-like G1P[8] strains that have emerged in Thailand and Japan were assumed to have originated from a recent common ancestor. To our knowledge, this is the first report on whole genome-based characterization of DS-1-like G1P[8] strains that have emerged in an area other than Japan. Our observations will provide important insights into the evolutionary dynamics of emerging DS-1-like G1P[8] rotaviruses.

  8. Measuring the decay $B^0 \\rightarrow \\pi^- D_s^+$ with sensitivity to the $b \\rightarrow u$ quark transition

    CERN Document Server

    AUTHOR|(CDS)2092407

    In this thesis, the measurement of $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+)$ at LHCb is discussed. $B^0 \\rightarrow \\pi^- D_s^+$ is a non-leptonic tree decay, which only occurs via the $b \\rightarrow u$ quark transition. As a result, it probes the CKM matrix element $|V_{ub}|$. As $B^0 \\rightarrow \\pi^- D_s^+$ is purely non-leptonic, non-factorisable contributions $|a_{NF}|$ from the strong interaction have to be taken into account. They are estimated using $B^0 \\rightarrow D \\bar{D}$ decays while taking non-tree (penguin, exchange and penguin annihilation) contributions into account. It is found that $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+) = (26.7\\pm 2.0(stat.)\\pm 1.5(syst.)\\pm1.6(\\mathcal{B}))\\times 10^{-6}$, which results in $|V_{ub}||a_{NF}| = (3.40\\pm 0.14(\\mathcal{B})\\pm 0.29(ext.))10^{-3}$, where the first uncertainty comes from the measurement of $\\mathcal{B}(B^0 \\rightarrow \\pi^- D_s^+)$ and the second uncertainty from external inputs.

  9. Noise-induced creation and annihilation of dissipative solitons (DS) in a passively mode-locked laser

    Science.gov (United States)

    Teamir, Tesfay; Elahi, Parviz; Makey, Ghaith; Fatih, Ilday

    Passive mode-locking, resulting in self-organized formation of femtoseconds-long laser pulses, constitutes a far-from-equilibrium steady state. Mode-locking is not only important for laser technology, but also of fundamental interest for broad class of systems. Despite numerous studies on their nonlinear dynamics, there is little understanding of the transitions that intrinsic noise can induce. We show that transitions between single-DS and multi-DS states can be triggered. Near critical points, DS states are observed to repeatedly exchange energy among themselves, form DS clusters with varying or vibrating temporal separation, often followed by random transformations among different states. This critical behavior appears to be caused by soliton-soliton or soliton-generated dispersive wave interactions. Irrespective of the specifics of the state, the measured noise level of the laser starts at a moderate value, is then reduced, as the DS's energy is increased. Further increases in power (nonlinearity) drives it towards a noisy critical state, where creation or annihilation of pulses occurs just before a new steady state is formed. These noise-induced transitions between steady states can shed light on the thermodynamics of far-from-equilibrium systems. TàBITAK (113F319) and ERC CoG (617521).

  10. Viral Delivery of dsRNA for Control of Insect Agricultural Pests and Vectors of Human Disease: Prospects and Challenges

    Science.gov (United States)

    Kolliopoulou, Anna; Taning, Clauvis N. T.; Smagghe, Guy; Swevers, Luc

    2017-01-01

    RNAi is applied as a new and safe method for pest control in agriculture but efficiency and specificity of delivery of dsRNA trigger remains a critical issue. Various agents have been proposed to augment dsRNA delivery, such as engineered micro-organisms and synthetic nanoparticles, but the use of viruses has received relatively little attention. Here we present a critical view of the potential of the use of recombinant viruses for efficient and specific delivery of dsRNA. First of all, it requires the availability of plasmid-based reverse genetics systems for virus production, of which an overview is presented. For RNA viruses, their application seems to be straightforward since dsRNA is produced as an intermediate molecule during viral replication, but DNA viruses also have potential through the production of RNA hairpins after transcription. However, application of recombinant virus for dsRNA delivery may not be straightforward in many cases, since viruses can encode RNAi suppressors, and virus-induced silencing effects can be determined by the properties of the encoded RNAi suppressor. An alternative is virus-like particles that retain the efficiency and specificity determinants of natural virions but have encapsidated non-replicating RNA. Finally, the use of viruses raises important safety issues which need to be addressed before application can proceed. PMID:28659820

  11. Automated Reconstruction of Building LoDs from Airborne LiDAR Point Clouds Using an Improved Morphological Scale Space

    Directory of Open Access Journals (Sweden)

    Bisheng Yang

    2016-12-01

    Full Text Available Reconstructing building models at different levels of detail (LoDs from airborne laser scanning point clouds is urgently needed for wide application as this method can balance between the user’s requirements and economic costs. The previous methods reconstruct building LoDs from the finest 3D building models rather than from point clouds, resulting in heavy costs and inflexible adaptivity. The scale space is a sound theory for multi-scale representation of an object from a coarser level to a finer level. Therefore, this paper proposes a novel method to reconstruct buildings at different LoDs from airborne Light Detection and Ranging (LiDAR point clouds based on an improved morphological scale space. The proposed method first extracts building candidate regions following the separation of ground and non-ground points. For each building candidate region, the proposed method generates a scale space by iteratively using the improved morphological reconstruction with the increase of scale, and constructs the corresponding topological relationship graphs (TRGs across scales. Secondly, the proposed method robustly extracts building points by using features based on the TRG. Finally, the proposed method reconstructs each building at different LoDs according to the TRG. The experiments demonstrate that the proposed method robustly extracts the buildings with details (e.g., door eaves and roof furniture and illustrate good performance in distinguishing buildings from vegetation or other objects, while automatically reconstructing building LoDs from the finest building points.

  12. ESO PR Highlights in 2004

    Science.gov (United States)

    2005-01-01

    new interesting scientific results on the basis of data from ESO telescopes, including several results from the unmatched interferometer mode of the VLT, the VLTI, some of which were highlighted in ESO Press Releases. Certainly worth noting is the possible first ever bona-fide image of an exoplanet and the discovery of the lightest known exoplanet . At the beginning of the year, Paranal welcomed the first Auxiliary Telescope, while on the instrument side as well, 2004 was a good year: we saw the arrival of SINFONI on the VLT, of AMBER on the VLTI, and the installation at the NACO Adaptive Optics instrument of the " Simultaneous Differential Imager (SDI)" to detect exoplanets. And the first prototype of the Astrophysical Virtual Observatory was able to provide unprecedented results on the existence of Type-2 quasars by discovering an entire population of obscured, powerful supermassive black holes. Many of these developments are described in ESO's Press Releases, most with Press Photos, cf. the 2004 PR Index. Some of last year's ESO PR highlights may be accessed directly via the clickable image above.

  13. The value of the CHA2DS2-VASc score for refining stroke risk stratification in patients with atrial fibrillation with a CHADS2 score 0-1

    DEFF Research Database (Denmark)

    Olesen, Jonas Bjerring; Torp-Pedersen, Christian; Hansen, Morten Lock

    2012-01-01

    associated with increasing CHA2DS2-VASc score was estimated in Cox regression models adjusted for year of inclusion and antiplatelet therapy. The value of adding the extra CHA2DS2-VASc risk factors to the CHADS2 score was evaluated by c-statistics, Net Reclassification Improvement (NRI) and Integrated......DS2-VASc score significantly improved the predictive value of the CHADS2 score alone and a CHA2DS2-VASc score=0 could clearly identify 'truly low risk' subjects. Use of the CHA2DS2-VASc score would significantly improve classification of AF patients at low and intermediate risk of stroke, compared......North American and European guidelines on atrial fibrillation (AF) are conflicting regarding the classification of patients at low/intermediate risk of stroke. We aimed to investigate if the CHA2DS2-VASc score improved risk stratification of AF patients with a CHADS2 score of 0-1. Using individual...

  14. Self double-stranded (ds)DNA induces IL-1β production from human monocytes by activating NLRP3 inflammasome in the presence of anti-dsDNA antibodies.

    Science.gov (United States)

    Shin, Min Sun; Kang, Youna; Lee, Naeun; Wahl, Elizabeth R; Kim, Sang Hyun; Kang, Ki Soo; Lazova, Rossitza; Kang, Insoo

    2013-02-15

    The pathogenic hallmark of systemic lupus erythematosus is the autoimmune response against self nuclear Ags, including dsDNA. The increased expression of the proinflammatory cytokine IL-1β has been found in the cutaneous lesion and PBMCs from lupus patients, suggesting a potential involvement of this cytokine in the pathogenesis of lupus. IL-1β is produced primarily by innate immune cells such as monocytes and can promote a Th17 cell response, which is increased in lupus. IL-1β production requires cleaving pro-IL-β into IL-1β by the caspase-1-associated multiprotein complex called inflammasomes. In this study we show that self dsDNA induces IL-1β production from human monocytes dependent on serum or purified IgG containing anti-dsDNA Abs by activating the nucleotide-binding oligomerization domain-like receptor family pyrin domain-containing 3 (NLRP3) inflammasome. Reactive oxygen species (ROS) and K(+) efflux were involved in this activation. Knocking down the NLRP3 or inhibiting caspase-1, ROS, and K(+) efflux decreased IL-1β production. Supernatants from monocytes treated with a combination of self dsDNA and anti-dsDNA Ab(+) serum promoted IL-17 production from CD4(+) T cells in an IL-1β-dependent manner. These findings provide new insights in lupus pathogenesis by demonstrating that self dsDNA together with its autoantibodies induces IL-1β production from human monocytes by activating the NLRP3 inflammasome through inducing ROS synthesis and K(+) efflux, leading to the increased Th17 cell response.

  15. BER Performance Simulation of Generalized MC DS-CDMA System with Time-Limited Blackman Chip Waveform

    Directory of Open Access Journals (Sweden)

    I. Develi

    2010-09-01

    Full Text Available Multiple access interference encountered in multicarrier direct sequence-code division multiple access (MC DS-CDMA is the most important difficulty that depends mainly on the correlation properties of the spreading sequences as well as the shape of the chip waveforms employed. In this paper, bit error rate (BER performance of the generalized MC DS-CDMA system that employs time-limited Blackman chip waveform is presented for Nakagami-m fading channels. Simulation results show that the use of Blackman chip waveform can improve the BER performance of the generalized MC DS-CDMA system, as compared to the performances achieved by using timelimited chip waveforms in the literature.

  16. Semi-leptonic production of DsJ(3040) and DJ(3000) in Bs and B decays

    Science.gov (United States)

    Li, Si-Chen; Jiang, Yue; Wang, Tian-Hong; Li, Qiang; Wang, Zhi-Hui; Wang, Guo-Li

    2017-01-01

    In this paper, we study the productions of the newly detected states DsJ(3040) and DJ(3000) observed by BABAR Collaboration and LHCb Collaboration. We assume these states to be the Ds(2P) and D(2P) states with the quantum number JP = 1+ in our work. The results of improved Bethe-Salpeter (BS) method indicate that the semi-leptonic decays via Bs and B into DsJ(3040) and DJ(3000) have considerable branching ratios, for example, Br(B¯s0 → D sJ+(3040)l-ν¯ l) = 5.79 × 10-4, Br(B¯0 → D J+(3000)l-ν¯ l) = 2.63 × 10-4(l = e,μ), which shows that these semi-leptonic decays can be accessible in experiments.

  17. Turbo code channel reliability for DS/CDMA systems under slow and frequency selective fading and multiple access interference

    Directory of Open Access Journals (Sweden)

    Taufik Abrão

    2008-08-01

    Full Text Available This work analyzes the Turbo and Convolutional codes strategies applied to the single-user detection (SuD problem in multiple access systems DS/CDMA, in multipath slow Rayleigh channels. In this work, a new equation for the DS/CDMA channel reliability, obtained from Monte Carlo Simulations (MCS, is proposed. Comparison with the literature results and has indicated a superior performance in the high Eb/N0 regions; in other Eb/N0 regions the proposed equation has similar performance than those described in the literature. Additionally, this work makes an analysis of the complexity/memory requirements versus performance of DS/CDMA receivers considering turbo (CDMA2000 and Viterbi (IS-95 decoders.

