WorldWideScience

Sample records for positive-polarity cg flashes

  1. Flash!

    Science.gov (United States)

    Schilling, Govert

    2002-04-01

    About three times a day our sky flashes with a powerful pulse of gamma ray bursts (GRB), invisible to human eyes but not to astronomers' instruments. The sources of this intense radiation are likely to be emitting, within the span of seconds or minutes, more energy than the sun will in its entire 10 billion years of life. Where these bursts originate, and how they come to have such incredible energies, is a mystery scientists have been trying to solve for three decades. The phenomenon has resisted study -- the flashes come from random directions in space and vanish without trace -- until very recently. In what could be called a cinematic conflation of Flash Gordon and The Hunt for Red October, Govert Schilling's Flash!: The Hunt for the Biggest Explosions in the Universe describes the exciting and ever-changing field of GRB research. Based on interviews with leading scientists, Flash! provides an insider's account of the scientific challenges involved in unravelling the enigmatic nature of GRBs. A science writer who has followed the drama from the very start, Schilling describes the ambition and jealousy, collegiality and competition, triumph and tragedy, that exists among those who have embarked on this recherche. Govert Schilling is a Dutch science writer and astronomy publicist. He is a contributing editor of Sky and Telescope magazine, and regularly writes for the news sections of Science and New Scientist. Schilling is the astronomy writer for de Volkskrant, one of the largest national daily newspapers in The Netherlands, and frequently talks about the Universe on Dutch radio broadcasts. He is the author of more than twenty popular astronomy books, and hundreds of newspaper and magazine articles on astronomy.

  2. Floating Inductance and FDNR Using Positive Polarity Current Conveyors

    Directory of Open Access Journals (Sweden)

    K. Pal

    2004-01-01

    Full Text Available A generalized circuit based on five positive polarity second-generation current conveyors is introduced. The circuit simulates a floating inductance, capacitor floatation circuit and floating fdnr. All these circuits use grounded capacitors.

  3. Hot Flashes

    Science.gov (United States)

    Hot flashes Overview Hot flashes are sudden feelings of warmth, which are usually most intense over the face, neck and chest. Your skin might redden, as if you're blushing. Hot flashes can also cause sweating, and if you ...

  4. DW_CG-832

    Data.gov (United States)

    Department of Homeland Security — Flat file data from the Office of Resource Management - Financial Analysis Division, CG-832 used for reporting cost allocation models within the Coast Guard Business...

  5. Statistical Evolution of the Lightning Flash

    Science.gov (United States)

    Zoghzoghy, F. G.; Cohen, M.; Said, R.; Inan, U. S.

    2012-12-01

    Natural lightning is one of the most fascinating and powerful electrical processes on Earth. To date, the physics behind this natural phenomenon are not fully understood, due primarily to the difficulty of obtaining measurements inside thunderstorms and to the wide range of timescales involved (from nanoseconds to seconds). Our aim is to use accurate lightning geo-location data from the National Lightning Detection Network (NLDN) to study statistical patterns in lightning, taking advantage of the fact that millions of lightning flashes occur around the globe every day. We present two sets of results, one involving the patterns of flashes in a storm, and a second involving the patterns of strokes in a flash. These patterns can provide a surrogate measure of the timescales and the spatial extents of the underlying physical processes. First, we study the timescales of charge buildup inside thunderstorms. We find that, following a lightning flash, the probability of another neighboring flash decreases and takes tens of seconds to recover. We find that this suppression effect is a function of flash type, stroke peak current, cloud-to-ground (CG) stroke multiplicity, and other lightning and geographical parameters. We find that the probabilities of subsequent flashes are more suppressed following oceanic lightning, or following flashes with higher peak currents and/or higher multiplicities (for CG flashes). Second, we use NLDN data to study the evolution of the strokes within a CG flash. A CG flash typically includes multiple return strokes, which can occur in the same channel or in multiple channels within a few kilometers. We cluster NLDN stroke data into flashes and produce the probability density function of subsequent strokes as a function of distance and time-delays relative to the previous stroke. Using this technique, we investigate processes which occur during the CG lightning flash with nanosecond to millisecond timescales. For instance, our results suggest

  6. Flash grundkursus

    DEFF Research Database (Denmark)

    Jensen, Henrik

    2008-01-01

    Flash er et programmeringssprog  og kan som sådant ikke noget i sig selv. Kursets mål er, at give den studerende et grundlæggende kendskab til Flash, så det kan bruges til præsentationer på skærm og til produktion af hjemmesider. På kurset arbejdes der med billede, grafik, lyd, video og interakti...

  7. An Analysis of Total Lightning Flash Rates Over Florida

    Science.gov (United States)

    Mazzetti, Thomas O.; Fuelberg, Henry E.

    2017-12-01

    Although Florida is known as the "Sunshine State", it also contains the greatest lightning flash densities in the United States. Flash density has received considerable attention in the literature, but lightning flash rate has received much less attention. We use data from the Earth Networks Total Lightning Network (ENTLN) to produce a 5 year (2010-2014) set of statistics regarding total flash rates over Florida and adjacent regions. Instead of tracking individual storms, we superimpose a 0.2° × 0.2° grid over the study region and count both cloud-to-ground (CG) and in-cloud (IC) flashes over 5 min intervals. Results show that the distribution of total flash rates is highly skewed toward small values, whereas the greatest rate is 185 flashes min-1. Greatest average annual flash rates ( 3 flashes min-1) are located near Orlando. The southernmost peninsula, North Florida, and the Florida Panhandle exhibit smaller average annual flash rates ( 1.5 flashes min-1). Large flash rates > 100 flashes min-1 can occur during any season, at any time during the 24 h period, and at any location within the domain. However, they are most likely during the afternoon and early evening in East Central Florida during the spring and summer months.

  8. Initial Breakdown Pulse Amplitudes in Intracloud and Cloud-to-Ground Lightning Flashes

    Science.gov (United States)

    Marshall, T. C.; Smith, E. M.; Stolzenburg, M.; Karunarathne, S.; Siedlecki, R. D., II

    2017-12-01

    This study analyzes the largest initial breakdown (IB) pulse in flashes from three storms in Florida. The study was motivated in part by the possibility that IB pulses of IC flashes may cause of terrestrial gamma-ray flashes (TGFs). The range-normalized, zero-to-peak amplitude of the largest IB pulse within each flash was determined along with its altitude, duration, and occurrence time in the flash. Appropriate data were available for 40 intracloud (IC) and 32 cloud-to-ground (CG) flashes. Histograms of the magnitude of the largest IB pulse amplitude by flash type were similar, with mean (median) values of 1.49 (1.05) V/m for IC flashes and -1.35 (-0.87) V/m for CG flashes. The mean amplitude of the largest IC IB pulses are substantially smaller (roughly an order of magnitude smaller) than the few known pulse amplitudes of TGF events and TGF candidate events. The largest IB pulse in 30 IC flashes showed a weak inverse relation between pulse amplitude and altitude. Amplitude of the largest IB pulse for 25 CG flashes showed no altitude correlation. Duration of the largest IB pulse in ICs averaged twice as long as in CGs (96 μs versus 46 μs); all of the CG durations were <100 μs. Among the ICs, there is a positive relation between largest IB pulse duration and amplitude; the linear correlation coefficient is 0.385 with outliers excluded. The largest IB pulse in IC flashes typically occurred at a longer time after the first IB pulse (average 4.1 ms) than was the case in CG flashes (average 0.6 ms). In both flash types, the largest IB pulse was the first IB pulse in about 30% of the cases.

  9. Flash evaporator

    OpenAIRE

    1997-01-01

    A device and method for flash evaporating a reagent includes an evaporation chamber that houses a dome on which evaporation occurs. The dome is solid and of high thermal conductivity and mass, and may be heated to a temperature sufficient to vaporize a specific reagent. The reagent is supplied from an external source to the dome through a nozzle, and may be supplied as a continuous stream, as a shower, and as discrete drops. A carrier gas may be introduced into the evaporation chamber and cre...

  10. Bipolar cloud-to-ground lightning flash observations

    Science.gov (United States)

    Saba, Marcelo M. F.; Schumann, Carina; Warner, Tom A.; Helsdon, John H.; Schulz, Wolfgang; Orville, Richard E.

    2013-10-01

    lightning is usually defined as a lightning flash where the current waveform exhibits a polarity reversal. There are very few reported cases of cloud-to-ground (CG) bipolar flashes using only one channel in the literature. Reports on this type of bipolar flashes are not common due to the fact that in order to confirm that currents of both polarities follow the same channel to the ground, one necessarily needs video records. This study presents five clear observations of single-channel bipolar CG flashes. High-speed video and electric field measurement observations are used and analyzed. Based on the video images obtained and based on previous observations of positive CG flashes with high-speed cameras, we suggest that positive leader branches which do not participate in the initial return stroke of a positive cloud-to-ground flash later generate recoil leaders whose negative ends, upon reaching the branch point, traverse the return stroke channel path to the ground resulting in a subsequent return stroke of opposite polarity.

  11. Weak positive cloud-to-ground flashes in Northeastern Colorado

    Science.gov (United States)

    Lopez, Raul E.; Maier, Michael W.; Garcia-Miguel, Juan A.; Holle, Ronald L.

    1991-01-01

    The frequency distributions of the peak magnetic field associated with the first detected return stroke of positive and negative cloud-to-ground (CG) flashes were studied using lightning data from northeastern Colorado. These data were obtained during 1985 with a medium-to-high gain network of three direction finders (DF's). The median signal strength of positive flashes was almost two times that of the negatives for flashes within 300 km of the DF's, which have an inherent detection-threshold bias that tends to discriminate against weak signals. This bias increases with range, and affects the detection of positive and negative flashes in different ways, because of the differing character of their distributions. Positive flashes appear to have a large percentage of signals clustered around very weak values that are lost to the medium-to-high gain Colorado Detection System very quickly with increasing range. The resulting median for positive signals could thus appear to be much larger than the median for negative signals, which are more clustered around intermediate values. When only flashes very close to the DF's are considered, however, the two distributions have almost identical medians. The large percentage of weak positive signals detected close to the DF's has not been explored previously. They have been suggested to come from intracloud discharges and thus are improperly classified as CG flashes. Evidence in hand, points to their being real positive, albeit weak CG flashes. Whether or not they are real positive ground flashes, it is important to be aware of their presence in data from magnetic DF networks.

  12. DIRCM FLASH Flight Tests

    National Research Council Canada - National Science Library

    Molocher, Bernhard; Kaltenecker, Anton; Thum-Jaeger, Andrea; Regensburger, Martin; Formery, Martin

    2005-01-01

    .... FLASH operation is as follows: After handover following an alarm from the missile warning system FLASH enters autonomous passive tracking mode for tracking a missiles and sending a laser beam onto the missile...

  13. Flash Platform Examination

    Science.gov (United States)

    2011-03-01

    than would be performed in software”[108]. Uro Tinic, one of the Flash player’s engineers, further clarifies exactly what Flash player 10 hardware...www.adobe.com/products/flashplayer/features/ (Access date: 28 Sep 2009). [109] Uro , T. What Does GPU Acceleration Mean? (online), http...133] Shorten, A. (2009), Design to Development: Flash Catalyst to Flash Builder, In Proceedings of Adobe Max 2009, Los Angeles, CA. 142 DRDC

  14. Spherical ion oscillations in a positive polarity gridded inertial-electrostatic confinement device

    Energy Technology Data Exchange (ETDEWEB)

    Bandara, R.; Khachan, J. [Plasma Physics, School of Physics, University of Sydney, Camperdown, New South Wales 2006 (Australia)

    2013-07-15

    A pulsed, positive polarity gridded inertial electrostatic confinement device has been investigated experimentally, using a differential emissive probe and potential traces as primary diagnostics. Large amplitude oscillations in the plasma current and plasma potential were observed within a microsecond of the discharge onset, which are indicative of coherent ion oscillations about a temporarily confined excess of recirculating electron space charge. The magnitude of the depth of the potential well in the established virtual cathode was determined using a differential emissive Langmuir probe, which correlated well to the potential well inferred from the ion oscillation frequency for both hydrogen and argon experiments. It was found that the timescale for ion oscillation dispersion is strongly dependent on the neutral gas density, and weakly dependent on the peak anode voltage. The cessation of the oscillations was found to be due to charge exchange processes converting ions to high velocity neutrals, causing the abrupt de-coherence of the oscillations through an avalanche dispersion in phase space.