  18. Reassortment of Human and Animal Rotavirus Gene Segments in Emerging DS-1-Like G1P[8] Rotavirus Strains.

    Science.gov (United States)

    Komoto, Satoshi; Tacharoenmuang, Ratana; Guntapong, Ratigorn; Ide, Tomihiko; Tsuji, Takao; Yoshikawa, Tetsushi; Tharmaphornpilas, Piyanit; Sangkitporn, Somchai; Taniguchi, Koki

    2016-01-01

    The emergence and rapid spread of novel DS-1-like G1P[8] human rotaviruses in Japan were recently reported. More recently, such intergenogroup reassortant strains were identified in Thailand, implying the ongoing spread of unusual rotavirus strains in Asia. During rotavirus surveillance in Thailand, three DS-1-like intergenogroup reassortant strains having G3P[8] (RVA/Human-wt/THA/SKT-281/2013/G3P[8] and RVA/Human-wt/THA/SKT-289/2013/G3P[8]) and G2P[8] (RVA/Human-wt/THA/LS-04/2013/G2P[8]) genotypes were identified in fecal samples from hospitalized children with acute gastroenteritis. In this study, we sequenced and characterized the complete genomes of strains SKT-281, SKT-289, and LS-04. On whole genomic analysis, all three strains exhibited unique genotype constellations including both genogroup 1 and 2 genes: G3-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 for strains SKT-281 and SKT-289, and G2-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 for strain LS-04. Except for the G genotype, the unique genotype constellation of the three strains (P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2) is commonly shared with DS-1-like G1P[8] strains. On phylogenetic analysis, nine of the 11 genes of strains SKT-281 and SKT-289 (VP4, VP6, VP1-3, NSP1-3, and NSP5) appeared to have originated from DS-1-like G1P[8] strains, while the remaining VP7 and NSP4 genes appeared to be of equine and bovine origin, respectively. Thus, strains SKT-281 and SKT-289 appeared to be reassortant strains as to DS-1-like G1P[8], animal-derived human, and/or animal rotaviruses. On the other hand, seven of the 11 genes of strain LS-04 (VP7, VP6, VP1, VP3, and NSP3-5) appeared to have originated from locally circulating DS-1-like G2P[4] human rotaviruses, while three genes (VP4, VP2, and NSP1) were assumed to be derived from DS-1-like G1P[8] strains. Notably, the remaining NSP2 gene of strain LS-04 appeared to be of bovine origin. Thus, strain LS-04 was assumed to be a multiple reassortment strain as to DS-1-like G1P[8], locally circulating

  19. Reassortment of Human and Animal Rotavirus Gene Segments in Emerging DS-1-Like G1P[8] Rotavirus Strains.

    Directory of Open Access Journals (Sweden)

    Satoshi Komoto

    Full Text Available The emergence and rapid spread of novel DS-1-like G1P[8] human rotaviruses in Japan were recently reported. More recently, such intergenogroup reassortant strains were identified in Thailand, implying the ongoing spread of unusual rotavirus strains in Asia. During rotavirus surveillance in Thailand, three DS-1-like intergenogroup reassortant strains having G3P[8] (RVA/Human-wt/THA/SKT-281/2013/G3P[8] and RVA/Human-wt/THA/SKT-289/2013/G3P[8] and G2P[8] (RVA/Human-wt/THA/LS-04/2013/G2P[8] genotypes were identified in fecal samples from hospitalized children with acute gastroenteritis. In this study, we sequenced and characterized the complete genomes of strains SKT-281, SKT-289, and LS-04. On whole genomic analysis, all three strains exhibited unique genotype constellations including both genogroup 1 and 2 genes: G3-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 for strains SKT-281 and SKT-289, and G2-P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 for strain LS-04. Except for the G genotype, the unique genotype constellation of the three strains (P[8]-I2-R2-C2-M2-A2-N2-T2-E2-H2 is commonly shared with DS-1-like G1P[8] strains. On phylogenetic analysis, nine of the 11 genes of strains SKT-281 and SKT-289 (VP4, VP6, VP1-3, NSP1-3, and NSP5 appeared to have originated from DS-1-like G1P[8] strains, while the remaining VP7 and NSP4 genes appeared to be of equine and bovine origin, respectively. Thus, strains SKT-281 and SKT-289 appeared to be reassortant strains as to DS-1-like G1P[8], animal-derived human, and/or animal rotaviruses. On the other hand, seven of the 11 genes of strain LS-04 (VP7, VP6, VP1, VP3, and NSP3-5 appeared to have originated from locally circulating DS-1-like G2P[4] human rotaviruses, while three genes (VP4, VP2, and NSP1 were assumed to be derived from DS-1-like G1P[8] strains. Notably, the remaining NSP2 gene of strain LS-04 appeared to be of bovine origin. Thus, strain LS-04 was assumed to be a multiple reassortment strain as to DS-1-like G1P[8], locally

  20. Crystal Field Levels of Pr3+ in PrFeO3 and PrGaO3 Determined by Inelastic Neutron Scattering

    DEFF Research Database (Denmark)

    Feldmann, K.; Henning, K.; Kaun, L.

    1975-01-01

    The crystal field splitting of the 3H4 ground state of the Pr ion in PrFeO3 and PrGaO3 has been investigated by inelastic scattering of thermal neutrons. At several temperatures the transitions have been measured by TAS and TOF methods for polycrystalline PrFeO3 and by the TOF method for polycrys...

  1. bioNerDS: exploring bioinformatics’ database and software use through literature mining

    Science.gov (United States)

    2013-01-01

    Background Biology-focused databases and software define bioinformatics and their use is central to computational biology. In such a complex and dynamic field, it is of interest to understand what resources are available, which are used, how much they are used, and for what they are used. While scholarly literature surveys can provide some insights, large-scale computer-based approaches to identify mentions of bioinformatics databases and software from primary literature would automate systematic cataloguing, facilitate the monitoring of usage, and provide the foundations for the recovery of computational methods for analysing biological data, with the long-term aim of identifying best/common practice in different areas of biology. Results We have developed bioNerDS, a named entity recogniser for the recovery of bioinformatics databases and software from primary literature. We identify such entities with an F-measure ranging from 63% to 91% at the mention level and 63-78% at the document level, depending on corpus. Not attaining a higher F-measure is mostly due to high ambiguity in resource naming, which is compounded by the on-going introduction of new resources. To demonstrate the software, we applied bioNerDS to full-text articles from BMC Bioinformatics and Genome Biology. General mention patterns reflect the remit of these journals, highlighting BMC Bioinformatics’s emphasis on new tools and Genome Biology’s greater emphasis on data analysis. The data also illustrates some shifts in resource usage: for example, the past decade has seen R and the Gene Ontology join BLAST and GenBank as the main components in bioinformatics processing. Abstract Conclusions We demonstrate the feasibility of automatically identifying resource names on a large-scale from the scientific literature and show that the generated data can be used for exploration of bioinformatics database and software usage. For example, our results help to investigate the rate of change in resource

  2. Mechanically unzipping dsDNA with built-in sequence inhomogeneities and bound proteins.

    Science.gov (United States)

    Lu, Ping; Pegg, Ian L; Sarkar, Abhijit

    2013-02-01

    We theoretically analyze the force signal expected during unzipping through a single double-stranded DNA (dsDNA) molecule with designed subsequences or inhomogeneities with large stability differentials compared to the rest of the molecule. Our calculations describe experiments where the extension between the unzipped ends is fixed--the so-called fixed-extension ensemble--and the equilibrium force is measured. Two different types of force traces are obtained depending on the inhomogeneity length and strength. For short inhomogeneities, a "sawtooth" force trace is obtained, with a force jump corresponding to release of the entire inhomogeneity at once, as observed in unzipping of natural-sequence DNA (Bockelmann et al., Biophy. J. 82, 1537 (2002)). For longer inhomogeneities, traces with force plateaus are obtained, corresponding to a gradual unpeeling of the strongly bound region. We find that inhomogeneities are disrupted in sequence giving rise to a succession of force spikes superposed on the baseline unzipping force of 15pN. The height of the force pulses diminishes as regions further down the molecule are unzipped, and asymptotically the force response approaches that of DNA without large stability-enhanced islands. Our model also allows us to describe the transition between intact and disrupted binding zones by thermally activated kinetics. We then analyze the related situation where multiple proteins are bound at specific points on the DNA with or without cooperative interactions between proteins, and where the removal of each protein is required for unzipping to proceed further along the DNA. The proteins bind stably to dsDNA and also to single-stranded DNA (ssDNA) but with a lower binding enthalpy. The force jumps correspond to the extra mechanical work that has to be done to overcome the large protein binding enthalpy to either dsDNA or ssDNA. Each force jump leads to the dissociation of a corresponding protein, but we do not find simultaneous release of

  3. Identification and expression analysis of a pathogen- responsive PR ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    related (PR) proteins. .... undesirable impacts of chemicals on environment. Introducing disease .... Figure 1. Alignment of the deduced amino acid sequences of VqPR-1 gene, the type member PR-1a from tobacco (GenBank:.

  4. Poly(hydroxyethyl methacrylate) based affinity membranes for in vitro removal of anti-dsDNA antibodies from SLE plasma.

    Science.gov (United States)

    Uzun, Lokman; Yavuz, Handan; Osman, Bilgen; Celik, Hamdi; Denizli, Adil

    2010-07-01

    The preparation of polymeric membrane using affinity technology for application in blood filtration devices is described here. DNA attached poly(hydroxyethyl methacrylate) (PHEMA) based microporous affinity membrane was prepared for selective removal of anti-dsDNA antibodies from systemic lupus erythematosus (SLE) patient plasma in in vitro. In order to further increase blood-compatibility of affinity membrane, aminoacid based comonomer N-methacryloyl-L-alanine (MAAL) was included in the polymerization recipe. PHEMAAL membrane was produced by a photopolymerization technique and then characterized by swelling tests and scanning electron microscope (SEM) studies. Blood-compatibility tests were also performed. The water swelling ratio of PHEMAAL membrane increased significantly (133.2%) compared with PHEMA (58%). PHEMAAL membrane has large pores around in the range of 5-10 microm. All the clotting times increased when compared with PHEMA membrane. Loss of platelets and leukocytes was very low. DNA loading was 7.8 mg/g. There was a very low anti-dsDNA-antibody adsorption onto the plain PHEMAAL membrane, about 78 IU/g. The PHEMAAL-DNA membrane adsorbed anti-dsDNA-antibody in the range of 10-68 x 10(3)IU/g from SLE plasma. Anti-dsDNA-antibody concentration decreased significantly from 875 to 144 IU/ml with the time. Anti-dsDNA-antibodies could be repeatedly adsorbed and eluted without noticeable loss in the anti-dsDNA-antibody adsorption amount. (c) 2010 Elsevier B.V. All rights reserved.

  5. Proteomic Analyses Reveal the Mechanism of Dunaliella salina Ds-26-16 Gene Enhancing Salt Tolerance in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Yanlong Wang

    Full Text Available We previously screened the novel gene Ds-26-16 from a 4 M salt-stressed Dunaliella salina cDNA library and discovered that this gene conferred salt tolerance to broad-spectrum organisms, including E. coli (Escherichia coli, Haematococcus pluvialis and tobacco. To determine the mechanism of this gene conferring salt tolerance, we studied the proteome of E. coli overexpressing the full-length cDNA of Ds-26-16 using the iTRAQ (isobaric tags for relative and absolute quantification approach. A total of 1,610 proteins were identified, which comprised 39.4% of the whole proteome. Of the 559 differential proteins, 259 were up-regulated and 300 were down-regulated. GO (gene ontology and KEGG (Kyoto encyclopedia of genes and genomes enrichment analyses identified 202 major proteins, including those involved in amino acid and organic acid metabolism, energy metabolism, carbon metabolism, ROS (reactive oxygen species scavenging, membrane proteins and ABC (ATP binding cassette transporters, and peptidoglycan synthesis, as well as 5 up-regulated transcription factors. Our iTRAQ data suggest that Ds-26-16 up-regulates the transcription factors in E. coli to enhance salt resistance through osmotic balance, energy metabolism, and oxidative stress protection. Changes in the proteome were also observed in E. coli overexpressing the ORF (open reading frame of Ds-26-16. Furthermore, pH, nitric oxide and glycerol content analyses indicated that Ds-26-16 overexpression increases nitric oxide content but has no effect on glycerol content, thus confirming that enhanced nitric oxide synthesis via lower intercellular pH was one of the mechanisms by which Ds-26-16 confers salt tolerance to E. coli.