  15. Spherical ion oscillations in a positive polarity gridded inertial-electrostatic confinement device

    Science.gov (United States)

    Bandara, R.; Khachan, J.

    2013-07-01

    A pulsed, positive polarity gridded inertial electrostatic confinement device has been investigated experimentally, using a differential emissive probe and potential traces as primary diagnostics. Large amplitude oscillations in the plasma current and plasma potential were observed within a microsecond of the discharge onset, which are indicative of coherent ion oscillations about a temporarily confined excess of recirculating electron space charge. The magnitude of the depth of the potential well in the established virtual cathode was determined using a differential emissive Langmuir probe, which correlated well to the potential well inferred from the ion oscillation frequency for both hydrogen and argon experiments. It was found that the timescale for ion oscillation dispersion is strongly dependent on the neutral gas density, and weakly dependent on the peak anode voltage. The cessation of the oscillations was found to be due to charge exchange processes converting ions to high velocity neutrals, causing the abrupt de-coherence of the oscillations through an avalanche dispersion in phase space.

  16. Performance of a plasma opening switch in positive polarity on Gamble I using flashboard plasma sources

    International Nuclear Information System (INIS)

    Renk, T.J.

    1995-01-01

    The successful development of the Plasma Opening Switch (POS) for inductive storage applications has been largely confined to negative polarity operation. Some models of POS behavior suggest that this is because in a positive polarity coaxial configuration, the weaker magnetic field at the cathode position retards the switch opening process. This article describes experiments in which both conductor radii in the POS region were significantly reduced. Anode- and cathode-side current monitors indicate that voltages greater than open-circuit are generated at the POS position, but there is a significant amount of electron flow out of the POS, depending upon load impedance. Flow impedance analysis indicates that a relatively small gap appears in the POS plasma after switch opening. Switch performance is also compared between flashboard and carbon gun plasma sources, with the latter operated both in positive and negative polarity

  17. Parallel preconditioning techniques for sparse CG solvers

    Energy Technology Data Exchange (ETDEWEB)

    Basermann, A.; Reichel, B.; Schelthoff, C. [Central Institute for Applied Mathematics, Juelich (Germany)

    1996-12-31

    Conjugate gradient (CG) methods to solve sparse systems of linear equations play an important role in numerical methods for solving discretized partial differential equations. The large size and the condition of many technical or physical applications in this area result in the need for efficient parallelization and preconditioning techniques of the CG method. In particular for very ill-conditioned matrices, sophisticated preconditioner are necessary to obtain both acceptable convergence and accuracy of CG. Here, we investigate variants of polynomial and incomplete Cholesky preconditioners that markedly reduce the iterations of the simply diagonally scaled CG and are shown to be well suited for massively parallel machines.

  18. Automated Studies of Continuing Current in Lightning Flashes

    Science.gov (United States)

    Martinez-Claros, Jose

    Continuing current (CC) is a continuous luminosity in the lightning channel that lasts longer than 10 ms following a lightning return stroke to ground. Lightning flashes following CC are associated with direct damage to power lines and are thought to be responsible for causing lightning-induced forest fires. The development of an algorithm that automates continuing current detection by combining NLDN (National Lightning Detection Network) and LEFA (Langmuir Electric Field Array) datasets for CG flashes will be discussed. The algorithm was applied to thousands of cloud-to-ground (CG) flashes within 40 km of Langmuir Lab, New Mexico measured during the 2013 monsoon season. It counts the number of flashes in a single minute of data and the number of return strokes of an individual lightning flash; records the time and location of each return stroke; performs peak analysis on E-field data, and uses the slope of interstroke interval (ISI) E-field data fits to recognize whether continuing current (CC) exists within the interval. Following CC detection, duration and magnitude are measured. The longest observed C in 5588 flashes was 631 ms. The performance of the algorithm (vs. human judgement) was checked on 100 flashes. At best, the reported algorithm is "correct" 80% of the time, where correct means that multiple stations agree with each other and with a human on both the presence and duration of CC. Of the 100 flashes that were validated against human judgement, 62% were hybrid. Automated analysis detects the first but misses the second return stroke in many cases where the second return stroke is followed by long CC. This problem is also present in human interpretation of field change records.

  19. NAND flash memory technologies

    CERN Document Server

    Aritome, Seiichi

    2016-01-01

    This book discusses basic and advanced NAND flash memory technologies, including the principle of NAND flash, memory cell technologies, multi-bits cell technologies, scaling challenges of memory cell, reliability, and 3-dimensional cell as the future technology. Chapter 1 describes the background and early history of NAND flash. The basic device structures and operations are described in Chapter 2. Next, the author discusses the memory cell technologies focused on scaling in Chapter 3, and introduces the advanced operations for multi-level cells in Chapter 4. The physical limitations for scaling are examined in Chapter 5, and Chapter 6 describes the reliability of NAND flash memory. Chapter 7 examines 3-dimensional (3D) NAND flash memory cells and discusses the pros and cons in structure, process, operations, scalability, and performance. In Chapter 8, challenges of 3D NAND flash memory are dis ussed. Finally, in Chapter 9, the author summarizes and describes the prospect of technologies and market for the fu...

  20. Pro Android Flash

    CERN Document Server

    Chin, Stephen; Campesato, Oswald

    2011-01-01

    Did you know you can take your Flash skills beyond the browser, allowing you to make apps for Android, iOS and the BlackBerry Tablet OS? Build dynamic apps today starting with the easy-to-use Android smartphones and tablets. Then, take your app to other platforms without writing native code. Pro Android Flash is the definitive guide to building Flash and other rich Internet applications (RIAs) on the Android platform. It covers the most popular RIA frameworks for Android developers - Flash and Flex - and shows how to build rich, immersive user experiences on both Android smartphones and tablet

  1. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Jie; Zhang, Linlin [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Li, E-mail: lili@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Chunyan; Wang, Ting [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Zhang, Guofan, E-mail: gfzhang@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China)

    2015-08-15

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  2. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    International Nuclear Information System (INIS)

    Meng, Jie; Zhang, Linlin; Li, Li; Li, Chunyan; Wang, Ting; Zhang, Guofan

    2015-01-01

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  3. Observation of reflected waves on the SABRE positive polarity inductive adder MITL

    International Nuclear Information System (INIS)

    Cuneo, M.E.; Poukey, J.W.; Mendel, C.W.; Rosenthal, S.E.; Hanson, D.L.; Smith, J.R.; Maenchen, J.E.; Wenger, D.F.; Bernard, M.A.

    1993-01-01

    We are studying the coupling of extraction applied-B ion diodes to Magnetically Insulated Transmission Line (MITLs) on the SABRE (Sandia Accelerator and Beam Research Experiment, 6 MV, 300 kA) positive polarity inductive voltage adder. Our goal is to determine conditions under which efficient coupling occurs. The best total power efficiency for an ideal ion diode load (i.e., without parasitic losses) is obtained by maximizing the product of cathode current and gap voltage. MITLs require that the load impedance be undermatched to the self-limited line operating impedance for efficient transfer of power to ion diodes, independent of transit time isolation, and even in the case of multiple cathode system with significant vacuum electron flow. We observe that this undermatched condition results in a reflected wave which decreases the line voltage and gap electron sheath current, and increases the anode and cathode current in a time-dependent way. The MITL diode coupling is determined by the flow impedance at the adder exit. We also show that the flow impedance increases along the extension MITL on SABRE. Experimental measurements of current and peak voltage are compared to analytical models and TWOQUICK 2.5-D PIC code simulations

  4. Energetic ion emission in a positive polarity nanosecond plasma opening switch

    International Nuclear Information System (INIS)

    Sarfaty, M.; Krasik, Ya.E.; Weingarten, A.; Fruchtman, A.; Maron, Y.

    1996-01-01

    The emission was studied of energetic ions from the plasma in a coaxial Plasma Opening Switch (POS) powered by a 300 kV, 15 kA, 90 ns positive polarity pulse. Fluxes lasting 2 - 3 ns of ions flowing radially onto the cathode were observed at all axial locations of the switch plasma within 5 ns of the beginning of the upstream POS current. It is suggested that the termination of this ion flux is due to the formation of a cathode plasma, which is consistent with our spectroscopic measurements. Later in the pulse, longer duration (100 ns) ion fluxes were observed radially, first appearing in the generator side of the switch plasma. Fluxes 30 - 40 ns long of ions flowing axially towards the POS load at velocities (2±1) x 10 8 cm/s were also observed. The dependences of the start time of the axial ion flow, of the ion velocities, and of the ion flux on the POS operation parameters were studied. (author). 6 figs., 5 refs

  5. Energetic ion emission in a positive polarity nanosecond plasma opening switch

    Energy Technology Data Exchange (ETDEWEB)

    Sarfaty, M [Univ. of Wisconsin, Madison, WI (United States); Krasik, Ya E; Weingarten, A; Fruchtman, A; Maron, Y [Weizmann Institute of Science, Rehovot (Israel). Department of Physics

    1997-12-31

    The emission was studied of energetic ions from the plasma in a coaxial Plasma Opening Switch (POS) powered by a 300 kV, 15 kA, 90 ns positive polarity pulse. Fluxes lasting 2 - 3 ns of ions flowing radially onto the cathode were observed at all axial locations of the switch plasma within 5 ns of the beginning of the upstream POS current. It is suggested that the termination of this ion flux is due to the formation of a cathode plasma, which is consistent with our spectroscopic measurements. Later in the pulse, longer duration (100 ns) ion fluxes were observed radially, first appearing in the generator side of the switch plasma. Fluxes 30 - 40 ns long of ions flowing axially towards the POS load at velocities (2{+-}1) x 10{sup 8} cm/s were also observed. The dependences of the start time of the axial ion flow, of the ion velocities, and of the ion flux on the POS operation parameters were studied. (author). 6 figs., 5 refs.

  6. Flash-Type Discrimination

    Science.gov (United States)

    Koshak, William J.

    2010-01-01

    This viewgraph presentation describes the significant progress made in the flash-type discrimination algorithm development. The contents include: 1) Highlights of Progress for GLM-R3 Flash-Type discrimination Algorithm Development; 2) Maximum Group Area (MGA) Data; 3) Retrieval Errors from Simulations; and 4) Preliminary Global-scale Retrieval.

  7. Long-Term Charge/Discharge Cycling Stability of MnO2 Aqueous Supercapacitor under Positive Polarization

    KAUST Repository

    Ataherian, Fatemeh; Wu, Nae-Lih

    2011-01-01

    The long-term charge/discharge cycling stability of MnO 2 electrode under positive polarization in aqueous KCl electrolyte has been studied over different potential windows spanning from the open circuit potential to varied higher-end potential

  8. hCG Test (Pregnancy Test)

    Science.gov (United States)

    ... Acidosis and Alkalosis Adrenal Insufficiency and Addison Disease Alcoholism Allergies Alzheimer Disease Anemia Angina Ankylosing Spondylitis Anthrax ... Patient Resources For Health Professionals Subscribe Search hCG Pregnancy Send Us Your Feedback Choose Topic At a ...

  9. Prolog+CG: A Maintainer's Perspective

    DEFF Research Database (Denmark)

    Petersen, Ulrik

    2006-01-01

    Prolog+CG is an implementation of Prolog with Conceptual Graphs as first-class datastructures, on a par with terms. As such, it lends itself well to applications in which reasoning with Conceptual Graphs and/or ontologies plays a role. It  as originally developed by Prof. Dr. Adil Kabbaj, who......, we offer some general observations about the tenets that make Prolog+CG a success....

  10. Floods and Flash Flooding

    Science.gov (United States)

    Floods and flash flooding Now is the time to determine your area’s flood risk. If you are not sure whether you ... If you are in a floodplain, consider buying flood insurance. Do not drive around barricades. If your ...