  6. CHA2DS2-VASc score and exercise capacity of patients with coronary artery disease participating in cardiac rehabilitation programs.

    Science.gov (United States)

    Haskiah, Feras; Shacham, Yacov; Minha, Saar; Rozenbaum, Zach; Pereg, David

    2017-12-01

    Exercise based cardiac rehabilitation improves prognosis and quality of life in patients with coronary artery disease. We aimed to investigate whether the CHA2DS2-VASc score may be a predictor of improvement in exercise capacity in acute coronary syndrome (ACS) patients participating in a cardiac rehabilitation program. Included were patients following a hospital admission due to ACS and were subsequently referred for an exercise based cardiac rehabilitation during 2010-2015. Participants were divided into three groups of low (1-2), intermediate (3) and high (4≤) CHA2DS2-VASc score. Exercise capacity was evaluated by a treadmill stress test at baseline and following 9 months. The primary endpoint was the percent of patients who achieved at least 25% improvement in exercise capacity. The 597 patients included in the study had a mean age of 65.5±9.3 years and consisted of 22.5% women. The primary endpoint of at least 25% improvement in exercise capacity following 9 months of cardiac rehabilitation occurred more frequently in patients in the high CHA2DS2-VASc group compared to the intermediate and low CHA2DS2-VASc score groups (47.3, 29.9 and 36.1% in the high, intermediate and low CHA2DS2-VASc score groups respectively, P=0.002). The CHA2DS2-VASc score may serve as a predictor of exercise capacity improvement. Its use for tailoring specific cardiac rehabilitation programs for ACS patients may yield further improvement in functional capacity and better utilization of resources.

  7. Multifunctional benefits of SuDS: techno-economic evaluation of decentralised solutions for urban water management

    Science.gov (United States)

    Mijic, Ana; Ossa-Moreno, Juan; Smith, Karl M.

    2016-04-01

    The increased frequency of extreme weather events associated with climate change poses a significant threat to the integrity and function of critical urban infrastructure - rail, road, telecommunications, power and water supply/sewerage networks. A key threat within the United Kingdom (UK) is the increased risk of pluvial flooding; the conventional approach of channeling runoff to an outfall has proven to be unsustainable during severe storm events. Green infrastructure, in the form of Sustainable Urban Drainage Systems (SuDS), has been proposed as a means of minimising the risk of pluvial flooding. However, despite their technical performance, SuDS uptake in the UK has not reached its full capacity yet, mostly due to reasons that go beyong the engineering realm. This work investigated the strategic role of SuDS retrofit in managing environmental risks to urban infrastructure in London at a catchment level, through an economic appraisal of multifunctional benefits. It was found that by including the multifunctional benefits of SuDS, the economic feasibility of the project improves considerably. The case study has also shown a mechanism towards achieving wider-scale SuDS retrofit, whereby the investments are split amongst multiple stakeholder groups by highlighting the additional benefits each group derives. Groups include water utilities and their users, local government and critical infrastructure owners. Finally, limitations to the existing cost-benefit methdology in the UK were identified, and recommendations made regarding incentives and governmental regulations to enhance the uptake of SuDS in London. The proposed methodology provides compelling and robust, cost-benefit based evidence of SUDS' effectiveness within the flood risk management planning framework, but also with regard to the additional benefits of Nature Based Solutions in urban environments.

  8. DS14 is more likely to measure depression rather than a personality disposition in patients with acute coronary syndrome.

    Science.gov (United States)

    Ossola, Paolo; De Panfilis, Chiara; Tonna, Matteo; Ardissino, Diego; Marchesi, Carlo

    2015-12-01

    It has been suggested that Type D Personality is a risk factor for acute coronary syndrome (ACS) and the DS14 has been developed for its assessment. However, some of the items on the DS14 seem to evaluate depressive symptoms rather than personality features. Therefore, the present study aims to verify whether an overlap exists between the constructs of Type D Personality and depression. Three-hundred-and-four consecutive patients who were both presenting their first ACS and had no history of major depression completed the Hospital Anxiety and Depression Scale (HADS) and the DS14 to assess Type D personality at baseline and have been re-evaluated at 1, 2, 4, 6, 9 and 12-month follow-ups. Out of 304 subjects (80.6% males), 40 were diagnosed as depressed. An exploratory factor analysis of HADS and the DS14 in the second month revealed that four out of seven items on the depressive subscale of HADS (HADS-D) and six out of seven items on the Negative Affectivity (NA) subscale of the DS14 segregated on the same factor. Results were verified by a Partial Confirmatory Factor Analysis performed at the twelfth month when most of the patients achieved complete remission from the depressive episode. Temporal stability was poor for NA and Type D Personality and these construct co-vary with HADS-D over time. Our data suggests that NA and depression are overlapping constructs, supporting the idea that the DS14 measures depressed features, rather than a personality disposition. © 2015 Scandinavian Psychological Associations and John Wiley & Sons Ltd.

  9. An active ac/ds transposon system for activation tagging in tomato cultivar m82 using clonal propagation.

    Science.gov (United States)

    Carter, Jared D; Pereira, Andy; Dickerman, Allan W; Veilleux, Richard E

    2013-05-01

    Tomato (Solanum lycopersicum) is a model organism for Solanaceae in both molecular and agronomic research. This project utilized Agrobacterium tumefaciens transformation and the transposon-tagging construct Activator (Ac)/Dissociator (Ds)-ATag-Bar_gosGFP to produce activation-tagged and knockout mutants in the processing tomato cultivar M82. The construct carried hygromycin resistance (hyg), green fluorescent protein (GFP), and the transposase (TPase) of maize (Zea mays) Activator major transcript X054214.1 on the stable Ac element, along with a 35S enhancer tetramer and glufosinate herbicide resistance (BAR) on the mobile Ds-ATag element. An in vitro propagation strategy was used to produce a population of 25 T0 plants from a single transformed plant regenerated in tissue culture. A T1 population of 11,000 selfed and cv M82 backcrossed progeny was produced from the functional T0 line. This population was screened using glufosinate herbicide, hygromycin leaf painting, and multiplex polymerase chain reaction (PCR). Insertion sites of transposed Ds-ATag elements were identified through thermal asymmetric interlaced PCR, and resulting product sequences were aligned to the recently published tomato genome. A population of 509 independent, Ds-only transposant lines spanning all 12 tomato chromosomes has been developed. Insertion site analysis demonstrated that more than 80% of these lines harbored Ds insertions conducive to activation tagging. The capacity of the Ds-ATag element to alter transcription was verified by quantitative real-time reverse transcription-PCR in two mutant lines. The transposon-tagged lines have been immortalized in seed stocks and can be accessed through an online database, providing a unique resource for tomato breeding and analysis of gene function in the background of a commercial tomato cultivar.

  10. Standardization of (142)Pr activity concentration.

    Science.gov (United States)

    Yeltepe, Emin; Yücel, Haluk

    2017-07-25

    (142)Pr (praseodymium-142), a potential radionuclide for brachytherapy, was produced after irradiating high purity natural Pr2O3 powder in a research reactor. The irradiated powder was then dissolved in acids and diluted for measurement. Several radioactivity measurement methods were used in the standardization of (142)Pr radionuclide. This work reports the results of standardization of (142)Pr with CIEMAT/NIST efficiency tracing method, gamma spectrometry and a calibrated ionization chamber. The activity measured from different standardization methods are compatible with each other within the uncertainty limits. The CIEMAT/NIST efficiency tracing method gives the lowest uncertainty and is a reliable method for the standardization of this radionuclide. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Pràctiques de Micropaleontologia I

    OpenAIRE

    Corbí, Hugo; Giannetti, Alice; Baeza Carratalá, José Francisco; Belda, Antonio

    2014-01-01

    Cuaderno de prácticas de Micropaleontología que abarca las siguientes prácticas: Webs de interés en Micropaleontología, recogida de muestras en campo, levigados, frotis, lámina delgada y observación de muestras: lupa binocular y microscopio. Secretariat de Promoció del Valencià, Universitat d'Alacant; Conselleria d'Educació.

  12. IMPLEMENTATION OF REAL TIME AUTOCORRELATION METHOD EMPLOYING THE DS87C550 MICROCONTROLLER

    Directory of Open Access Journals (Sweden)

    A. Jiménez-Cañas

    2005-04-01

    Full Text Available In this work, the implementation of Real Time Autocorrelation method proposed by Takeuchi and Hogaki, isexposed. The purpose is to obtain the frequency of the fetal cardiac beats, originated from a Fetal Detector, using awide-benefits DS87C550 microcontroller. The value of frequency is showed in a LCD. The autocorrelation algorithmwas simulated in a PC to know its dynamic behavior from selected signals. A criterion to carry out the recognitionand the selection of the first conformed crest, was obtained. By means of this criterion, the period of the processedsignal is determined. Consequently, an optimized and original algorithm was created and implemented in themicrocontroller, where the value of the fetal cardiac frequency (given in pulses per minute, ppm. is obtained each1.2 sec. In that time, two calculated values of frequency are averaged.

  13. The effects of dsRNA mycoviruses on growth and murine virulence of Aspergillus fumigatus.

    Science.gov (United States)

    Bhatti, Muhammad F; Jamal, Atif; Petrou, Michael A; Cairns, Timothy C; Bignell, Elaine M; Coutts, Robert H A

    2011-11-01

    Some isolates of the opportunistic human pathogenic fungus Aspergillus fumigatus are known to be infected with mycoviruses. The dsRNA genomes of two of these mycoviruses, which include a chrysovirus and a partitivirus, have been completely sequenced and an RT-PCR assay for the viruses has been developed. Through curing virus-infected A. fumigatus isolates by cycloheximide treatment and transfecting virus-free isolates with purified virus, as checked by RT-PCR, isogenic virus-free and virus-infected lines of the fungus were generated whose phenotypes and growth have been directly compared. Mycovirus infection of A. fumigatus with either the chrysovirus or the partitivirus resulted in significant aberrant phenotypic alterations and attenuation of growth of the fungus but had no effect on susceptibility to common antifungals. Chrysovirus infection of A. fumigatus caused no significant alterations to murine pathogenicity. Copyright © 2011 Elsevier Inc. All rights reserved.

  14. An Iterative Multiuser Detector for Turbo-Coded DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    Takawira Fambirai

    2005-01-01

    Full Text Available We propose an iterative multiuser detector for turbo-coded synchronous and asynchronous direct-sequence CDMA (DS-CDMA systems. The receiver is derived from the maximum a posteriori (MAP estimation of the single user's transmitted data, conditioned on information about the estimate of the multiple-access interference (MAI and the received signal from the channel. This multiple-access interference is reconstructed by making hard decisions on the users' detected bits at the preceding iteration. The complexity of the proposed receiver increases linearly with the number of users. The proposed detection scheme is compared with a previously developed one. The multiuser detector proposed in this paper has a better performance when the transmitted powers of all active users are equal in the additive white Gaussian noise (AWGN channel. Also, the detector is found to be resilient against the near-far effect.

  15. Successive Interference Cancellation for DS-Optical PPM-CDMA Systems

    Science.gov (United States)

    Alsowaidi, N.; Eltaif, Tawfig; Mokhtar, M. R.

    2016-06-01

    In this paper we introduce a successive interference cancellation (SIC) scheme for direct sequence optical code division multiple access (DS-OCDMA) systems using pulse position modulation (PPM). Considering double-padded modified prime code (DPMPC) as a signature sequence code, results show that the system has better performance in terms of both capacity and bit error rate (BER) as compared to the one without cancellation scheme, where the system with SIC scheme can support up to 88 users while the system without SIC scheme can support only 38 users at similar BER=10-9. Although the receiver sensitivity is affected by the overlapping between users, which limits the system performance, the theoretical analysis of this issue indicates the influence of the size of M-ary PPM on OCDMA system. Hence, the BER value is still sufficient for good system performance.

  16. Computationally Efficient Chaotic Spreading Sequence Selection for Asynchronous DS-CDMA

    Directory of Open Access Journals (Sweden)

    Litviņenko Anna

    2017-12-01

    Full Text Available The choice of the spreading sequence for asynchronous direct-sequence code-division multiple-access (DS-CDMA systems plays a crucial role for the mitigation of multiple-access interference. Considering the rich dynamics of chaotic sequences, their use for spreading allows overcoming the limitations of the classical spreading sequences. However, to ensure low cross-correlation between the sequences, careful selection must be performed. This paper presents a novel exhaustive search algorithm, which allows finding sets of chaotic spreading sequences of required length with a particularly low mutual cross-correlation. The efficiency of the search is verified by simulations, which show a significant advantage compared to non-selected chaotic sequences. Moreover, the impact of sequence length on the efficiency of the selection is studied.