  11. Biological functions of hCG and hCG-related molecules

    Directory of Open Access Journals (Sweden)

    Cole Laurence A

    2010-08-01

    Full Text Available Abstract Background hCG is a term referring to 4 independent molecules, each produced by separate cells and each having completely separate functions. These are hCG produced by villous syncytiotrophoblast cells, hyperglycosylated hCG produced by cytotrophoblast cells, free beta-subunit made by multiple primary non-trophoblastic malignancies, and pituitary hCG made by the gonadotrope cells of the anterior pituitary. Results and discussion hCG has numerous functions. hCG promotes progesterone production by corpus luteal cells; promotes angiogenesis in uterine vasculature; promoted the fusion of cytotrophoblast cell and differentiation to make syncytiotrophoblast cells; causes the blockage of any immune or macrophage action by mother on foreign invading placental cells; causes uterine growth parallel to fetal growth; suppresses any myometrial contractions during the course of pregnancy; causes growth and differentiation of the umbilical cord; signals the endometrium about forthcoming implantation; acts on receptor in mother's brain causing hyperemesis gravidarum, and seemingly promotes growth of fetal organs during pregnancy. Hyperglycosylated hCG functions to promote growth of cytotrophoblast cells and invasion by these cells, as occurs in implantation of pregnancy, and growth and invasion by choriocarcinoma cells. hCG free beta-subunit is produced by numerous non-trophoblastic malignancies of different primaries. The detection of free beta-subunit in these malignancies is generally considered a sign of poor prognosis. The free beta-subunit blocks apoptosis in cancer cells and promotes the growth and malignancy of the cancer. Pituitary hCG is a sulfated variant of hCG produced at low levels during the menstrual cycle. Pituitary hCG seems to mimic luteinizing hormone actions during the menstrual cycle.

  12. Target organ of hCG

    International Nuclear Information System (INIS)

    Yanaginuma, Tsutomu; Kobayashi, Takuro

    1974-01-01

    The author and his associated gave intravenous infusions of hCG labeled with 125 I to female rats and investigated its distribution in their brains. The results showed a significantly higher radioactivity in the median eminence than in the other parts of the brain. This indicated that there were receptors of hCG in the median eminence of the hypothalamus of a female rat. The mechanism of gonadotropin action was also discussed in this report. By giving 125 I and 125 I-BSA to the same rats which had been used in the study of hCG distribution in the brain, and by investigating the radioactivity of their ovaries, the author explained the receptor of gonadotropin in corpora lutea. (Serizawa, K.)

  13. Professional Flash Lite Mobile Development

    CERN Document Server

    Anderson, J G

    2010-01-01

    Discover how to create Flash Lite mobile apps from the ground up. Adobe Flash is an ideal choice for developing rich interactive content for "Flash-enabled" mobile devices; and with this book, you'll learn how to create unique applications with Flash Lite. Through a series of code samples and extensive example applications, you'll explore the core concepts, key features, and best practices of the Flash Lite player. Coverage reveals various ways to develop Flash mobile content, create applications with a cross-platform programming framework based on the Model, View and Controller conc

  14. Timing in a FLASH

    Science.gov (United States)

    Hoek, M.; Cardinali, M.; Corell, O.; Dickescheid, M.; Ferretti B., M. I.; Lauth, W.; Schlimme, B. S.; Sfienti, C.; Thiel, M.

    2017-12-01

    A prototype detector, called FLASH (Fast Light Acquiring Start Hodoscope), was built to provide precise Time-of-Flight (TOF) measurements and reference timestamps for detector setups at external beam lines. Radiator bars, made of synthetic fused silica, were coupled to a fast MCP-PMT with 64 channels and read out with custom electronics using Time-over-Threshold (TOT) for signal characterization. The TRB3 system, a high-precision TDC implemented in an FPGA, was used as data acquisition system. The performance of a system consisting of two FLASH units was investigated at a dedicated test experiment at the Mainz Microtron (MAMI) accelerator using its 855 MeV electron beam. The TOT measurement enabled time walk corrections and an overall TOF resolution of ∼70 ps could be achieved which translates into a resolution of ∼50 ps per FLASH unit. The intrinsic resolution of the frontend electronics including the TDC was measured to be less than 25 ps.

  15. Foundation Flash Cartoon Animation

    CERN Document Server

    Jones, Tim; Rosson, Allan S

    2008-01-01

    One of Flash s most common uses is still animation for cartoons, games, advertising etc, and this book takes a fresh look at the topic, breaking it down pre-production, production, and post production, and looking at each section in detail, and covering topics such as storyboarding, character libraries and camera mechanics like no Flash book has before. The book is written by members of the Emmy award winning ANIMAX team, who have created work for clients such as Disney, AOL, Fox, WWE, ESPN, and Sesame workshop. This book is an opportunity for them to share their secrets, and is written to sui

  16. Flash x-ray

    International Nuclear Information System (INIS)

    Johnson, Q.; Pellinen, D.

    1976-01-01

    The complementary techniques of flash x-ray radiography (FXR) and flash x-ray diffraction (FXD) provide access to a unique domain in nondestructive materials testing. FXR is useful in studies of macroscopic properties during extremely short time intervals, and FXD, the newer technique, is used in studies of microscopic properties. Although these techniques are similar in many respects, there are some substantial differences. FXD generally requires low-voltage, line-radiation sources and extremely accurate timing; FXR is usually less demanding. Phenomena which can be profitably studied by FXR often can also be studied by FXD to permit a complete materials characterization

  17. Theory of optical flashes

    International Nuclear Information System (INIS)

    London, R.A.

    1983-01-01

    The theory of optical flashes created by x- and γ-ray burst heating of stars in binaries is reviewed. Calculations of spectra due to steady-state x-ray reprocessing and estimates of the fundamental time scales for the non-steady case are discussed. The results are applied to the extant optical data from x-ray and γ-ray bursters. Finally, I review predictions of flashes from γ-ray bursters detectable by a state of the art all-sky optical monitor

  18. Learning Flash CS4 Professional

    CERN Document Server

    Shupe, Rich

    2009-01-01

    Learning Flash CS4 Professional offers beginners and intermediate Flash developers a unique introduction to the latest version of Adobe's powerful multimedia application. This easy-to-read book is loaded with full-color examples and hands-on tasks to help you master Flash CS4's new motion editor, integrated 3D system, and character control using the new inverse kinematics bones animation system. No previous Flash experience is necessary.

  19. Jaan Toomik Flash Artis

    Index Scriptorium Estoniae

    1999-01-01

    1999. a. mai-juuni 'Flash Artis' on ajakirja Eesti korrespondendi Ando Keskküla artikkel Jaan Toomikust. Jaan Toomik on kutsutud esinema Londoni The Photographers' Gallery grupinäitusele, tema videot 'Father and Son' näidatakse Londonis avataval näitusel 'Near and Elsewhere' 11.-24. juunini

  20. Inessa Josing Flash Artis

    Index Scriptorium Estoniae

    1999-01-01

    'Flash Art'i' 1998. a. nov.-dets. numbris Rosa Martínezi artiklis suvisest Manifesta II näitusest Luxembourg'is on positiivselt mainitud ka Inessa Josingut. Illustratsiooniks toodud seitsmest fotost ühel on I. Josingu aknakujundus 'What Must I Do to be Saved?'

  1. Physics Flash August 2016

    Energy Technology Data Exchange (ETDEWEB)

    Kippen, Karen Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-25

    Physics Flash is the newsletter for the Physics Division at Los Alamos National Laboratory. This newsletter is for August 2016. The following topics are covered: "Accomplishments in the Trident Laser Facility", "David Meyerhofer elected as chair-elect APS Nominating Committee", "HAWC searches for gamma rays from dark matter", "Proton Radiography Facility commissions electromagnetic magnifier", and "Cosmic ray muon computed tomography of spent nuclear fuel in dry storage casks."

  2. The lightning flash

    CERN Document Server

    Cooray, Vernon

    2014-01-01

    With contributions from today's leading lightning engineers and researchers, this updated 2nd edition of Vernon Cooray's classic text, The Lightning Flash provides the reader with an essential introduction to lightning and its impact on electrical and electronic equipment. Providing the reader with a thorough background into almost every aspect of lightning and its impact on electrical and electronic equipment, this new edition is updated throughout and features eight new chapters that bring the science up to date.

  3. Deconstructing continuous flash suppression

    OpenAIRE

    Yang, Eunice; Blake, Randolph

    2012-01-01

    In this paper, we asked to what extent the depth of interocular suppression engendered by continuous flash suppression (CFS) varies depending on spatiotemporal properties of the suppressed stimulus and CFS suppressor. An answer to this question could have implications for interpreting the results in which CFS influences the processing of different categories of stimuli to different extents. In a series of experiments, we measured the selectivity and depth of suppression (i.e., elevation in co...

  4. Coherent imaging at FLASH

    International Nuclear Information System (INIS)

    Chapman, H N; Bajt, S; Duesterer, S; Treusch, R; Barty, A; Benner, W H; Bogan, M J; Frank, M; Hau-Riege, S P; Woods, B W; Boutet, S; Cavalleri, A; Hajdu, J; Iwan, B; Seibert, M M; Timneanu, N; Marchesini, S; Sakdinawat, A; Sokolowski-Tinten, K

    2009-01-01

    We have carried out high-resolution single-pulse coherent diffractive imaging at the FLASH free-electron laser. The intense focused FEL pulse gives a high-resolution low-noise coherent diffraction pattern of an object before that object turns into a plasma and explodes. In particular we are developing imaging of biological specimens beyond conventional radiation damage resolution limits, developing imaging of ultrafast processes, and testing methods to characterize and perform single-particle imaging.

  5. Physics Flash December 2016

    Energy Technology Data Exchange (ETDEWEB)

    Kippen, Karen Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). ADEPS Communications

    2016-12-01

    This is the December 2016 issue of Physics Flash, the newsletter of the Physics Division of Los Alamos National Laboratory (LANL). In this issue, the following topics are covered: Novel liquid helium technique to aid highly sensitive search for a neutron electrical dipole moment; Silverleaf: Prototype Red Sage experiments performed at Q-site; John L. Kline named 2016 APS Fellow; Physics students in the news; First Entropy Engine quantum random number generator hits the market; and celebrating service.

  6. USA hCG reference service, 10-year report.

    Science.gov (United States)

    Cole, Laurence A; Laidler, Laura L; Muller, Carolyn Y

    2010-08-01

    The USA hCG Reference Service has been dealing with cases of persistent low levels of hCG and gestational trophoblastic diseases for 10years. Here we present the complete experience. Total hCG in serum and urine was measured using the Siemen's Immulite 1000 assay. Hyperglycosylated hCG, nicked hCG, free ss-subunit and ss-core fragment were measured using microtiterplate assays with antibodies B152, B151, FBT11 and B210, respectively. The USA hCG Reference Service has identified 83 cases of false-positive hCG, 71 cases of aggressive gestational trophoblastic disease (GTD), 52 cases of minimally invasive GTD, 168 cases of quiescent GTD and 22 cases of placenta site trophoblastic tumor (PSTT). In addition, 103 cases of pituitary hCG have been identified, 60 cases of nontrophoblastic tumor, 4 cases of inherited hCG and 2 cases of Munchausen's syndrome. This is 565 cases total. Multiple new methods are described and tested for diagnosing all of these disorders. The USA hCG Reference Service experience shows new methods for detecting multiple hCG-related disorders and recommends new approaches for detecting these hCG-related disorders. 2010 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  7. [Children with hyperthyroidism due to elevated hCG levels].

    Science.gov (United States)

    Jöbsis, Jasper J; van Trotsenburg, A S Paul; Merks, Johannes H M; Kamp, Gerdine A

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking effect, hCG can induce high oestradiol levels, resulting in stormy pubertal development. False negative hCG tests due to the high-dose hook effect may complicate the diagnostic process. In patients with antibody-negative thyrotoxicosis, the diagnosis of hCG-induced hyperthyroidism must be considered.

  8. PICTURE, 2-D Slices Through 3-D CG of MORSE, QAD-CG

    International Nuclear Information System (INIS)

    1994-01-01

    1 - Description of program or function: Picture generates plots of two-dimensional slices through the three-dimensional geometry described by the combinatorial geometry (CG) package used in such codes as MORSE and QAD-CG. These plots are printed on a standard line printer. 2 - Method of solution: Several different ways are available to obtain a two-dimensional slice through the geometry. The geometry ray tracing capability is tested by forcing the geometry package to execute the routines and logic of the Monte Carlo random walk or kernel integration algorithms. 3 - Restrictions on the complexity of the problem: None tested besides those listed in the input descriptions

  9. Long-Term Charge/Discharge Cycling Stability of MnO2 Aqueous Supercapacitor under Positive Polarization

    KAUST Repository

    Ataherian, Fatemeh

    2011-01-01

    The long-term charge/discharge cycling stability of MnO 2 electrode under positive polarization in aqueous KCl electrolyte has been studied over different potential windows spanning from the open circuit potential to varied higher-end potential limited by O 2 evolution. Cycling up to 1.2 V (vs Ag/AgCl (aq)) causes partial (35) capacitance fading to a plateau value within the initial cycles, accompanied by morphological reconstruction, reduction of surface Mn ions and oxygen evolution. The surface Mn-ion reduction has been attributed to a two-step oxidation-reduction mechanism involving OH oxidation in electrolyte, based on electrochemical analysis. When cycling potential extends to 1.4 V, extensive oxygen evolution takes place. The combination of surface passivation of current collector and extensive gas bubbling, which deteriorates electrical contact among the constituent particles within the electrode, results in further monotonic capacitance reduction. © 2011 The Electrochemical Society.

  10. Determination of hCG-alpha subunit in threatened pregnancy

    International Nuclear Information System (INIS)

    Talas, M.; Pohanka, J.; Fingerova, H.; Janouskova, M.; Krikal, Z.; Prasilova, J.; Zupkova, H.

    1987-01-01

    Radioimmunoassay of the hCG-alpha subunit was made using an antibody anti hCG-alpha serum, highly purified hCG-alpha for 125 I-labelling and the standard hCG-alpha. Sera of healthy pregnant women sampled throughout the whole pregnancies were used to determine x-bar±S.D. of hCG-alpha for 14-day intervals. Included in the study were groups of women with high risk of premature labor, late toxemia of pregnancy, twins and fetal hypotrophy. It was shown that increased hCG-alpha is found in pregnant women in whom signs of late toxemia of pregnancy are combined with high risk of premature labor, or with twin pregnancies, while in those with fetal hypotrophy hCG-alpha is within normal limits. (author). 3 figs., 7 refs

  11. Analysis list: CG8478 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CG8478 Cell line,Embryo,Pupae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/...target/CG8478.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/CG8478.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/CG8478.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Ce...ll_line.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Embryo.tsv,http://dbarchive.bioscie...ncedbc.jp/kyushu-u/dm3/colo/CG8478.Pupae.tsv http://dbarchive.biosciencedbc.jp/kyus

  12. Flashing inception in flowing liquids

    International Nuclear Information System (INIS)

    Jones, O.C. Jr.

    1979-01-01

    The inception of net vaporization in flashing flows is examined. It is suggested that the flashing inception can be expressed as two additive effects. One is due to the static decompression which is a function of the spinodal limit and also of the expansion rate. The other effect which is a function of Reynolds number and flashing index, is due to the turbulent fluctuations of the flowing liquid. It is shown that by taking a three standard deviation band on the turbulent velocity fluctuations, an adequate representation of the inverse mass flux effect on flashing inception for existing data is obtained

  13. Flash X-ray

    International Nuclear Information System (INIS)

    Sato, Eiichi

    2003-01-01

    Generation of quasi-monochromatic X-ray by production of weakly ionized line plasma (flash X-ray), high-speed imaging by the X-ray and high-contrast imaging by the characteristic X-ray absorption are described. The equipment for the X-ray is consisted from the high-voltage power supply and condenser, turbo molecular pump, and plasma X-ray tube. The tube has a long linear anticathode to produce the line plasma and flash X-ray at 20 kA current at maximum. X-ray spectrum is measured by the imaging plate equipped in the computed radiography system after diffracted by a LiF single crystal bender. Cu anticathode generates sharp peaks of K X-ray series. The tissue images are presented for vertebra, rabbit ear and heart, and dog heart by X-ray fluoroscopy with Ce anticathode. Generation of K-orbit characteristic X-ray with extremely low bremsstrahung is to be attempted for medical use. (N.I.)

  14. VAM3D-CG configuration management plan

    International Nuclear Information System (INIS)

    Langford, D.W.

    1994-01-01

    The VAM3D-CG computer code has been licensed for use at Hanford, from HydroGeologic, Inc., of Herndon, VA. Version 2.4b has been installed on the 3200GWW workstations, and is currently under configuration management. The purpose of this report is to describe the installation and configuration management of VAM3D-CG on the Hanford Computer System. VAM3D-CG is written in standard FORTRAN F77

  15. Spatio-temporal dimension of lightning flashes based on three-dimensional Lightning Mapping Array

    Science.gov (United States)

    López, Jesús A.; Pineda, Nicolau; Montanyà, Joan; Velde, Oscar van der; Fabró, Ferran; Romero, David

    2017-11-01

    3D mapping system like the LMA - Lightning Mapping Array - are a leap forward in lightning observation. LMA measurements has lead to an improvement on the analysis of the fine structure of lightning, allowing to characterize the duration and maximum extension of the cloud fraction of a lightning flash. During several years of operation, the first LMA deployed in Europe has been providing a large amount of data which now allows a statistical approach to compute the full duration and horizontal extension of the in-cloud phase of a lightning flash. The "Ebro Lightning Mapping Array" (ELMA) is used in the present study. Summer and winter lighting were analyzed for seasonal periods (Dec-Feb and Jun-Aug). A simple method based on an ellipse fitting technique (EFT) has been used to characterize the spatio-temporal dimensions from a set of about 29,000 lightning flashes including both summer and winter events. Results show an average lightning flash duration of 440 ms (450 ms in winter) and a horizontal maximum length of 15.0 km (18.4 km in winter). The uncertainties for summer lightning lengths were about ± 1.2 km and ± 0.7 km for the mean and median values respectively. In case of winter lightning, the level of uncertainty reaches up to 1 km and 0.7 km of mean and median value. The results of the successful correlation of CG discharges with the EFT method, represent 6.9% and 35.5% of the total LMA flashes detected in summer and winter respectively. Additionally, the median value of lightning lengths calculated through this correlative method was approximately 17 km for both seasons. On the other hand, the highest median ratios of lightning length to CG discharges in both summer and winter were reported for positive CG discharges.

  16. Laser-flash calorimetry

    International Nuclear Information System (INIS)

    Takahashi, Y.; Nakamura, J.-I.

    1982-01-01

    The heat capacity of vanadium has been measured by laser-flash calorimetry in the temperature region from 80 to 1000 K. The results are compared with available low- and high-temperature heat capacities, and revised thermodynamic values of vanadium are given. No heat-capacity anomaly has been found in the pure vanadium sample over the temperature range investigated, while a small heat-capacity discontinuity, less than 1.2 J.K -1 .mol -1 , has been observed at 220 to 230 K on the same sample but electropolished before measurement. This anomaly disappeared after annealing at 1000 K in vacuo for 1 h and is attributable to the introduction of a small amount of hydrogen during electropolishing. (author)

  17. Ion diode performance on a positive polarity inductive voltage adder with layered magnetically insulated transmission line flow

    International Nuclear Information System (INIS)

    Hinshelwood, D. D.; Schumer, J. W.; Allen, R. J.; Commisso, R. J.; Jackson, S. L.; Murphy, D. P.; Phipps, D.; Swanekamp, S. B.; Weber, B. V.; Ottinger, P. F.; Apruzese, J. P.; Cooperstein, G.; Young, F. C.

    2011-01-01

    A pinch-reflex ion diode is fielded on the pulsed-power machine Mercury (R. J. Allen, et al., 15th IEEE Intl. Pulsed Power Conf., Monterey, CA, 2005, p. 339), which has an inductive voltage adder (IVA) architecture and a magnetically insulated transmission line (MITL). Mercury is operated in positive polarity resulting in layered MITL flow as emitted electrons are born at a different potential in each of the adder cavities. The usual method for estimating the voltage by measuring the bound current in the cathode and anode of the MITL is not accurate with layered flow, and the interaction of the MITL flow with a pinched-beam ion diode load has not been studied previously. Other methods for determining the diode voltage are applied, ion diode performance is experimentally characterized and evaluated, and circuit and particle-in-cell (PIC) simulations are performed. Results indicate that the ion diode couples efficiently to the machine operating at a diode voltage of about 3.5 MV and a total current of about 325 kA, with an ion current of about 70 kA of which about 60 kA is proton current. It is also found that the layered flow impedance of the MITL is about half the vacuum impedance.

  18. Flashing oscillation in pool water

    International Nuclear Information System (INIS)

    Takamasa, Tomoji; Kondo, Koichi; Hazuku, Tatsuya

    1996-01-01

    This paper presents an experimental study of high-pressure saturated water discharging into the pool water. The purpose of the experiment is to clarify the phenomena that occur in blow-down of high-pressure saturated water from the pressure vessel into the water-filled containment in the case of a wall-crack accident or a LOCA in an advanced reactor. The results revealed that a flashing oscillation (FO) occurs when high-pressure saturated water discharges into the pool water, under specified experimental settings. The range of the flashing oscillates between a point very close to and some distance from the vent hole. The pressures in the vent tube and pool water vary according to the flashing oscillation. The pressure oscillation and frequency of flashing position might be caused by the balancing action between the supply of saturated water, flashing at the control volume and its condensation on the steam-water interface. A linear analysis was conducted using a spherical flashing bubble model. The period of the flashing oscillation in the experiments can be explained by theoretical analysis

  19. Flashing coupled density wave oscillation

    International Nuclear Information System (INIS)

    Jiang Shengyao; Wu Xinxin; Zhang Youjie

    1997-07-01

    The experiment was performed on the test loop (HRTL-5), which simulates the geometry and system design of the 5 MW reactor. The phenomenon and mechanism of different kinds of two-phase flow instabilities, namely geyser instability, flashing instability and flashing coupled density wave instability are described. The especially interpreted flashing coupled density wave instability has never been studied well, it is analyzed by using a one-dimensional non-thermo equilibrium two-phase flow drift model computer code. Calculations are in good agreement with the experiment results. (5 refs.,5 figs., 1 tab.)

  20. Observers can reliably identify illusory flashes in the illusory flash paradigm

    NARCIS (Netherlands)

    Erp, J.B.F. van; Philippi, T.G.; Werkhoven, P.

    2013-01-01

    In the illusory flash paradigm, a single flash may be experienced as two flashes when accompanied by two beeps or taps, and two flashes may be experienced as a single flash when accompanied by one beep or tap. The classic paradigm restricts responses to '1' and '2' (2-AFC), ignoring possible

  1. Flashing inception in flowing liquids

    International Nuclear Information System (INIS)

    Jones, O.C. Jr.

    1980-01-01

    The inception of net vaporization in flashing flows is examined. It is suggested that the flashing inception can be expressed as two additive effects. One is due to the static decompression which is a function of the initial temperature and also the expansion rate. The other effect which is a function of Reynolds number and flashing index, is due to the turbulent fluctuations of the flowing liquid. It is shown that by taking a three standard deviation band on the turbulent velocity fluctuations, an adequate representation of the inverse mass flux effect on flashing inception for existing data is obtained. The turbulence effects are combined with the correlation of Alamgir and Lienhard to provide predictive methods recommended for the case where both static and convective decompression effects exist

  2. Research of coal flash hydropyrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Z.; Zhu, H.; Wu, Y.; Tang, L.; Cheng, L.; Xu, Z. [East China University of Science and Technology, Shanghai (China)

    2001-02-01

    Using x-ray photoelectron spectroscopy (XPS) analyses the organic sufur of seven different Chinese coals and their semi-cokes from flash hydropyrolysis were studied. The results showed that the organic sulfur in coal was alkyal sulfur and thiophene with the peak of XPS located in 163.1-163.5 eV and 164.1-164.5 eV. The relative thiophene content in coal increased with the coal rank. The type of organic sulfur in semi-coke in flash hydropyrolysis was generally thiophene species; its XPS peak also located in 164.1-164.5 eV, and was in accord with its corresponding coal. Total alkyl sulfur and some thiophene sulfur were removed during the flash hydropyrolysis process. The alkyl sulfur had very high activity in hydrogenation reaction. Flash hydropyrolysis was an important new clean-coal technique and had notable desulfurization effect. 13 refs., 2 figs., 4 tabs.

  3. Declarative Programming with Temporal Constraints, in the Language CG

    Directory of Open Access Journals (Sweden)

    Lorina Negreanu

    2015-01-01

    Full Text Available Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment’s evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  4. Declarative Programming with Temporal Constraints, in the Language CG.

    Science.gov (United States)

    Negreanu, Lorina

    2015-01-01

    Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment's evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  5. New flash mixing

    International Nuclear Information System (INIS)

    Sackmann, I.