  17. CP decomposition approach to blind separation for DS-CDMA system using a new performance index

    Science.gov (United States)

    Rouijel, Awatif; Minaoui, Khalid; Comon, Pierre; Aboutajdine, Driss

    2014-12-01

    In this paper, we present a canonical polyadic (CP) tensor decomposition isolating the scaling matrix. This has two major implications: (i) the problem conditioning shows up explicitly and could be controlled through a constraint on the so-called coherences and (ii) a performance criterion concerning the factor matrices can be exactly calculated and is more realistic than performance metrics used in the literature. Two new algorithms optimizing the CP decomposition based on gradient descent are proposed. This decomposition is illustrated by an application to direct-sequence code division multiplexing access (DS-CDMA) systems; computer simulations are provided and demonstrate the good behavior of these algorithms, compared to others in the literature.

  18. DPLL implementation in carrier acquisition and tracking for burst DS-CDMA receivers.

    Science.gov (United States)

    Guan, Yun-feng; Zhang, Zhao-yang; Lai, Li-feng

    2003-01-01

    This paper presents the architectures, algorithms, and implementation considerations of the digital phase locked loop (DPLL) used for burst-mode packet DS-CDMA receivers. As we know, carrier offset is a rather challenging problem in CDMA system. According to different applications, different DPLL forms should be adopted to correct different maximum carrier offset in CDMA systems. One classical DPLL and two novel DPLL forms are discussed in the paper. The acquisition range of carrier offset can be widened by using the two novel DPLL forms without any performance degradation such as longer acquisition time or larger variance of the phase error. The maximum acquisition range is 1/(4T), where T is the symbol period. The design can be implemented by FPGA directly.

  19. DS-CDMA satellite diversity reception for personal satellite communication: Downlink performance analysis

    Science.gov (United States)

    DeGaudenzi, Riccardo; Giannetti, Filippo

    1995-01-01

    The downlink of a satellite-mobile personal communication system employing power-controlled Direct Sequence Code Division Multiple Access (DS-CDMA) and exploiting satellite-diversity is analyzed and its performance compared with a more traditional communication system utilizing single satellite reception. The analytical model developed has been thoroughly validated by means of extensive Monte Carlo computer simulations. It is shown how the capacity gain provided by diversity reception shrinks considerably in the presence of increasing traffic or in the case of light shadowing conditions. Moreover, the quantitative results tend to indicate that to combat system capacity reduction due to intra-system interference, no more than two satellites shall be active over the same region. To achieve higher system capacity, differently from terrestrial cellular systems, Multi-User Detection (MUD) techniques are likely to be required in the mobile user terminal, thus considerably increasing its complexity.

  20. Fast converging minimum probability of error neural network receivers for DS-CDMA communications.

    Science.gov (United States)

    Matyjas, John D; Psaromiligkos, Ioannis N; Batalama, Stella N; Medley, Michael J

    2004-03-01

    We consider a multilayer perceptron neural network (NN) receiver architecture for the recovery of the information bits of a direct-sequence code-division-multiple-access (DS-CDMA) user. We develop a fast converging adaptive training algorithm that minimizes the bit-error rate (BER) at the output of the receiver. The adaptive algorithm has three key features: i) it incorporates the BER, i.e., the ultimate performance evaluation measure, directly into the learning process, ii) it utilizes constraints that are derived from the properties of the optimum single-user decision boundary for additive white Gaussian noise (AWGN) multiple-access channels, and iii) it embeds importance sampling (IS) principles directly into the receiver optimization process. Simulation studies illustrate the BER performance of the proposed scheme.

  1. Secure DS-CDMA spreading codes using fully digital multidimensional multiscroll chaos

    KAUST Repository

    Mansingka, Abhinav S.

    2014-06-18

    This paper introduces a generalized fully digital hardware implementation of 1-D, 2-D and 3-D multiscroll chaos through sawtooth nonlinearities in a 3rd order ODE with the Euler approximation, wherein low-significance bits pass all NIST SP. 800-22 tests. The low-significance bits show good performance as spreading code for multiple-access DS-CDMA in AWGN and multipath environments, equivalent to Gold codes. This system capitalizes on complex nonlinear dynamics afforded by multiscroll chaos to provide higher security than conventional codes with the same BER performance demonstrated experimentally on a Xilinx Virtex 4 FPGA with logic utilization less than 1.25% and throughput up to 10.92 Gbits/s.

  2. Compensating for Channel Fading in DS-CDMA Communication Systems Employing ICA Neural Network Detectors

    Directory of Open Access Journals (Sweden)

    David Overbye

    2005-06-01

    Full Text Available In this paper we examine the impact of channel fading on the bit error rate of a DS-CDMA communication system. The system employs detectors that incorporate neural networks effecting methods of independent component analysis (ICA, subspace estimation of channel noise, and Hopfield type neural networks. The Rayleigh fading channel model is used. When employed in a Rayleigh fading environment, the ICA neural network detectors that give superior performance in a flat fading channel did not retain this superior performance. We then present a new method of compensating for channel fading based on the incorporation of priors in the ICA neural network learning algorithms. When the ICA neural network detectors were compensated using the incorporation of priors, they give significantly better performance than the traditional detectors and the uncompensated ICA detectors. Keywords: CDMA, Multi-user Detection, Rayleigh Fading, Multipath Detection, Independent Component Analysis, Prior Probability Hebbian Learning, Natural Gradient

  3. Distributed Control for Autonomous Operation of a Three-Port AC/DC/DS Hybrid Microgrid

    DEFF Research Database (Denmark)

    Wang, Peng; Jin, Chi; Zhu, Dexuan

    2015-01-01

    distributed control scheme includes: 1) a fully decentralized control, which is achieved by local power sharing (LPS) in individual ac or dc network, global power sharing (GPS) throughout ac/dc networks, and storage power sharing (SPS) among distributed storages. Upon fully decentralized control, each power...... module can operate independently without communication links. This would benefit for riding through communication malfunction in multilayer supervision control system; 2) a multilevel power exchange control for scheduling LPS, GPS, and SPS has been developed to reduce unnecessary power exchange between......This paper presents a distributed control scheme for reliable autonomous operation of a hybrid three-port ac/dc/distributed storage (ds) microgrid by means of power sharing in individual network, power exchange between ac and dc networks, and power management among three networks. The proposed...

  4. Flexibility of short ds-DNA intercalated by a dipyridophenazine ligand

    Directory of Open Access Journals (Sweden)

    Fuchao eJia

    2015-04-01

    Full Text Available We use Förster Resonant Energy Transfer (FRET in order to measure the increase of flexibility of short ds-DNA induced by the intercalation of dipyridophenazine (dppz ligand in between DNA base pairs. By using a DNA double strand fluorescently labeled at its extremeties, it is shown that the end-to-end length increase of DNA due to the intercalation of one dppz ligand is smaller than the DNA base pair interdistance. This may be explained either by a local bending of the DNA or by an increase of its flexibility. The persistence length of the formed DNA/ligand is evaluated. The described structure may have implications in the photophysical damages induced by the complexation of DNA by organometallic molecules.

  5. EURISOL-DS Multi-MW Target: Cavitations detection by the a Laser Doppler Vibrometer

    CERN Document Server

    Cyril Kharoua, Yacine Kadi, Jacques Lettry, Laure Blumenfeld, Karel Samec (CERN)Knud Thomsen, Sergej Dementevjs, Rade Milenkovich (PSI)Anatoli Zik, Erik Platacis (IPUL)

    This technical note summarises the innovative measurement devices used within Task #2 of the European Isotope Separation On-Line Radioactive Ion Beam Facility Design Study (EURISOL-DS) to detect the occurrence of cavitation in liquid metal flowing inside the CGS target mock-up.During the METEX hydraulic experiment carried out at IPUL (Institute of Physics of the University of Latvia), a Laser Doppler Vibrometer was used to characterize the wall vibrations of the beam window at different flow regimes. A series of tests proved the high sensitivity of the LDV to detect the occurrence of cavitation in the liquid metal flowing inside the target. In this context, a dedicated test procedure was developed to establish the validity of using LDV for detecting the onset of cavitation.

  6. Coherent Code Tracking for Spatial Transmit Diversity DS-CDMA Systems

    Directory of Open Access Journals (Sweden)

    R. W. Stewart

    2005-09-01

    Full Text Available Spatial transmit diversity schemes are now well integrated into third-generation cellular mobile communication system specifications. When DS-CDMA-based technology is deployed in typical macro- and microcell environments, multipath diversity and spatial diversity may be exploited simultaneously by a 2D RAKE receiver. The work presented in this paper focuses on taking advantage of spatial transmit diversity in synchronising the 2D RAKE structure. We investigate the use of coherent and noncoherent techniques for tracking the timing parameters of each multipath component. It is shown that both noncoherent and coherent techniques benefit from transmit diversity. Additionally the performance gap between these two techniques increases with the number of antennas.

  7. The complete genome sequence of Haloferax volcanii DS2, a model archaeon.

    Directory of Open Access Journals (Sweden)

    Amber L Hartman

    2010-03-01

    Full Text Available Haloferax volcanii is an easily culturable moderate halophile that grows on simple defined media, is readily transformable, and has a relatively stable genome. This, in combination with its biochemical and genetic tractability, has made Hfx. volcanii a key model organism, not only for the study of halophilicity, but also for archaeal biology in general.We report here the sequencing and analysis of the genome of Hfx. volcanii DS2, the type strain of this species. The genome contains a main 2.848 Mb chromosome, three smaller chromosomes pHV1, 3, 4 (85, 438, 636 kb, respectively and the pHV2 plasmid (6.4 kb.The completed genome sequence, presented here, provides an invaluable tool for further in vivo and in vitro studies of Hfx. volcanii.

  8. CHA2DS2-VASc Score for Identifying Truly Low-Risk Atrial Fibrillation for Stroke

    DEFF Research Database (Denmark)

    Kim, Tae-Hoon; Yang, Pil-Sung; Kim, Daehoon

    2017-01-01

    -risk patients toward initially identifying patients with a truly low risk of ischemic stroke, who do not need antithrombotic therapy. We tested the predictive ability of the congestive heart failure, hypertension, age ≥75, diabetes mellitus, prior stroke or transient ischemic attack (doubled; CHADS2......), congestive heart failure, hypertension, age ≥75 (doubled), diabetes mellitus, prior stroke or transient ischemic attack (doubled), vascular disease, age 65 to 74, female (CHA2DS2-VASc), and Anticoagulation and Risk Factors in Atrial Fibrillation (ATRIA) risk stratification schemes in oral anticoagulants...... naive patients with atrial fibrillation in a Korean nationwide sample cohort. METHODS: From January 2002 to December 2008, a total of 5855 oral anticoagulant naive patients with nonvalvular atrial fibrillation aged ≥20 years were enrolled from Korea National Health Insurance Service-Sample Cohort...

  9. FISSION TARGET DESIGN AND INTEGRATION OF NEUTRON CONVERTER FOR EURISOL-DS PROJECT

    CERN Document Server

    J. Bermudez, O. Alyakrinskiy, M. Barbui, F. Negoita, L. Serbina, L.B. Tecchio, E. Udup

    A study of a new fission target for EURISOL-DS is presented with a detailed description of the target. Calculations of several configurations were done using Monte Carlo code FLUKA aimed to obtaining 1015 fissions/s on single target. In Eurisol, neutrons inducing the fission reactions are produced by a proton beam 1GeV-4mA interacting with a mercury converter. The target configuration was customized to gain fission yield from the large amount of low energy neutrons produced by the Hg converter. To this purpose, the fissile material is composed by discs of 238-Uranium carbide enriched with 15 g of 235-U. Studies of several geometries were done in order to define the shape and composition of uranium target, taking into account the mechanical and space constraints

  10. Mercury purification in the megawatt liquid metal spallation target of EURISOL-DS

    CERN Document Server

    Neuhausen, Joerg; Eller, Martin; Schumann, Dorothea; Eichler, Bernd; Horn, Susanne

    High power spallation targets are going to be used extensively in future research and technical facilities such as spallation neutron sources, neutrino factories, radioactive beam facilities or accelerator driven systems for the transmutation of long-lived nuclear waste. Within EURISOL-DS, a 4 MW liquid metal spallation target is designed to provide neutrons for a fission target, where neutron rich radionuclides will be produced. For the spallation target, mercury is planned to be used as target material. A large amount of radionuclides ranging from atomic number Z=1 to 81 will be produced in the liquid metal during long term irradiation. It is planned to remove those radionuclides by chemical or physicochemical methods to reduce its radioactivity. For the development of a purification procedure, knowledge about the chemical state of the different elements present in the mixture is required. We present a general concept of applicable separation techniques in a target system and show some results of experiment...