    1980-01-01

    It was found that even for stars evolved away from the red giant branch, a new mixing of nucleo-synthesis products from the hydrogen-burning shells into surface layers was possible, from the penetration of the contaminated intershell region with the H- and He-ionization convection zones. This is due to the helium shell flash driving an immense expansion of an inner carbon pocket, namely, by a factor of 12,000 in radius, a drop in density of about 10 12 , and a cooling of inner pockets normally near 10 8 K to 23,000 K. The surface would be enriched in carbon ( 12 C), helium ( 4 He), and s-process elements, but not significantly in nitrogen ( 14 N), oxygen ( 16 O), or the isotope 13 C. This new type of mixing might provide the missing clue for FG Sagittae. Such a mixing had been suggested by the observations of FG Sagittae, but had been unexplainable by theory up to now

  6. Deconstructing continuous flash suppression.

    Science.gov (United States)

    Yang, Eunice; Blake, Randolph

    2012-03-08

    In this paper, we asked to what extent the depth of interocular suppression engendered by continuous flash suppression (CFS) varies depending on spatiotemporal properties of the suppressed stimulus and CFS suppressor. An answer to this question could have implications for interpreting the results in which CFS influences the processing of different categories of stimuli to different extents. In a series of experiments, we measured the selectivity and depth of suppression (i.e., elevation in contrast detection thresholds) as a function of the visual features of the stimulus being suppressed and the stimulus evoking suppression, namely, the popular "Mondrian" CFS stimulus (N. Tsuchiya & C. Koch, 2005). First, we found that CFS differentially suppresses the spatial components of the suppressed stimulus: Observers' sensitivity for stimuli of relatively low spatial frequency or cardinally oriented features was more strongly impaired in comparison to high spatial frequency or obliquely oriented stimuli. Second, we discovered that this feature-selective bias primarily arises from the spatiotemporal structure of the CFS stimulus, particularly within information residing in the low spatial frequency range and within the smooth rather than abrupt luminance changes over time. These results imply that this CFS stimulus operates by selectively attenuating certain classes of low-level signals while leaving others to be potentially encoded during suppression. These findings underscore the importance of considering the contribution of low-level features in stimulus-driven effects that are reported under CFS.

  7. hCGbeta core fragment is a metabolite of hCG: evidence from infusion of recombinant hCG.

    Science.gov (United States)

    Norman, R J; Buchholz, M M; Somogyi, A A; Amato, F

    2000-03-01

    The availability of recombinant human chorionic gonadotrophin (r-hCG) has allowed us to measure its metabolic and renal clearance rates and to study the origin of the beta core fragment of hCG (hCGbetacf). Serum and urine samples were collected from six subjects, after an intravenous injection of 2 mg (equivalent to 44 000 IU Urinary hCG) r-hCG, and assayed for hCG and the beta subunit (hCGbeta). Urine from four of the subjects was also subjected to gel chromatography and assayed for hCGbetacf and hCG. r-hCG, administered as an intravenous dose, was distributed, initially in a volume of 3.4+/-0.7 l (mean+/-s.d.) and then in 6.5+/-1.15 l at steady-state. The disappearance of r-hCG from serum was bi-exponential, with an initial half-life of 4.5+/-0.7 h and a terminal half-life of 29.0+/-4.6 h. The mean residence time was 28. 6+/- 3.6 h and the total systemic clearance rate of r-hCG was 226+/-18 ml/h. The renal clearance rate was 28.75+/-6.2 ml/h (mean+/-s.d). hCGbetacf was detected in all urine samples collected at 6 h intervals. Over the 138 h period of urine collection, 12.9% (range 10.1-17.3% ) of r-hCG injected was recovered as the intact molecule and 1.7% (range 0.8-2.9%) was recovered as the hCGbetacf, in 4 subjects. The molar ratio of hCGbetacf to hCG in urine increased from 3.1+/-1.7%, on day 1, to 76+/-34.3% (mean+/-s.e.m.) on day 5, after r-hCG infusion, suggesting that hCGbetacf is a metabolic product of the infused r-hCG.

  8. Coast Guard Enterprise Project Management (CG-EPM)

    Data.gov (United States)

    Department of Homeland Security — CG-EPM provides the following capabilities: A Project Center, Portfolio Analysis Tools, Project Planning Tool, Web-based Project Plan Updater, Project Collaboration...

  9. Flashing light in microalgae biotechnology.

    Science.gov (United States)

    Abu-Ghosh, Said; Fixler, Dror; Dubinsky, Zvy; Iluz, David

    2016-03-01

    Flashing light can enhance photosynthesis and improve the quality and quantity of microalgal biomass, as it can increase the products of interest by magnitudes. Therefore, the integration of flashing light effect into microalgal cultivation systems should be considered. However, microalgae require a balanced mix of the light/dark cycle for higher growth rates, and respond to light intensity differently according to the pigments acquired or lost during the growth. This review highlights recently published results on flashing light effect on microalgae and its applications in biotechnology, as well as the recently developed bioreactors designed to fulfill this effect. It also discusses how this knowledge can be applied in selecting the optimal light frequencies and intensities with specific technical properties for increasing biomass production and/or the yield of the chemicals of interest by microalgae belonging to different genera. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Principles of arc flash protection

    Energy Technology Data Exchange (ETDEWEB)

    Hirschmann, R. B.

    2003-04-01

    Recent developments in NFPA 70E, the electrical safety standards in the United States and Canada, designed to provide for a safe industrial work environment, are discussed. The emphasis in this instance is on arc explosions. Development of an arc flash protective program is discussed under various major components of an electrical safety program. These are: appropriate qualifications and training for workers, safe work practices, appropriate hazard assessment practices for any task exceeding 50V where there is the potential of an arc flash accident, flash protection equipment commensurate with the hazard associated with the task to be performed, layering in protective clothing over all body surfaces, and strict adherence to rules regarding use of safety garments and equipment.

  11. Review: hCG, Preeclampsia and Regulatory T cells

    OpenAIRE

    Norris, Wendy; Nevers, Tania; Sharma, Surendra; Kalkunte, Satyan

    2011-01-01

    Human chorionic gonadotropin (hCG) is crucial for successful pregnancy. Its many functions include angiogenesis and immune regulation. Despite years of research, the etiology of preeclampsia remains unknown. Marked by insufficient trophoblast invasion and poor spiral artery remodeling, preeclampsia has also been linked to immune dysregulation. Here we discuss the roles of hCG in the context of endovascular cross-talk between trophoblasts and endothelial cells and immune tolerance. We propose ...

  12. Flash sintering of ceramic materials

    Science.gov (United States)

    Dancer, C. E. J.

    2016-10-01

    During flash sintering, ceramic materials can sinter to high density in a matter of seconds while subjected to electric field and elevated temperature. This process, which occurs at lower furnace temperatures and in shorter times than both conventional ceramic sintering and field-assisted methods such as spark plasma sintering, has the potential to radically reduce the power consumption required for the densification of ceramic materials. This paper reviews the experimental work on flash sintering methods carried out to date, and compares the properties of the materials obtained to those produced by conventional sintering. The flash sintering process is described for oxides of zirconium, yttrium, aluminium, tin, zinc, and titanium; silicon and boron carbide, zirconium diboride, materials for solid oxide fuel applications, ferroelectric materials, and composite materials. While experimental observations have been made on a wide range of materials, understanding of the underlying mechanisms responsible for the onset and latter stages of flash sintering is still elusive. Elements of the proposed theories to explain the observed behaviour include extensive Joule heating throughout the material causing thermal runaway, arrested by the current limitation in the power supply, and the formation of defect avalanches which rapidly and dramatically increase the sample conductivity. Undoubtedly, the flash sintering process is affected by the electric field strength, furnace temperature and current density limit, but also by microstructural features such as the presence of second phase particles or dopants and the particle size in the starting material. While further experimental work and modelling is still required to attain a full understanding capable of predicting the success of the flash sintering process in different materials, the technique non-etheless holds great potential for exceptional control of the ceramic sintering process.

  13. Validation of 125I-hCG as a marker for elimination of hCG and stability of 125I-hCG after in vivo injection in humans

    OpenAIRE

    Christensen, T B; Marqversen, J; Engbaek, F; Berger, P; Bacher, T; Maase, H von der

    1999-01-01

    We have recently introduced 125I-hCG as an elimination marker in patients with human chorionic gonadotrophin (hCG) producing testicular cancer. 125I-hCG is a well-known reagent in clinical biochemistry and is used extensively in hCG assays. Previous studies have shown that the iodination process leaves the hCG molecule mainly intact. The iodination, purification and stability of 125I-hCG tracer are described. The aim of the present study was to determine whether or not 125I is associated with...

  14. Quick Guide to Flash Catalyst

    CERN Document Server

    Elmansy, Rafiq

    2011-01-01

    How do you transform user interface designs created in Photoshop or Illustrator into interactive web pages? It's easier than you think. This guide shows you how to use Adobe Flash Catalyst to create interactive UIs and website wireframes for Rich Internet Applications-without writing a single line of code. Ideal for web designers, this book introduces Flash Catalyst basics with detailed step-by-step instructions and screenshots that illustrate every part of the process. You'll learn hands-on how to turn your static design or artwork into working user interfaces that can be implemented in Fla

  15. Hot Flashes amd Night Sweats (PDQ)

    Science.gov (United States)

    ... Professionals Questions to Ask about Your Treatment Research Hot Flashes and Night Sweats (PDQ®)–Patient Version Overview ... quality of life in many patients with cancer. Hot flashes and night sweats may be side effects ...

  16. Detection of Malicious Flash Banner Advertisements

    Directory of Open Access Journals (Sweden)

    Kirill Alekseevich Samosadnyy

    2014-09-01

    Full Text Available The paper addresses the problem of detecting malicious flash advertisements. As a result, detection method based on dynamic analysis that modify flash application and execute it in Adobe Flash player is proposed and evaluated on synthetic and real world examples.

  17. Flash CS4: The Missing Manual

    CERN Document Server

    Grover, Chris

    2008-01-01

    Unlock the power of Flash and bring gorgeous animations to life onscreen. Flash CS4: The Missing Manual includes a complete primer on animation, a guided tour of the program's tools and capabilities, lots of new illustrations, and more details on working with video. Beginners will learn to use the software in no time, and experienced Flash designers will improve their skills.

  18. RELATIONSHIP BETWEEN FLASH POINTS OF SOME BINARY ...

    African Journals Online (AJOL)

    B. S. Chandravanshi

    Miscellaneous binary blends containing solvent neutral-150 (SN-150), ... viscosity, the flash point test has always been a standard part of a lubricant's specification. ... between structure and flash points of organic compounds [5-12] and fuels [13, 14]. ... in binary mixtures, the gaps between flash points would be high enough.

  19. Jaan Toomik ajakirjas Flash Art

    Index Scriptorium Estoniae

    1999-01-01

    Kunstiajakirja "Flash Art" maikuu numbris Ando Keskküla artikkel, mis annab ülevaate J. Toomiku loomingust ja peatub pikemalt tema olulisematel töödel. 10. juunist J. Toomiku isiknäitus Londoni fotograafide galeriis. Eksponeeritud video "Uisutaja"

  20. Ingmar Muusikuse foto Flash Artis

    Index Scriptorium Estoniae

    1999-01-01

    Flash Arti 1999. a. oktoobrinumbris virtuaalse näituse rubriigis Ando Keskküla artikkel radikaalsemast eesti kunstist ja kunstielust postsotsialistlikul ajastul. Illustratsiooniks Liina Siibi fotokompositsioonid, Ingmar Muusikuse foto Raoul Kurvitza, Ene-Liis Semperi ja Kiwa Eesti Panga performance'ist

  1. Undergraduate Separations Utilizing Flash Chromatography

    Science.gov (United States)

    Horowitz, G.

    2000-02-01

    This article describes the procedures used to carry out four flash chromatography experiments: the isolation of the carotenes, chlorophylls and xanthophylls from a spinach extract; the separation of ß-carotene from tetraphenyl cyclopentadienone; the isolation of (+) and (-) carvone from caraway and spearmint oil; and the purification of benzil from benzoin. Apparatus used is nonbreakable, easy to use, and inexpensive.

  2. Proportion hyperglycosylated hCG: a new test for discriminating gestational trophoblastic diseases.

    Science.gov (United States)

    Cole, Laurence A

    2014-11-01

    Hyperglycosylated human chorionic gonadotropin (hCG) is a variant of hCG with large oligosaccharide side chains. Although hCG is produced by syncytiotrophoblast cells, hyperglycosylated hCG marks cytotrophoblast cell. Hyperglycosylated hCG signals placental implantation. Total hCG in serum and urine is measured by the Siemens Immulite hCG pregnancy test; the result is in milli-international unit per milliliter. Hyperglycosylated hCG is determined by the B152 microtiter plate assay; the result is in nanogram per milliliter. Hyperglycosylated hCG results can be converted to milli-international unit per milliliter equivalents by multiplying by 11. The test measures proportion hyperglycosylated hCG, hyperglycosylated hCG / total hCG. Proportion hyperglycosylated hCG marks cases intent on developing persistent hydatidiform mole (68% detection at 17% false detection). Proportion hyperglycosylated hCG also marks persistent hydatidiform mole (100% detection at 5.1% false detection). Proportion hyperglycosylated hCG distinguishes choriocarcinoma and gestational trophoblastic neoplasm cases, absolutely discriminating aggressive cases and minimally aggressive cases. Proportion hyperglycosylated hCG identifies quiescent gestational trophoblastic disease cases. It recognizes quiescent cases that become persistent disease (100% detection at 0% false positive). Proportion hyperglycosylated hCG is an invaluable test for discriminating gestational trophoblastic diseases.

  3. Foundation Flash CS4 for Designers

    CERN Document Server

    Green, Tom

    2008-01-01

    In this book, you'll learn:* How to create effective animations using the new Motion Editor and animation tools * How to use the new 3D features to animate objects in 3D space * Best-practice tips and techniques from some of the top Flash practitioners on the planet * How to create captioned video and full-screen video, and deploy HD video using Flash * Techniques for using the Flash UI components as well as XML documents to create stunning,interactive presentations If you're a Flash designer looking for a solid overview of Flash CS4, this book is for you. Through the use of solid and practica

  4. On multiphase negative flash for ideal solutions

    DEFF Research Database (Denmark)

    Yan, Wei; Stenby, Erling Halfdan

    2012-01-01

    simpler than the corresponding normal flash algorithm. Unlike normal flash, multiphase negative flash for ideal solutions can diverge if the feasible domain for phase amounts is not closed. This can be judged readily during the iteration process. The algorithm can also be extended to the partial negative......There is a recent interest to solve multiphase negative flash problems where the phase amounts can be negative for normal positive feed composition. Solving such a negative flash problem using successive substitution needs an inner loop for phase distribution calculation at constant fugacity...... coefficients. It is shown that this inner loop, named here as multiphase negative flash for ideal solutions, can be solved either by Michelsen's algorithm for multiphase normal flash, or by its variation which uses F−1 phase amounts as independent variables. In either case, the resulting algorithm is actually...

  5. Extending the QUDA Library with the eigCG Solver

    Energy Technology Data Exchange (ETDEWEB)

    Strelchenko, Alexei [Fermilab; Stathopoulos, Andreas [William-Mary Coll.

    2014-12-12

    While the incremental eigCG algorithm [ 1 ] is included in many LQCD software packages, its realization on GPU micro-architectures was still missing. In this session we report our experi- ence of the eigCG implementation in the QUDA library. In particular, we will focus on how to employ the mixed precision technique to accelerate solutions of large sparse linear systems with multiple right-hand sides on GPUs. Although application of mixed precision techniques is a well-known optimization approach for linear solvers, its utilization for the eigenvector com- puting within eigCG requires special consideration. We will discuss implementation aspects of the mixed precision deflation and illustrate its numerical behavior on the example of the Wilson twisted mass fermion matrix inversions

  6. Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU

  7. Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B

  8. Data of evolutionary structure change: 1CG8B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG8B-2QU0A 1CG8 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...> 1CG8 B 1CG8B ence>VWKDV--DHKQI...ine> ILE CA 383 2QU0 A 2QU

  9. Spurious dispersion effects at FLASH

    International Nuclear Information System (INIS)

    Prat, Eduard

    2009-07-01

    The performance of the Free-Electron Laser (FEL) process imposes stringent demands on the transverse trajectory and size of the electron beam. Since transverse dispersion changes off-energy particle trajectories and increases the effective beam size, dispersion must be controlled. This thesis treats the concept of dispersion in linacs, and analyses the impact of dispersion on the electron beam and on the FEL process. It presents generation mechanisms for spurious dispersion, quantifying its importance for FLASH (Free-electron Laser in Hamburg) and the XFEL (European X-ray Free-Electron Laser). A method for measuring and correcting dispersion and its implementation in FLASH is described. Experiments of dispersion e ects on the transverse beam quality and on the FEL performance are presented. (orig.)

  10. Flash x-ray cinematography

    International Nuclear Information System (INIS)

    Stein, W.E.

    1976-01-01

    Experiments intended to provide an overview of the potential capabilities and limitations of flash x-ray cinematography as a diagnostic technique for a Fast Reactor Safety Test Facility are described. The results provide estimates of the x-ray pulse intensity required to obtain adequate radiographs of an array of fuel pins in a typical reactor configuration. An estimate of the upper limit on the pulse duration imposed by the reactor background radiation was also determined. X-ray cinematography has been demonstrated at a repetition rate limited only by the recording equipment on hand at the time of these measurements. These preliminary results indicate that flash x-ray cinematography of the motion of fuel in a Fast Reactor Test Facility is technically feasible

  11. Spurious dispersion effects at FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Prat, Eduard

    2009-07-15

    The performance of the Free-Electron Laser (FEL) process imposes stringent demands on the transverse trajectory and size of the electron beam. Since transverse dispersion changes off-energy particle trajectories and increases the effective beam size, dispersion must be controlled. This thesis treats the concept of dispersion in linacs, and analyses the impact of dispersion on the electron beam and on the FEL process. It presents generation mechanisms for spurious dispersion, quantifying its importance for FLASH (Free-electron Laser in Hamburg) and the XFEL (European X-ray Free-Electron Laser). A method for measuring and correcting dispersion and its implementation in FLASH is described. Experiments of dispersion e ects on the transverse beam quality and on the FEL performance are presented. (orig.)

  12. Internalization of Rat FSH and LH/CG Receptors by rec-eCG in CHO-K1 Cells.

    Science.gov (United States)

    Park, Jong-Ju; Seong, Hun-Ki; Kim, Jeong-Soo; Munkhzaya, Byambaragchaa; Kang, Myung-Hwa; Min, Kwan-Sik

    2017-06-01

    Equine chorionic gonadotropin (eCG) is a unique molecule that elicits the response characteristics of both follicle-stimulating hormone (FSH) and luteinizing hormone (LH) in other species. Previous studies from this laboratory had demonstrated that recombinant eCG (rec-eCG) from Chinese hamster ovary (CHO-K1) cells exhibited both FSH- and LH-like activity in rat granulosa and Leydig cells. In this study, we analyzed receptor internalization through rec-eCGs, wild type eCG (eCGβ/α) and mutant eCG (eCGβ/αΔ56) with an N-linked oligosaccharide at Asn 56 of the α-subunit. Both the rec-eCGs were obtained from CHO-K1 cells. The agonist activation of receptors was analyzed by measuring stimulation time and concentrations of rec-eCGs. Internalization values in the stably selected rat follicle-stimulating hormone receptor (rFSHR) and rat luteinizing/chorionic gonadotropin receptor (rLH/CGR) were highest at 50 min after stimulation with 10 ng of rec-eCGβ/α. The dose-dependent response was highest when 10 ng of rec-eCGβ/α was used. The deglycosylated eCGβ/αΔ56 mutant did not enhance the agonist-stimulated internalization. We concluded that the state of activation of rFSHR and rLH/CGR could be modulated through agonist-stimulated internalization. Our results suggested that the eLH/CGRs are mostly internalized within 60 min by agonist-stimulation by rec-eCG. We also suggested that the lack of responsiveness of the deglycosylated eCGβ/ αΔ56 was likely because the site of glycosylation played a pivotal role in agonist-stimulated internalization in cells expressing rFSHR and rLH/CGR.

  13. Hot flashes and sleep in women.

    Science.gov (United States)

    Moe, Karen E

    2004-12-01

    Sleep disturbances during menopause are often attributed to nocturnal hot flashes and 'sweats' associated with changing hormone patterns. This paper is a comprehensive critical review of the research on the relationship between sleep disturbance and hot flashes in women. Numerous studies have found a relationship between self-reported hot flashes and sleep complaints. However, hot flash studies using objective sleep assessment techniques such as polysomnography, actigraphy, or quantitative analysis of the sleep EEG are surprisingly scarce and have yielded somewhat mixed results. Much of this limited evidence suggests that hot flashes are associated with objectively identified sleep disruption in at least some women. At least some of the negative data may be due to methodological issues such as reliance upon problematic self-reports of nocturnal hot flashes and a lack of concurrent measures of hot flashes and sleep. The recent development of a reliable and non-intrusive method for objectively identifying hot flashes during the night should help address the need for substantial additional research in this area. Several areas of clinical relevance are described, including the effects of discontinuing combined hormone therapy (estrogen plus progesterone) or estrogen-only therapy, the possibility of hot flashes continuing for many years after menopause, and the link between hot flashes and depression.

  14. Visualization of reaction mechanism by CG based on quantum ...

    African Journals Online (AJOL)

    In this work, the change in the molecular configuration in fundamental chemical reactions such as, F + HCl ¨ HF + Cl, I + H2¨ HI + H, OH- + CH3Cl ¨ CH3OH + Cl-, and esterification of acetic acid and ethyl alcohol were visualized by the quantum chemical calculation MOPAC with PM5 Hamiltonian. The CG teaching material ...

  15. The effect of administering equine chorionic gonadotropin (eCG) and human chorionic gonadotropin (hCG) post artificial insemination on fertility of lactating dairy cows.

    Science.gov (United States)

    Bartolome, J A; Wallace, S Perez; de la Sota, R L; Thatcher, W W

    2012-09-15

    The objective was to evaluate the effect of equine chorionic gonadotropin (eCG) and hCG post artificial insemination (AI) on fertility of lactating dairy cows. In Experiment 1, cows were either treated with eCG on Day 22 post AI (400 IU; n = 80) or left untreated (n = 84). On Day 29, pregnant cows were either treated with hCG (2500 IU; n = 32) or left untreated (n = 36). Pregnancy and progesterone were evaluated on Days 29 and 45. In Experiment 2, cows (n = 28) were either treated with eCG on Day 22 (n = 13) or left untreated (n = 15) and either treated with hCG on Day 29 (n = 14) or left untreated (n = 14). Blood sampling and ultrasonography were conducted between Days 22 and 45. In Experiment 3, cows were either treated with eCG on Day 22 post AI (n = 229) or left untreated (n = 241). Pregnancy was evaluated on Days 36 and 85. In Experiment 1, eCG on Day 22 increased (P cows on Day 29 (50.0 vs. 33.3%) and on Day 45, the increase was higher (P cows with timed AI (41.2 vs. 6.5%) than in cows AI at detected estrus (50.0 vs. 37.8%). Pregnancy losses were reduced by eCG and hCG, but increased in cows that did not receive eCG but were given hCG (P cows, but not in cows treated with eCG. In Experiment 2, hCG increased (P cows (P cows with low body condition (eCG = 45.6 and 43.5%; Control = 22.9 and 22.9%). In conclusion, eCG at 22 days post insemination increased fertility, primarily in cows with low body condition and reduced pregnancy losses when given 7 days before hCG; hCG induced accessory CLs and slightly increased progesterone, but hCG given in the absence of a prior eCG treatment reduced fertility. Copyright © 2012 Elsevier Inc. All rights reserved.

  16. A Durable Flash Memory Search Tree

    OpenAIRE

    Clay III, James; Wortman, Kevin

    2012-01-01

    We consider the task of optimizing the B-tree data structure, used extensively in operating systems and databases, for sustainable usage on multi-level flash memory. Empirical evidence shows that this new flash memory tree, or FM Tree, extends the operational lifespan of each block of flash memory by a factor of roughly 27 to 70 times, while still supporting logarithmic-time search tree operations.