  11. Conformational Properties of β-PrP*

    Science.gov (United States)

    Hosszu, Laszlo L. P.; Trevitt, Clare R.; Jones, Samantha; Batchelor, Mark; Scott, David J.; Jackson, Graham S.; Collinge, John; Waltho, Jonathan P.; Clarke, Anthony R.

    2009-01-01

    Prion propagation involves a conformational transition of the cellular form of prion protein (PrPC) to a disease-specific isomer (PrPSc), shifting from a predominantly α-helical conformation to one dominated by β-sheet structure. This conformational transition is of critical importance in understanding the molecular basis for prion disease. Here, we elucidate the conformational properties of a disulfide-reduced fragment of human PrP spanning residues 91–231 under acidic conditions, using a combination of heteronuclear NMR, analytical ultracentrifugation, and circular dichroism. We find that this form of the protein, which similarly to PrPSc, is a potent inhibitor of the 26 S proteasome, assembles into soluble oligomers that have significant β-sheet content. The monomeric precursor to these oligomers exhibits many of the characteristics of a molten globule intermediate with some helical character in regions that form helices I and III in the PrPC conformation, whereas helix II exhibits little evidence for adopting a helical conformation, suggesting that this region is a likely source of interaction within the initial phases of the transformation to a β-rich conformation. This precursor state is almost as compact as the folded PrPC structure and, as it assembles, only residues 126–227 are immobilized within the oligomeric structure, leaving the remainder in a mobile, random-coil state. PMID:19369250

  12. Conformational properties of beta-PrP.

    Science.gov (United States)

    Hosszu, Laszlo L P; Trevitt, Clare R; Jones, Samantha; Batchelor, Mark; Scott, David J; Jackson, Graham S; Collinge, John; Waltho, Jonathan P; Clarke, Anthony R

    2009-08-14

    Prion propagation involves a conformational transition of the cellular form of prion protein (PrPC) to a disease-specific isomer (PrPSc), shifting from a predominantly alpha-helical conformation to one dominated by beta-sheet structure. This conformational transition is of critical importance in understanding the molecular basis for prion disease. Here, we elucidate the conformational properties of a disulfide-reduced fragment of human PrP spanning residues 91-231 under acidic conditions, using a combination of heteronuclear NMR, analytical ultracentrifugation, and circular dichroism. We find that this form of the protein, which similarly to PrPSc, is a potent inhibitor of the 26 S proteasome, assembles into soluble oligomers that have significant beta-sheet content. The monomeric precursor to these oligomers exhibits many of the characteristics of a molten globule intermediate with some helical character in regions that form helices I and III in the PrPC conformation, whereas helix II exhibits little evidence for adopting a helical conformation, suggesting that this region is a likely source of interaction within the initial phases of the transformation to a beta-rich conformation. This precursor state is almost as compact as the folded PrPC structure and, as it assembles, only residues 126-227 are immobilized within the oligomeric structure, leaving the remainder in a mobile, random-coil state.

  13. Gravitational wave memory in dS4+2n and 4D cosmology

    Science.gov (United States)

    Chu, Y.-Z.

    2017-02-01

    We argue that massless gravitons in all even dimensional de Sitter (dS) spacetimes higher than two admit a linear memory effect arising from their propagation inside the null cone. Assume that gravitational waves (GWs) are being generated by an isolated source, and over only a finite period of time {η\\text{i}}≤slant η ≤slant {η\\text{f}} . Outside of this time interval, suppose the shear-stress of the GW source becomes negligible relative to its energy-momentum and its mass quadrupole moments settle to static values. We then demonstrate, the transverse-traceless (TT) GW contribution to the perturbation of any dS4+2n written in a conformally flat form ({{a}2}{ημ ν}\\text{d}{{x}μ}\\text{d}{{x}ν} )—after the source has ceased and the primary GW train has passed—amounts to a spacetime constant shift in the flat metric proportional to the difference between the TT parts of the source’s final and initial mass quadrupole moments. As a byproduct, we present solutions to Einstein’s equations linearized about de Sitter backgrounds of all dimensions greater than three. We then point out there is a similar but approximate tail induced linear GW memory effect in 4D matter dominated universes. Our work here serves to improve upon and extend the 4D cosmological results of Chu (2015 Phys. Rev. D 92 124038), which in turn preceded complementary work by Bieri et al (2015 arXiv:1509.01296) and by Kehagias and Riotto (2016 arXiv:1602.02653).

  14. DsHsp90 is involved in the early response of Dunaliella salina to environmental stress.

    Science.gov (United States)

    Wang, Si-Jia; Wu, Ming-Jie; Chen, Xiang-Jun; Jiang, Yan; Yan, Yong-Bin

    2012-01-01

    Heat shock protein 90 (Hsp90) is a molecular chaperone highly conserved across the species from prokaryotes to eukaryotes. Hsp90 is essential for cell viability under all growth conditions and is proposed to act as a hub of the signaling network and protein homeostasis of the eukaryotic cells. By interacting with various client proteins, Hsp90 is involved in diverse physiological processes such as signal transduction, cell mobility, heat shock response and osmotic stress response. In this research, we cloned the dshsp90 gene encoding a polypeptide composed of 696 amino acids from the halotolerant unicellular green algae Dunaliella salina. Sequence alignment indicated that DsHsp90 belonged to the cytosolic Hsp90A family. Further biophysical and biochemical studies of the recombinant protein revealed that DsHsp90 possessed ATPase activity and existed as a dimer with similar percentages of secondary structures to those well-studied Hsp90As. Analysis of the nucleotide sequence of the cloned genomic DNA fragment indicated that dshsp90 contained 21 exons interrupted by 20 introns, which is much more complicated than the other plant hsp90 genes. The promoter region of dshsp90 contained putative cis-acting stress responsive elements and binding sites of transcriptional factors that respond to heat shock and salt stress. Further experimental research confirmed that dshsp90 was upregulated quickly by heat and salt shock in the D. salina cells. These findings suggested that dshsp90 might serve as a component of the early response system of the D. salina cells against environmental stresses.

  15. DsHsp90 Is Involved in the Early Response of Dunaliella salina to Environmental Stress†

    Science.gov (United States)

    Wang, Si-Jia; Wu, Ming-Jie; Chen, Xiang-Jun; Jiang, Yan; Yan, Yong-Bin

    2012-01-01

    Heat shock protein 90 (Hsp90) is a molecular chaperone highly conserved across the species from prokaryotes to eukaryotes. Hsp90 is essential for cell viability under all growth conditions and is proposed to act as a hub of the signaling network and protein homeostasis of the eukaryotic cells. By interacting with various client proteins, Hsp90 is involved in diverse physiological processes such as signal transduction, cell mobility, heat shock response and osmotic stress response. In this research, we cloned the dshsp90 gene encoding a polypeptide composed of 696 amino acids from the halotolerant unicellular green algae Dunaliella salina. Sequence alignment indicated that DsHsp90 belonged to the cytosolic Hsp90A family. Further biophysical and biochemical studies of the recombinant protein revealed that DsHsp90 possessed ATPase activity and existed as a dimer with similar percentages of secondary structures to those well-studied Hsp90As. Analysis of the nucleotide sequence of the cloned genomic DNA fragment indicated that dshsp90 contained 21 exons interrupted by 20 introns, which is much more complicated than the other plant hsp90 genes. The promoter region of dshsp90 contained putative cis-acting stress responsive elements and binding sites of transcriptional factors that respond to heat shock and salt stress. Further experimental research confirmed that dshsp90 was upregulated quickly by heat and salt shock in the D. salina cells. These findings suggested that dshsp90 might serve as a component of the early response system of the D. salina cells against environmental stresses. PMID:22942684

  16. An evidence-based evaluation of transferrable skills and job satisfaction for science PhDs

    Science.gov (United States)

    Brandt, Patrick D.; O’Connell, Anna B.; Hall, Joshua D.; Freeman, Ashalla M.; Harrell, Jessica R.; Cook, Jeanette Gowen; Brennwald, Patrick J.

    2017-01-01

    PhD recipients acquire discipline-specific knowledge and a range of relevant skills during their training in the life sciences, physical sciences, computational sciences, social sciences, and engineering. Empirically testing the applicability of these skills to various careers held by graduates will help assess the value of current training models. This report details results of an Internet survey of science PhDs (n = 8099) who provided ratings for fifteen transferrable skills. Indeed, analyses indicated that doctoral training develops these transferrable skills, crucial to success in a wide range of careers including research-intensive (RI) and non-research-intensive (NRI) careers. Notably, the vast majority of skills were transferrable across both RI and NRI careers, with the exception of three skills that favored RI careers (creativity/innovative thinking, career planning and awareness skills, and ability to work with people outside the organization) and three skills that favored NRI careers (time management, ability to learn quickly, ability to manage a project). High overall rankings suggested that graduate training imparted transferrable skills broadly. Nonetheless, we identified gaps between career skills needed and skills developed in PhD training that suggest potential areas for improvement in graduate training. Therefore, we suggest that a two-pronged approach is crucial to maximizing existing career opportunities for PhDs and developing a career-conscious training model: 1) encouraging trainees to recognize their existing individual skill sets, and 2) increasing resources and programmatic interventions at the institutional level to address skill gaps. Lastly, comparison of job satisfaction ratings between PhD-trained employees in both career categories indicated that those in NRI career paths were just as satisfied in their work as their RI counterparts. We conclude that PhD training prepares graduates for a broad range of satisfying careers, potentially

  17. WSN-DS: A Dataset for Intrusion Detection Systems in Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Iman Almomani

    2016-01-01

    Full Text Available Wireless Sensor Networks (WSN have become increasingly one of the hottest research areas in computer science due to their wide range of applications including critical military and civilian applications. Such applications have created various security threats, especially in unattended environments. To ensure the security and dependability of WSN services, an Intrusion Detection System (IDS should be in place. This IDS has to be compatible with the characteristics of WSNs and capable of detecting the largest possible number of security threats. In this paper a specialized dataset for WSN is developed to help better detect and classify four types of Denial of Service (DoS attacks: Blackhole, Grayhole, Flooding, and Scheduling attacks. This paper considers the use of LEACH protocol which is one of the most popular hierarchical routing protocols in WSNs. A scheme has been defined to collect data from Network Simulator 2 (NS-2 and then processed to produce 23 features. The collected dataset is called WSN-DS. Artificial Neural Network (ANN has been trained on the dataset to detect and classify different DoS attacks. The results show that WSN-DS improved the ability of IDS to achieve higher classification accuracy rate. WEKA toolbox was used with holdout and 10-Fold Cross Validation methods. The best results were achieved with 10-Fold Cross Validation with one hidden layer. The classification accuracies of attacks were 92.8%, 99.4%, 92.2%, 75.6%, and 99.8% for Blackhole, Flooding, Scheduling, and Grayhole attacks, in addition to the normal case (without attacks, respectively.

  18. Cascading gauge theory on dS4 and String Theory landscape

    Science.gov (United States)

    Buchel, Alex; Galante, Damián A.