  17. Evaluation of Flash Bainite in 4130 Steel

    Science.gov (United States)

    2011-07-01

    Technical Report ARWSB-TR-11011 Evaluation of Flash Bainite in 4130 Steel G. Vigilante M. Hespos S. Bartolucci...4. TITLE AND SUBTITLE Evaluation of Flash Bainite in 4130 Steel 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...need to be addressed, the Flash Bainite processing of 4130 steel demonstrates promise for applications needing a combination of high strength with

  18. Construction and performance of large flash chambers

    International Nuclear Information System (INIS)

    Taylor, F.E.; Bogert, D.; Fisk, R.; Stutte, L.; Walker, J.K.; Wolfson, J.; Abolins, M.; Ernwein, J.; Owen, D.; Lyons, T.

    1979-01-01

    The construction and performance of 12' x 12' flash chambers used in a 340 ton neutrino detector under construction at Fermilab is described. The flash chambers supply digital information with a spatial resolution of 0.2'', and are used to finely sample the shower development of the reaction products of neutrino interactions. The flash chambers are easy and inexpensive to build and are electronically read out

  19. Menopausal Hot Flashes and White Matter Hyperintensities

    Science.gov (United States)

    Thurston, Rebecca C.; Aizenstein, Howard J.; Derby, Carol A.; Sejdić, Ervin; Maki, Pauline M.

    2015-01-01

    Objective Hot flashes are the classic menopausal symptom. Emerging data links hot flashes to cardiovascular disease (CVD) risk, yet how hot flashes are related to brain health is poorly understood. We examined the relationship between hot flashes - measured via physiologic monitor and self-report - and white matter hyperintensities (WMH) among midlife women. Methods Twenty midlife women ages 40-60 without clinical CVD, with their uterus and both ovaries, and not taking hormone therapy were recruited. Women underwent 24 hours of ambulatory physiologic and diary hot flash monitoring to quantify hot flashes; magnetic resonance imaging to assess WMH burden; 72 hours of actigraphy and questionnaires to quantify sleep; and a blood draw, questionnaires, and physical measures to quantify demographics and CVD risk factors. Test of a priori hypotheses regarding relations between physiologically-monitored and self-reported wake and sleep hot flashes and WMH were conducted in linear regression models. Results More physiologically-monitored hot flashes during sleep were associated with greater WMH, controlling for age, race, and body mass index [beta(standard error)=.0002 (.0001), p=.03]. Findings persisted controlling for sleep characteristics and additional CVD risk factors. No relations were observed for self-reported hot flashes. Conclusions More physiologically-monitored hot flashes during sleep were associated with greater WMH burden among midlife women free of clinical CVD. Results suggest that relations between hot flashes and CVD risk observed in the periphery may extend to the brain. Future work should consider the unique role of sleep hot flashes in brain health. PMID:26057822

  20. Modelling and mitigation of Flash Crashes

    OpenAIRE

    Fry, John; Serbera, Jean-Philippe

    2017-01-01

    The algorithmic trading revolution has had a dramatic effect upon markets. Trading has become faster, and in some ways more efficient, though potentially at the cost higher volatility and increased uncertainty. Stories of predatory trading and flash crashes constitute a new financial reality. Worryingly, highly capitalised stocks may be particularly vulnerable to flash crashes. Amid fears of high-risk technology failures in the global financial system we develop a model for flash crashes....

  1. Flash CS5 The Missing Manual

    CERN Document Server

    Grover, Chris

    2010-01-01

    Once you know how to use Flash, you can create everything from simple animations to high-end desktop applications, but it's a complex tool that can be difficult to master on your own-unless you have this Missing Manual. This book will help you learn all you need to know about Flash CS5 to create animations that bring your ideas to life. Learn animation basics. Find everything you need to know to get started with FlashMaster the Flash tools. Learn the animation and effects toolset, with clear explanations and hands-on examplesUse 3D effects. Rotate and put objects in motion in three dimensions

  2. Search Engine Optimization for Flash Best Practices for Using Flash on the Web

    CERN Document Server

    Perkins, Todd

    2009-01-01

    Search Engine Optimization for Flash dispels the myth that Flash-based websites won't show up in a web search by demonstrating exactly what you can do to make your site fully searchable -- no matter how much Flash it contains. You'll learn best practices for using HTML, CSS and JavaScript, as well as SWFObject, for building sites with Flash that will stand tall in search rankings.

  3. The haptic and the visual flash-lag effect and the role of flash characteristics.

    Directory of Open Access Journals (Sweden)

    Knut Drewing

    Full Text Available When a short flash occurs in spatial alignment with a moving object, the moving object is seen ahead the stationary one. Similar to this visual "flash-lag effect" (FLE it has been recently observed for the haptic sense that participants judge a moving hand to be ahead a stationary hand when judged at the moment of a short vibration ("haptic flash" that is applied when the two hands are spatially aligned. We further investigated the haptic FLE. First, we compared participants' performance in two isosensory visual or haptic conditions, in which moving object and flash were presented only in a single modality (visual: sphere and short color change, haptic: hand and vibration, and two bisensory conditions, in which the moving object was presented in both modalities (hand aligned with visible sphere, but the flash was presented only visually or only haptically. The experiment aimed to disentangle contributions of the flash's and the objects' modalities to the FLEs in haptics versus vision. We observed a FLE when the flash was visually displayed, both when the moving object was visual and visuo-haptic. Because the position of a visual flash, but not of an analogue haptic flash, is misjudged relative to a same visuo-haptic moving object, the difference between visual and haptic conditions can be fully attributed to characteristics of the flash. The second experiment confirmed that a haptic FLE can be observed depending on flash characteristics: the FLE increases with decreasing intensity of the flash (slightly modulated by flash duration, which had been previously observed for vision. These findings underline the high relevance of flash characteristics in different senses, and thus fit well with the temporal-sampling framework, where the flash triggers a high-level, supra-modal process of position judgement, the time point of which further depends on the processing time of the flash.

  4. Kathon CG y Dermatología Laboral: Actualización Kathon CG and Occupational Dermatology: An update

    Directory of Open Access Journals (Sweden)

    Ana Rita Rodrigues Barata

    2012-09-01

    Full Text Available El Kathon CG constituye el nombre comercial de una mezcla de isotiazolinas: Metilcloroisotiazolinona y Metilisotiazolinona. Es un conservante muy utilizado, sobre todo en la industria cosmética, aunque en los últimos años también se ha impuesto su presencia en productos de limpieza de uso doméstico y actualmente a concentraciones más altas en preparados de uso industrial como aceites de corte, emulsiones de látex, pinturas al temple, aceites para motores Diesel, etc. Por su alto poder sensibilizante y amplia utilización, constituye actualmente una de las causas más frecuentes de alergia de contacto por preservativos, tanto en nuestra vida privada, como en el ámbito profesional. Objetivos: Estudiar la capacidad sensibilizante del Kathon CG y su relación con el desarrollo de eczema de contacto alérgico de origen profesional. Métodos: Estudio observacional descriptivo, a través de la revisión de las historias clínicas de los pacientes vistos en el Servicio de Dermatología Laboral del Instituto Nacional de Medicina y Seguridad en el Trabajo durante los años 2008-2012; 1520 pacientes fueron evaluados y estudiados mediante pruebas epicutáneas para descartar una posible dermatosis profesional. Se registraron los casos de sensibilización al Kathon CG y se analizaron las siguientes variables: genero, edad, grupo profesional, localización de las lesiones cutáneas, relevancia y relación profesional. El análisis estadístico se realizó con el programa SPSS 15.0. Resultados: Se observó sensibilización al Kathon CG en 88 pacientes (5,8%, correspondiendo un 42% a sensibilizaciones de origen profesional. Conclusiones: La alergia de contacto profesional por Kathon CG constituye actualmente es un problema de alta prevalencia. Ante un paciente con positividad a este alérgeno hay que interrogar siempre por su profesión.Kathon CG is the tradename for a mixture of isothiazolines: methylchloroisothiazolinone and methylisothiazolinone. It

  5. Rh-flash acquisition card

    International Nuclear Information System (INIS)

    Bourrion, O.

    2003-01-01

    The rh-flash card main purpose is to convert and store the image of the analog data present at input into an output buffer, namely in a given timing window besides a stop signal (like a digital oscilloscope). It is conceived in VME format 1U wide with an additional connector. Novelty of this card is its ability to sample at a high frequency, due to flash coders, and this at a high repetition rate. To do that the card allows the storage of the data considered 'useful' and that is done by storing only the data exceeding a certain threshold. This can be useful for instance for viewing peaks in a spectrum, and obtaining their relative location. The goal is to stock and process the data sampled before and after the arrival of a stop signal (what entails a storage depth). A threshold is defined and any peak exceeding its level will really be stored in the output buffer which is readable through the VME bus. The peak values will be stored as well as m preceding and n subsequent values (both programmable). Obviously, if the threshold is zero the system of data processing is off and all data will be stored. The document is structured on six sections titled: 1. Description; 2. Specifications; 3. Explaining the design of channels; 4. Explaining the shared part of the design; 5. Addressing (→ user guide); 6. Software precautions. (author)

  6. NO signatures from lightning flashes

    Science.gov (United States)

    Stith, J.; Dye, J.; Ridley, B.; Laroche, P.; Defer, E.; Baumann, K.; Hübler, G.; Zerr, R.; Venticinque, M.

    1999-07-01

    In situ measurements of cloud properties, NO, and other trace gases were made in active thunderstorms by two research aircraft. Concurrent measurements from a three-dimensional (3-D) VHF interferometer and the 2-D National Lightning Detection Network were used to determine lightning frequency and location. The CHILL Doppler radar and the NOAA-WP-3D Orion X band Doppler radar were also used to measure storm characteristics. Two case studies from the (STERAO) Stratosphere-Troposphere Experiments: Radiation, Aerosols, and Ozone project in northeastern Colorado during the summer of 1996 are presented. Narrow spikes (0.11-0.96 km across), containing up to 19 ppbv of NO, were observed in the storms. Most were located in or downwind of electrically active regions where the NO produced by lightning would be expected. However, it was difficult to correlate individual flashes with NO spikes. A simple model of the plume of NO from lightning is used to estimate NO production from the mean mixing ratio measured in these spikes. The estimates range from 2.0×1020 to 1.0×1022 molecules of NO per meter of flash length.

  7. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    was associated with former and current smoking status, high daily and cumulative smoking, short time since smoking cessation (all p values 7×10-31), and the smoking-related CHRN3A genotype (-0.48% per T-allele, p=0.002). The multifactorially adjusted HRs for the lowest versus highest methylation quintiles were...... in the lowest and highest methylation quintiles were 3.7% and 0.0% (p=2×10-7), whereas predicted PLCOM2012 6-year risks were similar (4.3% and 4.4%, p=0.77). CONCLUSION: AHRR (cg05575921) hypomethylation, a marker of smoking behaviour, provides potentially clinical relevant predictions of future smoking-related...... morbidity and mortality. METHODS: From the Copenhagen City Heart Study representing the Danish general population, we studied 9234 individuals. Using bisulphite treated leucocyte DNA, AHRR (cg05575921) methylation was measured. Rs1051730 (CHRN3A) genotype was used to evaluate smoking heaviness. Participants...

  8. Cross-linking of hCG to luteal receptors

    Energy Technology Data Exchange (ETDEWEB)

    Ji, T.H.; Ji, I.

    1985-01-01

    Photoaffinity labeling of the lutropin/choriogonadotropin (LH/hCG) receptor system on porcine granulosa cells has demonstrated that both the ..cap alpha.. and ..beta.. subunits of hCG directly photoaffinity label the hormone receptor. Three new bands appear on SDS-PAGE as a consequence of photoaffinity labeling by each subunit: the molecular weights of the three bands (106K, 88K, and 83K) produced by the subunit are larger by approximately 10K than those of the three bands (96K, 76K, and 73K) labeled by the ..cap alpha.. subunit. Although it could be a coincidence that the molecular weight of the ..beta.. subunit is approximately 10K larger than that of the ..cap alpha.. subunit, the similarity in these differences suggests the possibility that both the ..cap alpha.. and ..beta.. subunits have labeled the same polypeptides.

  9. Effects of equine chorionic gonadotropin (eCG) administration and ...

    African Journals Online (AJOL)

    Pregnancy rate in group F was more than the control group (p < 0.05). Twinning rates and kid crops in groups E+F and F were significantly higher than control group (p < 0.05). Time of onset of estrus decreased in groups with eCG administration (E and E+F). Therefore, it is concluded that the flushing especially coupled with ...