    2014-06-01

    Placing anti-D3 branes at the tip of the conifold in Klebanov-Strassler geometry provides a generic way of constructing meta-stable de Sitter (dS) vacua in String Theory. A local geometry of such vacua exhibit gravitational solutions with a D3 charge measured at the tip opposite to the asymptotic charge. We discuss a restrictive set of such geometries, where anti-D3 branes are smeared at the tip. Such geometries represent holographic dual of cascading gauge theory in dS4 with or without chiral symmetry breaking. We find that in the phase with unbroken chiral symmetry the D3 charge at the tip is always positive. Furthermore, this charge is zero in the phase with spontaneously broken chiral symmetry. We show that the effective potential of the chirally symmetric phase is lower than that in the symmetry broken phase, i.e., there is no spontaneous chiral symmetry breaking for cascading gauge theory in dS4. The positivity of the D3 brane charge in smooth de-Sitter deformed conifold geometries with fluxes presents difficulties in uplifting AdS vacua to dS ones in String Theory via smeared anti-D3 branes. First, turning on fluxes on Calabi-Yau compactifications of type IIB string theory produces highly warped geometry with stabilized complex structure (but not Kähler) moduli of the compactification [3]; Next, including non-perturbative effects (which are under control given the unbroken supersymmetry), one obtains anti-de Sitter (AdS4) vacua with all moduli fixed; Finally, one uses anti-D3 branes of type IIB string theory to uplift AdS4 to de Sitter (dS4) vacua. As the last step of the construction completely breaks supersymmetry, it is much less controlled. In fact, in [4-7] it was argued that putting anti-D3 branes at the tip of the Klebanov-Strassler (KS) [8] geometry (as done in KKLT construction) leads to a naked singularity. Whether or not the resulting singularity is physical is subject to debates. When M4=dS4 and the chiral symmetry is unbroken, the D3 brane

  19. Generation and characterization of a transgenic pig carrying a DsRed-monomer reporter gene.

    Directory of Open Access Journals (Sweden)

    Chih-Jen Chou

    Full Text Available Pigs are an optimal animal for conducting biomedical research because of their anatomical and physiological resemblance to humans. In contrast to the abundant resources available in the study of mice, few fluorescent protein-harboring porcine models are available for preclinical studies. In this paper, we report the successful generation and characterization of a transgenic DsRed-Monomer porcine model.The transgene comprised a CMV enhancer/chicken-beta actin promoter and DsRed monomeric cDNA. Transgenic pigs were produced by using pronuclear microinjection. PCR and Southern blot analyses were applied for identification of the transgene. Histology, blood examinations and computed tomography were performed to study the health conditions. The pig amniotic fluid progenitor/stem cells were also isolated to examine the existence of red fluorescence and differentiation ability.Transgenic pigs were successfully generated and transmitted to offspring at a germ-line transmission rate of 43.59% (17/39. Ubiquitous expression of red fluorescence was detected in the brain, eye, tongue, heart, lung, liver, pancreas, spleen, stomach, small intestine, large intestine, kidney, testis, and muscle; this was confirmed by histology and western blot analyses. In addition, we confirmed the differentiation potential of amniotic fluid progenitor stem cells isolated from the transgenic pig.This red fluorescent pig can serve as a host for other fluorescent-labeled cells in order to study cell-microenvironment interactions, and can provide optimal red-fluorescent-labeled cells and tissues for research in developmental biology, regenerative medicine, and xenotransplantation.

  20. La préservation, atout essentiel pour contrer la précarité des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La préservation, atout essentiel pour contrer la précarité des moyens de subsistance en Afrique de l'Est. Ce projet vise à aider les ménages et les décideurs des régions rurales à mieux comprendre l'importance de la biodiversité et de la préservation des ressources comme composantes essentielles de stratégies ...

  1. Mouse Prion Protein (PrP) Segment 100 to 104 Regulates Conversion of PrPC to PrPSc in Prion-Infected Neuroblastoma Cells

    Science.gov (United States)

    Hara, Hideyuki; Okemoto-Nakamura, Yuko; Shinkai-Ouchi, Fumiko; Hanada, Kentaro; Yamakawa, Yoshio

    2012-01-01

    Prion diseases are characterized by the replicative propagation of disease-associated forms of prion protein (PrPSc; PrP refers to prion protein). The propagation is believed to proceed via two steps; the initial binding of the normal form of PrP (PrPC) to PrPSc and the subsequent conversion of PrPC to PrPSc. We have explored the two-step model in prion-infected mouse neuroblastoma (ScN2a) cells by focusing on the mouse PrP (MoPrP) segment 92-GGTHNQWNKPSKPKTN-107, which is within a region previously suggested to be part of the binding interface or shown to differ in its accessibility to anti-PrP antibodies between PrPC and PrPSc. Exchanging the MoPrP segment with the corresponding chicken PrP segment (106-GGSYHNQKPWKPPKTN-121) revealed the necessity of MoPrP residues 99 to 104 for the chimeras to achieve the PrPSc state, while segment 95 to 98 was replaceable with the chicken sequence. An alanine substitution at position 100, 102, 103, or 104 of MoPrP gave rise to nonconvertible mutants that associated with MoPrPSc and interfered with the conversion of endogenous MoPrPC. The interference was not evoked by a chimera (designated MCM2) in which MoPrP segment 95 to 104 was changed to the chicken sequence, though MCM2 associated with MoPrPSc. Incubation of the cells with a synthetic peptide composed of MoPrP residues 93 to 107 or alanine-substituted cognates did not inhibit the conversion, whereas an anti-P8 antibody recognizing the above sequence in PrPC reduced the accumulation of PrPSc after 10 days of incubation of the cells. These results suggest the segment 100 to 104 of MoPrPC plays a key role in conversion after binding to MoPrPSc. PMID:22398286

  2. 76 FR 22744 - 60-Day Notice of Proposed Information Collection: Form DS-3083, Training Registration (For Non-U...

    Science.gov (United States)

    2011-04-22

    ... Institute, Office of the Executive Director (FSI/EX). Form Number: DS-3083. Respondents: Business owners... Executive Director, Room F-2205, U.S. Department of State, Washington, DC 20522-4201. Fax: 703-302-7227. You..., Executive Director, Foreign Service Institute, Department of State. BILLING CODE 4710-34-P ...

  3. 76 FR 65317 - 60-Day Notice of Proposed Information Collection: DS-4184, Risk Management and Analysis (RAM)

    Science.gov (United States)

    2011-10-20

    ... Notice of Proposed Information Collection: DS-4184, Risk Management and Analysis (RAM) ACTION: Notice of...: Risk Analysis and Management. OMB Control Number: None. Type of Request: New. Originating Office... support to entities or individuals deemed to be a risk to national security. Methodology: The State...

  4. Divergent Patterns of Social Cognition Performance in Autism and 22q11.2 Deletion Syndrome (22q11DS)

    Science.gov (United States)

    McCabe, Kathryn L.; Melville, Jessica L.; Rich, Dominique; Strutt, Paul A.; Cooper, Gavin; Loughland, Carmel M.; Schall, Ulrich; Campbell, Linda E.

    2013-01-01

    Individuals with developmental disorders frequently report a range of social cognition deficits including difficulties identifying facial displays of emotion. This study examined the specificity of face emotion processing deficits in adolescents with either autism or 22q11DS compared to typically developing (TD) controls. Two tasks (face emotion…

  5. 76 FR 77581 - 60-Day Notice of Proposed Information Collection: Form DS-3097, Exchange Visitor Program Annual...

    Science.gov (United States)

    2011-12-13

    ... Notice of Proposed Information Collection: Form DS-3097, Exchange Visitor Program Annual Report, and OMB... of 1995. Title of Information Collection: Exchange Visitor Program Annual Report. OMB Control Number... the Student and Exchange Visitor Information System (SEVIS) and then printed and signed by a sponsor...

  6. A Low-Complexity Joint Synchronization and Detection Algorithm for Single-Band DS-CDMA UWB Communications

    DEFF Research Database (Denmark)

    Christensen, Lars P.B.

    2005-01-01

    The problem of asynchronous direct-sequence code division multiple access (DS-CDMA) detection over the ultra-wideband (UWB) multipath channel is considered. A joint synchronization, channel-estimation and multi-user detection scheme based on the adaptive linear minimum mean-square error (LMMSE...

  7. Space-Time Chip Equalization for Maximum Diversity Space-Time Block Coded DS-CDMA Downlink Transmission

    NARCIS (Netherlands)

    Leus, G.; Petré, F.; Moonen, M.

    2004-01-01

    In the downlink of DS-CDMA, frequency-selectivity destroys the orthogonality of the user signals and introduces multiuser interference (MUI). Space-time chip equalization is an efficient tool to restore the orthogonality of the user signals and suppress the MUI. Furthermore, multiple-input

  8. A Combined MIS/DS Course Uses Lecture Capture Technology to "Level the Playing Field" in Student Numeracy

    Science.gov (United States)

    Popovich, Karen

    2012-01-01

    This paper describes the process taken to develop a quantitative-based and Excel™-driven course that combines "BOTH" Management Information Systems (MIS) and Decision Science (DS) modeling outcomes and lays the foundation for upper level quantitative courses such as operations management, finance and strategic management. In addition,…

  9. 76 FR 3690 - 60-Day Notice of Proposed Information Collection: DS-10, Birth Affidavit, OMB Control Number 1405...

    Science.gov (United States)

    2011-01-20

    ... Notice of Proposed Information Collection: DS-10, Birth Affidavit, OMB Control Number 1405-0132 ACTION... Collection: Birth Affidavit. OMB Control Number: 1405-0132. Type of Request: Extension of a Currently... form number (if applicable), information collection title, and OMB control number in any correspondence...

  10. 77 FR 40692 - 30-Day Notice of Proposed Information Collection: DS-158, Contact Information and Work History...

    Science.gov (United States)

    2012-07-10

    ... Notice of Proposed Information Collection: DS-158, Contact Information and Work History for Nonimmigrant... collection request to the Office of Management and Budget (OMB) for approval in accordance with the Paperwork Reduction Act of 1995. Title of Information Collection: Contact Information and Work History for...

  11. 75 FR 27854 - 30-Day Notice of Proposed Information Collection: DS-4048, Projected Sales of Major Weapons in...

    Science.gov (United States)

    2010-05-18

    ... Notice of Proposed Information Collection: DS-4048, Projected Sales of Major Weapons in Support of... following information collection request to the Office of Management and Budget (OMB) for approval in accordance with the Paperwork Reduction Act of 1995. Title of Information Collection: Projected Sales of...

  12. 76 FR 72022 - 30-Day Notice of Proposed Information Collection: DS-4131 Advance Notification Form: Tourist and...

    Science.gov (United States)

    2011-11-21

    ...-Governmental Activities in the Antarctic Treaty Area, 1405-0181 ACTION: Notice of request for public comment... Notification Form: Tourist and Other Non-Governmental Activities in the Antarctic Treaty Area. OMB Control... comments by the following methods: Email: [email protected] . You must include the DS form number...

  13. Supplementation of alkaline phytase (Ds11) in whole-wheat bread reduces phytate content and improves mineral solubility.

    Science.gov (United States)

    Park, Yun-Jong; Park, Jiwon; Park, Ki-Hwan; Oh, Byung-Chul; Auh, Joong-Hyuck

    2011-08-01

    In this study, alkaline phytase was added to whole-wheat bread and the phytate content and mineral profiles were compared to commercially available acidic phytase. At neutral pH, some phytate (approximately 20%) was degraded by endogenous phytase in wheat flour, while 40% of phytate was hydrolyzed by alkaline phytase DS11 and a 35% reduction was observed with acidic phytase. Most of the enzymatic activity occurred during the proofing stage, and the rate of reaction depended on pH. DS11 phytase effectively degraded the phytate level within a 30 min treatment at pH 7; however, at least 60 min was needed with acidic phytase to achieve the same hydrolysis level. Mineral profiles were also dramatically affected by the phytate reduction. The biggest increase was observed in Fe²⁺ by the phytase treatment. The Fe²⁺ content increased 10-fold at pH 7 and 8-fold at pH 5 with alkaline phytase DS11. Alkaline phytase DS11 was shown to be effective at phytate reduction in whole-wheat bread preparation. Additionally, phytate degradation enhanced the mineral availability of bread. © 2011 Institute of Food Technologists®

  14. Motor step size and ATP coupling efficiency of the dsDNA translocase EcoR124I

    NARCIS (Netherlands)

    Seidel, R.; Bloom, J.G.P.; Dekker, C.; Szczelkun, M.D.

    2008-01-01

    The Type I restriction-modification enzyme EcoR124I is an archetypical helicase-based dsDNA translocase that moves unidirectionally along the 3'–5' strand of intact duplex DNA. Using a combination of ensemble and single-molecule measurements, we provide estimates of two physicochemical constants

  15. Noncytotoxic orange and red/green derivatives of DsRed-Express2 for whole-cell labeling

    Directory of Open Access Journals (Sweden)

    Glick Benjamin S

    2009-04-01

    Full Text Available Abstract Background Whole-cell labeling is a common application of fluorescent proteins (FPs, but many red and orange FPs exhibit cytotoxicity that limits their use as whole-cell labels. Recently, a tetrameric red FP called DsRed-Express2 was engineered for enhanced solubility and was shown to be noncytotoxic in bacterial and mammalian cells. Our goal was to create derivatives of this protein with different spectral properties. Results Building on previous studies of DsRed mutants, we created two DsRed-Express2 derivatives: E2-Orange, an orange FP, and E2-Red/Green, a dual-color FP with both red and green emission. We show that these new FPs retain the low cytotoxicity of DsRed-Express2. In addition, we show that these new FPs are useful as second or third colors for flow cytometry and fluorescence microscopy. Conclusion E2-Orange and E2-Red/Green will facilitate the production of healthy, stably fluorescent cell lines and transgenic organisms for multi-color labeling studies.

  16. 75 FR 37519 - 30-Day Notice of Proposed Information Collection: Forms DS-4138, Request for Escort Screening...

    Science.gov (United States)

    2010-06-29

    ...-4140, Application for OFM Web Site Account; DS- 1504; Request for Customs Clearance of Merchandise... Information Collection: Request for Escort Screening Courtesies. OMB Control Number: 1405-0105. Type of.... Title of Information Collection: Photograph and Signature Card. OMB Control Number: 1405-0105. Type of...

  17. A collection of Ds insertional mutants associated with defects in male gametophyte development and function in Arabidopsis thaliana.

    Science.gov (United States)

    Boavida, Leonor C; Shuai, Bin; Yu, Hee-Ju; Pagnussat, Gabriela C; Sundaresan, Venkatesan; McCormick, Sheila

    2009-04-01

    Functional analyses of the Arabidopsis genome require analysis of the gametophytic generation, since approximately 10% of the genes are expressed in the male gametophyte and approximately 9% in the female gametophyte. Here we describe the genetic and molecular characterization of 67 Ds insertion lines that show reduced transmission through the male gametophyte. About half of these mutations are male gametophytic-specific mutations, while the others also affect female transmission. Genomic sequences flanking both sides of the Ds element were recovered for 39 lines; for 16 the Ds elements were inserted in or close to coding regions, while 7 were located in intergenic/unannotated regions of the genome. For the remaining 16 lines, chromosomal rearrangements such as translocations or deletions, ranging between 30 and 500 kb, were associated with the transposition event. The mutants were classified into five groups according to the developmental processes affected; these ranged from defects in early stages of gametogenesis to later defects affecting pollen germination, pollen tube growth, polarity or guidance, or pollen tube-embryo sac interactions or fertilization. The isolated mutants carry Ds insertions in genes with diverse biological functions and potentially specify new functions for several unannotated or unknown proteins.

  18. 77 FR 12903 - 60-Day Notice of Proposed Information Collection: DS-158, Contact Information and Work History...

    Science.gov (United States)

    2012-03-02

    ... Notice of Proposed Information Collection: DS-158, Contact Information and Work History for Nonimmigrant... of Information Collection: Contact Information and Work History for Nonimmigrant Visa Applicant. OMB... access to the Internet may view and comment on this notice by going to the Federal regulations Web site...

  19. Using RICH Particle Identification in the LHCb High Level Trigger Selection of $B_s \\to D_s h$

    CERN Document Server

    Patel, M

    2006-01-01

    The use of RICH particle identification (PID) in the High Level Trigger (HLT) selection of $B_s \\to D_s h$, where $h = pi$ or $K$, has been explored. The online RICH PID is found to be a more efficient cut to reject minimum bias background events than others presently used. The application of RICH PID therefore allows other cuts to be relaxed and the trigger efficiency to be increased. In addition, the control of the background is sufficient to allow a small fraction of additional events to be triggered without requiring all the tracks be reconstructed right the way through the LHCb detector. A track segment is used to determine the direction of one of the particles in a candidate decay and then the $D_s$ mass is "forced" to determine the momentum of this segment. This allows the recovery of events lost owing to the tracking inefficiency in the HLT. The $D_s$ mass-forcing requires a number of cuts to be tightened in order to reduce the additional background generated by the loss of the $D_s$ mass constraint. ...

  20. 75 FR 54690 - 60-Day Notice of Proposed Information Collection: DS-7656; Affidavit of Relationship (AOR); OMB...

    Science.gov (United States)

    2010-09-08

    ... (PRM/A) Form Number: DS-7656. Respondents: Persons admitted to the United States as refugees or granted asylum in the United States who are claiming a relationship with family members overseas (spouses... age and have been admitted to the United States as a refugee or granted asylum in the United States no...

  1. Investigation of the Rare Exclusive Bc*→Dsνν- Decays in the Framework of the QCD Sum Rules

    Directory of Open Access Journals (Sweden)

    V. Bashiry

    2014-01-01

    Full Text Available Exclusive Bc*→Dsνν- decay is studied in the framework of the three-point QCD sum rules approach. The two gluon condensate contributions to the correlation function are calculated and the form factors of this transition are found. The decay width and total branching ratio for this decay are also calculated.

  2. ESO PR Highlights in 2007

    Science.gov (United States)

    2008-01-01

    Another great year went by for ESO, the European Organisation for Astronomical Research in the Southern Hemisphere. From 1 January 2007, with the official joining of the Czech Republic, ESO has 13 member states, and since September, ESO has a new Director General, Tim de Zeeuw (ESO 03/07 and 38/07). Many scientific discoveries were made possible with ESO's telescopes. Arguably, the most important is the discovery of the first Earth-like planet in the habitable zone of a low-mass red dwarf (ESO 22/07). If there is water on this planet, then it should be liquid! ESO PR Highlights 2007 This is a clickable map. These are only some of the press releases issued by ESO in 2007. For a full listing, please go to ESO 2007 page. In our own Solar System also, astronomers made stunning breakthroughs with ESO's telescopes, observing the effect of the light from the Sun on an asteroid's rotation (ESO 11/07), describing in unprecedented detail the double asteroid Antiope (ESO 18/07), peering at the rings of Uranus (ESO 37/07), discovering a warm south pole on Neptune (ESO 41/07), showing a widespread and persistent morning drizzle of methane over the western foothills of Titan's major continent (ESO 47/07), and studying in the greatest details the wonderful Comet McNaught (ESO 05/07 and 07/07). In the study of objects slightly more massive than planets, the VLT found that brown dwarfs form in a similar manner to normal stars (ESO 24/07). The VLT made it also possible to measure the age of a fossil star that was clearly born at the dawn of time (ESO 23/07). Other discoveries included reconstructing the site of a flare on a solar-like star (ESO 53/07), catching a star smoking (ESO 34/07), revealing a reservoir of dust around an elderly star (ESO 43/07), uncovering a flat, nearly edge-on disc of silicates in the heart of the magnificent Ant Nebula (ESO 42/07), finding material around a star before it exploded (ESO 31/07), fingerprinting the Milky Way (ESO 15/07), revealing a rich

  3. Using PrEP, losing condoms? PrEP promotion may undermine safe sex.

    Science.gov (United States)

    Alaei, Kamair; Paynter, Christopher A; Juan, Shao-Chiu; Alaei, Arash

    2016-09-20

    PrEP is a crucial new tool for the prevention of HIV. However, careful attention must be paid as to whether its widespread adoption could reduce condom usage, which may in turn increase STIs in the long-run. In this article we re-assess whether PrEP uptake may influence condom usage, and we call for vigilance by public health advocates to ensure that PrEP promotion does not lead to a drop-off in safe sex practices. Most of the evidence that PrEP does not change condom usage comes from double-blind clinical trials which are focused on the biological effect of PrEP on HIV incidence. However, subjects in these trials may not change their behavior because they do not actually know if they are taking PrEP. A number of focus group studies on individuals considering taking PrEP show that many see the drug as an opportunity for increasing unprotected sex. National survey data from the CDC show that condom rates are decreasing among MSM, which are a major target group for PrEP. Furthermore, data from public health records show that STIs are increasing among MSM in some areas with relatively high PrEP uptake. There is enough evidence that PrEP is contributing to rising STI infections to warrant concern. Public health advocates must ensure that PrEP uptake does not inadvertently threaten the public's health and that thirty years of condom promotion are not wasted.

  4. Assessment of left atrium mechanical function by deformation imaging in atrial fibrillation and its correlation with CHA2DS2-VASc risk score

    Directory of Open Access Journals (Sweden)

    Mahmoud Kamel Ahmed

    2015-09-01

    Conclusion: AF leads to impairment of LA mechanical function as evidenced by low PALS but PALS was not significantly correlated with CHA2DS2-VASc score. Also, there was no significantly statistical difference between PALS in patients with low and high CHA2DS2-VASc scores.

  5. Dataset of the absorption, emission and excitation spectra and fluorescence intensity graphs of fluorescent cyanine dyes for the quantification of low amounts of dsDNA

    NARCIS (Netherlands)

    Bruijns, Brigitte Bibiche; Tiggelaar, Roald M.; Gardeniers, Johannes G.E.

    This article describes data related to a research article entitled “Fluorescent cyanine dyes for the quantification of low amounts of dsDNA” (B. Bruijns, R. Tiggelaar, J. Gardeniers, 2016) [1]. Six cyanine dsDNA dyes - EvaGreen, SYBR Green, PicoGreen, AccuClear, AccuBlue NextGen and YOYO-1 – are

  6. Increased anxiety and depression in Danish cardiac patients with a type D personality: cross-validation of the Type D Scale (DS14)

    DEFF Research Database (Denmark)

    Spindler, Helle; Kruse, Charlotte; Zwisler, Ann-Dorthe

    2009-01-01

    , the Hospital Anxiety and Depression Scale, and the Eysenck Personality Questionnaire. A subgroup (n = 318) also completed the DS14 at 3 or 12 weeks. RESULTS: The two-factor structure of the DS14 was confirmed; the subscales negative affectivity and social inhibition were shown to be valid, internally...

  7. Précis de grammaire

    CERN Document Server

    Chollet, Isabelle

    2009-01-01

    Le Précis de grammaire est tout particulièrement destiné aux apprenants de français langue étrangère, quel que soit leur niveau. Cet ouvrage propose de fournir une réponse claire à tous les problèmes grammaticaux que rencontrent les étudiants étrangers. Axées sur la communication, les explications sont accompagnées d'exemples simples et de mises en situation. La forme et le sens sont donc privilégiés pour faire de ce précis une véritable grammaire de référence. Le précis de grammaire est composé de cinq parties comprenant chacune plusieurs chapitres : La phrase ; Les phrases complexes ; Les parties du discours ; Les relations logiques ; Le système verbal. Les chapitres comportent de nombreux renvois à d'autres chapitres. En début d'ouvrage, un sommaire détaillé présente l'ensemble du précis et donne une indication de niveau (selon le classement du Cadre européen de référence pour les langues) : de A l à C l. En fin d'ouvrage, un index permet de trouver très facilement un mot (...

  8. A first-in-human study of DS-1040, an inhibitor of the activated form of thrombin-activatable fibrinolysis inhibitor, in healthy subjects.

    Science.gov (United States)

    Zhou, J; Kochan, J; Yin, O; Warren, V; Zamora, C; Atiee, G; Pav, J; Orihashi, Y; Vashi, V; Dishy, V

    2017-05-01

    Essentials DS-1040 inhibits the activated form of thrombin-activatable fibrinolysis inhibitor (TAFIa). Infusion of DS-1040 was safe and well tolerated in healthy young and elderly subjects. DS-1040 substantially decreased TAFIa activity but had no impact on bleeding time. DS-1040 may provide an option of safer thrombolytic therapy. Background Current treatments for acute ischemic stroke and venous thromboembolism, such as recombinant tissue-type plasminogen activator and thrombectomy, are limited by a narrow time window and the risk of bleeding. DS-1040 is a novel low molecular weight compound that inhibits the activated form of thrombin-activatable fibrinolysis inhibitor (TAFIa), and was developed as a fibrinolysis enhancer for the treatment of thromboembolic diseases. Objectives This first-in-human, randomized, placebo-controlled, three-part, phase 1 study was conducted to evaluate the safety, pharmacokinetics and pharmacodynamics of DS-1040 in healthy subjects. Subjects/Methods Young (18-45 years) or elderly (65-75 years) subjects (N = 103) were randomized to receive single ascending doses of DS-1040 ranging from 0.1 mg to 40 mg, or placebo, administered either as a 0.5-h intravenous infusion or as a 24-h continuous infusion. Results All doses of DS-1040 were tolerated, and no serious adverse events (AEs) or discontinuations resulting from AEs occurred during the study. Bleeding time remained within the normal range for all doses tested in all subjects. Plasma exposure of DS-1040 increased proportionally with increase in dose. Elderly subjects had higher exposures to DS-1040 and prolonged elimination times, probably because of decreased renal clearance. DS-1040 caused a substantial dose-dependent and time-dependent decrease in TAFIa activity and in 50% clot lysis time. The levels of D-dimer, indicative of endogenous fibrinolysis, increased in some individuals following DS-1040 treatment. No effects of DS-1040 on coagulation parameters or platelet

  9. A Study of the CryoTel® DS 1.5 Cryocooler for Higher Cooling Capacity

    Science.gov (United States)

    Kim, Yongsu; Wade, Jimmy; Wilson, Kyle

    2015-12-01

    The CryoTel® DS 1.5 is a split type Stirling cryocooler which was developed by Sunpower for systems requiring compact size, high efficiency, and high reliability. The DS 1.5 has a nominal lift of 1.5 watts at 77 K with 30 watts of input power. The cooler design includes gas bearings on the pistons and displacer for non-contact operation, and achieves low vibration by using dual-opposed pistons inside the wave generator, and a passive balancer on the cold head to offset the displacer motion. The efficiency of the DS 1.5 is ranked highly compared to other cryocoolers at 14.2% Carnot efficiency, but there are many customers who want more lift with the same size and reliability. Therefore, Sunpower performed a study on the feasibility of maximizing the lift of the DS 1.5 without increasing its size. This paper describes the analysis and test results of increasing the cooler power density by using a higher operating frequency and charge pressure. Prototype testing showed good agreement with the model. Testing performed at various frequencies and charge pressures with a few internal component changes resulted in a maximum lift of 2.1 watts with an input power of 43 watts, achieving 13.9% of Carnot. The prototype high-capacity DS 1.5 achieved 0.6 watts more lift with only a slight decrease in efficiency, and with less than 0.2% cooler mass increase. The impact on the cooldown time on a thermal mass system was tested and the cool-down time was 37% faster while consuming less input energy during that time. Sunpower plans to build more units to gain a broader range of performance data and will then decide whether to proceed with a commercial product.

  10. The Relationships between Atrial Electromechanical Delay and CHA2DS2-VASc Score in Patients Diagnosed with Paroxysmal AF.

    Science.gov (United States)

    Nar, Gökay; İnci, Sinan; Aksan, Gökhan; Soylu, Korhan; Demirelli, Selami; Nar, Rukiye

    2015-09-01

    This study aims to evaluate the relationship between atrial electromechanical delay (AEMD) times and CHA2DS2-VASc scores in patients diagnosed with paroxysmal atrial fibrillation (PAF). The study included a total of 74 patients, 34 of whom were diagnosed with PAF and 40 were included in the control group. The CHA2DS2-VASc score was calculated for each patient. Additionally, blood samples were taken from all patients and transthoracic echocardiographic measurements were made. Left atrial mechanical functions and AEMD were calculated. Mean CHA2DS2-VASc score measured was 2.24 ± 1.53 in PAF group. There was no significant difference between the groups when the patients were evaluated for baseline characteristics and laboratory parameters (P > 0.05) The echocardiographic evaluation of LA mechanical functions showed that only LA minimum volume (19 ± 6.4 vs. 16.7 ± 4.6, P = 0.02) and LA presystolic volume (28.9 ± 7 vs. 25.1 ± 5.7, P = 0.01) were higher in the PAF group. When AEMD was compared between the groups; lateral PA, septal PA, tricuspid PA, Interatrial EMD, and intraatrial EMD were significantly extended compared to control group (P < 0.001) CHA2DS2-VASc score was correlated with Lateral atrial PA (P < 0.001, r = 0.524), Septal atrial PA (P < 0.001, r = 0.45), Interatrial EMD (P < 0.001, r = 0.54), and intraatrial EMD (P < 0.001, r = 0.51) times. The present study shows that AEMD times increase in patients with PAF compared to the control group. Furthermore, this study revealed a correlation between AEMD times and CHA2DS2-VASc score, as well showed that extended AEMD time may be associated with thromboembolism risk. © 2014, Wiley Periodicals, Inc.

  11. Massive A-to-I RNA editing is common across the Metazoa and correlates with dsRNA abundance.

    Science.gov (United States)

    Porath, Hagit T; Knisbacher, Binyamin A; Eisenberg, Eli; Levanon, Erez Y

    2017-10-02

    Adenosine to inosine (A-to-I) RNA editing is a post-transcriptional modification catalyzed by the ADAR (adenosine deaminase that acts on RNA) enzymes, which are ubiquitously expressed among metazoans. Technical requirements have limited systematic mapping of editing sites to a small number of organisms. Thus, the extent of editing across the metazoan lineage is largely unknown. Here, we apply a computational procedure to search for RNA-sequencing reads containing clusters of editing sites in 21 diverse organisms. Clusters of editing sites are abundant in repetitive genomic regions that putatively form double-stranded RNA (dsRNA) structures and are rarely seen in coding regions. The method reveals a considerable variation in hyper-editing levels across species, which is partly explained by differences in the potential of sequences to form dsRNA structures and the variability of ADAR proteins. Several commonly used model animals exhibit low editing levels and editing levels in primates is not exceptionally high, as previously suggested. Editing by ADARs is highly prevalent across the Metazoa, mostly targeting dsRNA structures formed by genomic repeats. The degree to which the transcriptome of a given species undergoes hyper-editing is governed by the repertoire of repeats in the underlying genome. The strong association of RNA editing with the long dsRNA regions originating from non-coding repetitive elements is contrasted by the almost non-existing signal seen in coding regions. Hyper-edited regions are rarely expressed in a non-edited form. These results support the notion that the main role of ADAR is to suppress the cellular response to endogenous dsRNA structures.

  12. Gene silencing in Phlebotomine sand flies: xanthine dehydrogenase knock down by dsRNA micro-injections

    Science.gov (United States)

    Sant’ Anna, Mauricio R V; Alexander, Bruce; Bates, Paul A; Dillon, Rod J

    2009-01-01

    Lutzomyia longipalpis are vectors of medically important visceral leishmaniasis in South America. Bloodfed adult females digest large amounts of protein, and xanthine dehydrogenase is thought to be a key enzyme involved in protein catabolism through the production of urate. Large amounts of heme are also released during digestion with potentially damaging consequences, as heme can generate oxygen radicals that damage to lipids, proteins and nucleic acids. However, urate is an anti-oxidant that may prevent such oxidative damage produced by heme. We investigated xanthine dehydrogenase by developing the RNAi technique for sand flies and used this technique to knock down the Lu. longipalpis xanthine dehydrogenase gene to evaluate its role in survival of adult females after blood feeding. The gene sequence of Lu. longipalpis xanthine dehydrogenase is described together with expression in different life cycle stages and RNAi knock down. Semi quantitative RT-PCR of xanthine dehydrogenase expression showed a significant increase in expression after bloodmeal ingestion. Micro-injection of dsRNA via the thorax of 1 day old adult female sand flies resulted in approximately 40% reduction of xanthine dehydrogenase gene expression in comparison to flies injected with a control dsRNA. A significant reduction of urate in the whole body and excretions of Lu. longipalpis was observed after dsRNA xanthine dehydrogenase microinjection and feeding 96h later on rabbit blood. Sand flies injected with XDH dsRNA also exhibit significantly reduced life span in comparison with the mock-injected group when fed on sucrose or when rabbit blood fed, showing that urate could be indeed an important free radical scavenger in Lu. Longipalpis. The demonstration of xanthine dehydrogenase knock down by dsRNA microinjection, low mortality of micro-injected insects and the successful bloodfeeding of injected insects demonstrated the utility of RNAi as a tool for functional analysis of genes in

  13. Social PR study 2015: a study of social media use among PR professionals

    OpenAIRE

    Pole, K.; Cision UK

    2015-01-01

    This study aims to explore and understand how social media impacts PR professionals and their media relationships. It compares the results with research from the published Social Journalism Study 2015 and notes that PR professionals and journalists are largely in agreement about how social media is changing their work environment.

  14. Tips for the PR Chairman for Education Associations. PR Bookshelf No. 2.

    Science.gov (United States)

    National Education Association, Washington, DC.

    This booklet is intended to aid leaders of local education associations in developing a continuing public relations (PR) program aimed at establishing and maintaining a favorable public image for teachers. Although it offers useful guidelines for developing a PR program, the booklet does not contain lists of specific things to do. Instead, it…

  15. Small molecules and antibodies: a means of distinguishing between PrPC and PrPSc

    Science.gov (United States)

    PrPSc and PrPC are isoforms, since they possess identical covalent structures and identical post-translational modifications. The same amino acid may react differently with the same chemical reagent in an isoform-dependent manner. The site of covalent modification can be identified by mass spectrom...

  16. Distinguishing between PrPC and PrPSc using small molecule reagents(Abstract)

    Science.gov (United States)

    Background/Introduction. The structural difference between PrPSc and PrPC is entirely conformational: they are isoforms. Both isoforms possess identical covalent structures and identical post-translational modifications. This means that the same amino acid can react differently with the same chemica...

  17. In silico strategies on prion pathogenic conversion and inhibition from PrPC-PrPSc.

    Science.gov (United States)

    Pagadala, Nataraj S; Syed, Khajamohiddin; Bhat, Rakesh

    2017-03-01

    To date, various therapeutic strategies identified numerous anti-prion compounds and antibodies that stabilize PrP C , block the conversion of PrP C -PrP Sc and increased effect on PrP Sc clearance. However, no suitable drug has been identified clinically so far due to the poor oral absorption, low blood-brain-barrier [BBB] penetration, and high toxicity. Although some of the drugs were proven to be effective in prion-infected cell culture and whole animal models, none of them increased the rate of survival compared to placebo. Areas covered: In this review, the authors highlight the importance of in silico approaches like molecular docking, virtual screening, pharmacophore analysis, molecular dynamics, QSAR, CoMFA and CoMSIA applied to detect molecular mechanisms of prion inhibition and conversion from PrP C -PrP Sc . Expert opinion: Several in silico approaches combined with experimental studies have provided many structural and functional clues on the stability and physiological activity of prion mutants. Further, various studies of in silico and in vivo approaches were also shown to identify several new small organic anti-scrapie compounds to decrease the accumulation of PrP res in cell culture, inhibit the aggregation of a PrP C peptide, and possess pharmacokinetic characteristics that confirm the drug-likeness of these compounds.

  18. Distinguishing between PrPC and PrPSc using small molecule reagents

    Science.gov (United States)

    Background/Introduction. The structural difference between PrPSc and PrPC is entirely conformational: they are isoforms. Both isoforms possess identical covalent structures and identical post-translational modifications. This means that the same amino acid can react differently with the same chemic...

  19. Prédestination ou prédétermination dans l’islam ?

    OpenAIRE

    Djedi, Youcef

    2012-01-01

    Dans ses quelques traitements de la doctrine islamique de la prédestination, Max Weber se réfère à la thèse du pasteur luthérien Friedrich Ulrich sur la prédestination dans l’islam et le christianisme. Or l’un des moments forts de cette thèse consiste précisément à distinguer entre « prédestination» proprement dite et « prédétermination», cette dernière caractérisant alors davantage la conception islamique, tenue pour plus faiblement sotériologique. Consolidée par la caution wébérienne, pour ...

  20. Plasminogen: A cellular protein cofactor for PrPSc propagation

    OpenAIRE

    Mays, Charles E; Ryou, Chongsuk

    2011-01-01

    The biochemical essence of prion replication is the molecular multiplication of the disease-associated misfolded isoform of prion protein (PrP), termed PrPSc, in a nucleic acid-free manner. PrPSc is generated by the protein misfolding process facilitated by conformational conversion of the host-encoded cellular PrP to PrPSc. Evidence suggests that an auxiliary factor may play a role in PrPSc propagation. We and others previously discovered that plasminogen interacts with PrP, while its functi...