  10. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    were followed for up to 22 years for exacerbations of COPD, event of lung cancer and all-cause mortality. Six-year lung cancer risk was calculated according to the Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial (PLCOM2012). MEASUREMENTS AND MAIN RESULTS: AHRR (cg05575921) hypomethylation......RATIONALE AND OBJECTIVES: Self-reported smoking underestimates disease risk. Smoking affects DNA methylation, in particular the cg05575921 site in the aryl hydrocarbon receptor repressor (AHRR) gene. We tested the hypothesis that AHRR cg05575921 hypomethylation is associated with risk of smoking...... 4.58 (95% CI 2.83 to 7.42) for COPD exacerbations, 4.87 (2.31 to 10.3) for lung cancer and 1.67 (1.48 to 1.88) for all-cause mortality. Finally, among 2576 high-risk smokers eligible for lung cancer screening by CT, observed cumulative incidences of lung cancer after 6 years for individuals...

  11. uFlip: Understanding Flash IO Patterns

    DEFF Research Database (Denmark)

    Bouganim, Luc; Jonsson, Bjørn; Bonnet, Philippe

    2009-01-01

    want to establish what kind of IOs should be favored (or avoided) when designing algorithms and architectures for flash-based systems. In this paper, we focus on flash IO patterns, that capture relevant distribution of IOs in time and space, and our goal is to quantify their performance. We define uFLIP...

  12. Au Contraire: Gifted in a Flash (Mob)

    Science.gov (United States)

    Delisle, James R.

    2012-01-01

    A "flash mob" is defined by Wikipedia as "a large group of people who assemble suddenly in a public place, perform an unusual and pointless act for a brief time, then disperse." Fueled by social media and Smartphones, flash mobs have been used, primarily, as entertaining diversions by addicted techies with (apparently) tons of time on their hands.…

  13. Flash memory in embedded Java programs

    DEFF Research Database (Denmark)

    Korsholm, Stephan Erbs

    This paper introduces a Java execution environment with the capability for storing constant heap data in Flash, thus saving valuable RAM. The extension is motivated by the structure of three industrial applications which demonstrate the need for storing constant data in Flash on small embedded...

  14. FLASH Interface; a GUI for managing runtime parameters in FLASH simulations

    Science.gov (United States)

    Walker, Christopher; Tzeferacos, Petros; Weide, Klaus; Lamb, Donald; Flocke, Norbert; Feister, Scott

    2017-10-01

    We present FLASH Interface, a novel graphical user interface (GUI) for managing runtime parameters in simulations performed with the FLASH code. FLASH Interface supports full text search of available parameters; provides descriptions of each parameter's role and function; allows for the filtering of parameters based on categories; performs input validation; and maintains all comments and non-parameter information already present in existing parameter files. The GUI can be used to edit existing parameter files or generate new ones. FLASH Interface is open source and was implemented with the Electron framework, making it available on Mac OSX, Windows, and Linux operating systems. The new interface lowers the entry barrier for new FLASH users and provides an easy-to-use tool for experienced FLASH simulators. U.S. Department of Energy (DOE), NNSA ASC/Alliances Center for Astrophysical Thermonuclear Flashes, U.S. DOE NNSA ASC through the Argonne Institute for Computing in Science, U.S. National Science Foundation.

  15. Organic flash cycles for efficient power production

    Science.gov (United States)

    Ho, Tony; Mao, Samuel S.; Greif, Ralph

    2016-03-15

    This disclosure provides systems, methods, and apparatus related to an Organic Flash Cycle (OFC). In one aspect, a modified OFC system includes a pump, a heat exchanger, a flash evaporator, a high pressure turbine, a throttling valve, a mixer, a low pressure turbine, and a condenser. The heat exchanger is coupled to an outlet of the pump. The flash evaporator is coupled to an outlet of the heat exchanger. The high pressure turbine is coupled to a vapor outlet of the flash evaporator. The throttling valve is coupled to a liquid outlet of the flash evaporator. The mixer is coupled to an outlet of the throttling valve and to an outlet of the high pressure turbine. The low pressure turbine is coupled to an outlet of the mixer. The condenser is coupled to an outlet of the low pressure turbine and to an inlet of the pump.

  16. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  17. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  18. Radioimmunoassay and evaluation for serum SIgA and CG of the hepatopathy patients

    International Nuclear Information System (INIS)

    Liu Junchi; Du Shujun; Lu Jun; Tang Xiaolin; Mao Shaorong

    1995-01-01

    Serum SIgA and CG of 247 hepatopathy (male 140, female 99) are radioimmunoassayed. The Clinical Significance of SIgA, CG for hepatisms is evaluated. The results show that the assay of SIgA, CG has an important significance for the doctor to choose the treatment plans and determine the prognosis

  19. Terrestrial gamma-ray flashes

    Science.gov (United States)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo

    2013-08-01

    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models.

  20. Terrestrial gamma-ray flashes

    International Nuclear Information System (INIS)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo

    2013-01-01

    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models

  1. EEHG at FLASH and DELTA

    Energy Technology Data Exchange (ETDEWEB)

    Molo, Robert; Hoener, Markus; Huck, Holger; Hacker, Kirsten; Khan, Shaukat; Schick, Andreas; Ungelenk, Peter; Zeinalzadeh, Maryam [Center for Synchrotron Radiation (DELTA), TU Dortmund University (Germany); Meulen, Peter van der; Salen, Peter [Stockholm University (Sweden); Angelova Hamberg, Gergana; Ziemann, Volker [Uppsala University (Sweden)

    2013-07-01

    The echo-enabled harmonic generation (EEHG) scheme utilizes two modulators with two magnetic chicanes in order to generate an electron density modulation with high harmonic content. In contrast to free-electron lasers (FEL) based on self-amplified spontaneous emission (SASE), the radiation of an EEHG FEL has better longitudinal coherence and is naturally synchronized with an external laser, which is advantageous for pump-probe applications. At the free-electron laser in Hamburg (FLASH), an EEHG experiment is currently under preparation. The short-pulse facility at DELTA (a 1.5-GeV synchrotron light source operated by the TU Dortmund University) based on coherent harmonic generation (CHG) will be upgraded using the EEHG technique in order to reach shorter wavelengths.

  2. [Nikola Tesla: flashes of inspiration].

    Science.gov (United States)

    Villarejo-Galende, Albero; Herrero-San Martín, Alejandro

    2013-01-16

    Nikola Tesla (1856-1943) was one of the greatest inventors in history and a key player in the revolution that led to the large-scale use of electricity. He also made important contributions to such diverse fields as x-rays, remote control, radio, the theory of consciousness or electromagnetism. In his honour, the international unit of magnetic induction was named after him. Yet, his fame is scarce in comparison with that of other inventors of the time, such as Edison, with whom he had several heated arguments. He was a rather odd, reserved person who lived for his inventions, the ideas for which came to him in moments of inspiration. In his autobiography he relates these flashes with a number of neuropsychiatric manifestations, which can be seen to include migraine auras, synaesthesiae, obsessions and compulsions.

  3. Non Volatile Flash Memory Radiation Tests

    Science.gov (United States)

    Irom, Farokh; Nguyen, Duc N.; Allen, Greg

    2012-01-01

    Commercial flash memory industry has experienced a fast growth in the recent years, because of their wide spread usage in cell phones, mp3 players and digital cameras. On the other hand, there has been increased interest in the use of high density commercial nonvolatile flash memories in space because of ever increasing data requirements and strict power requirements. Because of flash memories complex structure; they cannot be treated as just simple memories in regards to testing and analysis. It becomes quite challenging to determine how they will respond in radiation environments.

  4. Clinical effects of CG (Hythiol) tablets on leukopenia resulting from radiotherapy

    International Nuclear Information System (INIS)

    Fukui, Hideki; Sakaguchi, Kokichi; Sekiba, Kaoru

    1984-01-01

    A double-blind comparative study of CG(L-cysteine) tablets and approved drugs (CG capsules) was made to assess clinical effects of CG tablets on leukopenia. The subjects were 75 patients with cancer of the uterine cervix in whom the number of WBC was 4,500-7,500/mm before irradiation. The ratios of patients who kept WBC as 3,500/mm or more were 64.7% in the group with CG tablets and 50% in the group with CG capsules with no statistical significance. The ratios of patients who kept WBC as 3,000/mm or more were 82.4% in the group with CG tablets and 79.4% in the group with CG capsules with no statistical significance. The ratios to prevent leukopenia were 70.6% in the group with CG tablets and 58.8% in the group with CG capsules with no significant difference. Other hematological findings, subjective symptoms and the performance of radiotherapeutic protocol were not different between the groups. No marked side effects were observed. These results suggest that CG tablets, as well as CG capsules, are effective for preventing leukopenia resulting from radiotherapy. (Namekawa, K.)

  5. MR colonography with fecal tagging: comparison between 2D turbo FLASH and 3D FLASH sequences

    International Nuclear Information System (INIS)

    Papanikolaou, Nickolas; Grammatikakis, John; Maris, Thomas; Prassopoulos, Panos; Gourtsoyiannis, Nicholas; Lauenstein, Thomas

    2003-01-01

    The objective of this study was to compare inversion recovery turbo 2D fast low-angle shot (FLASH) and 3D FLASH sequences for fecal-tagged MR colonography studies. Fifteen consecutive patients with indications for colonoscopy underwent MR colonography with fecal tagging. An inversion recovery turbo-FLASH sequence was applied and compared in terms of artifacts presence, efficiency for masking residual stool, and colonic wall conspicuity with a fat-saturated 3D FLASH sequence. Both sequences were acquired following administration of paramagnetic contrast agent. Contrast-to-noise ratio and relative contrast between colonic wall and lumen were calculated and compared for both sequences. Turbo 2D FLASH provided fewer artifacts, higher efficiency for masking the residual stool, and colonic wall conspicuity equivalent to 3D FLASH. An inversion time of 10 ms provided homogeneously low signal intensity of the colonic lumen. Contrast to noise between colonic wall and lumen was significantly higher in the 3D FLASH images, whereas differences in relative contrast were not statistically significant. An optimized inversion-recovery 2D turbo-FLASH sequence provides better fecal tagging results and should be added to the 3D FLASH sequence when designing dark-lumen MR colonography examination protocols. (orig.)

  6. Dynamic GnRH and hCG testing

    DEFF Research Database (Denmark)

    Bang, A. Kirstine; Nordkap, Loa; Almstrup, Kristian

    2017-01-01

    OBJECTIVE: Gonadotropin-releasing hormone (GnRH) and human chorionic gonadotropin (hCG) stimulation tests may be used to evaluate the pituitary and testicular capacity. Our aim was to evaluate changes in follicular-stimulating hormone (FSH), luteinizing hormone (LH) and testosterone after Gn...... influence of the tests was illustrated by results from 45 patients suspected of disordered hypothalamic-pituitary-gonadal axis. METHODS: Baseline, stimulated, relative and absolute changes in serum FSH and LH were determined by ultrasensitive TRIFMA, and testosterone was determined by LC-MS/MS. RESULTS......: For the reference group, LH and FSH increased almost 400% and 40% during GnRH testing, stimulated levels varied from 4.4 to 58.8 U/L and 0.2 to 11.8 U/L and FSH decreased in nine men. Testosterone increased approximately 110% (range: 18.7-67.6 nmol/L) during hCG testing. None of the polymorphisms had any major...

  7. A global flash flood forecasting system

    Science.gov (United States)

    Baugh, Calum; Pappenberger, Florian; Wetterhall, Fredrik; Hewson, Tim; Zsoter, Ervin

    2016-04-01

    The sudden and devastating nature of flash flood events means it is imperative to provide early warnings such as those derived from Numerical Weather Prediction (NWP) forecasts. Currently such systems exist on basin, national and continental scales in Europe, North America and Australia but rely on high resolution NWP forecasts or rainfall-radar nowcasting, neither of which have global coverage. To produce global flash flood forecasts this work investigates the possibility of using forecasts from a global NWP system. In particular we: (i) discuss how global NWP can be used for flash flood forecasting and discuss strengths and weaknesses; (ii) demonstrate how a robust evaluation can be performed given the rarity of the event; (iii) highlight the challenges and opportunities in communicating flash flood uncertainty to decision makers; and (iv) explore future developments which would significantly improve global flash flood forecasting. The proposed forecast system uses ensemble surface runoff forecasts from the ECMWF H-TESSEL land surface scheme. A flash flood index is generated using the ERIC (Enhanced Runoff Index based on Climatology) methodology [Raynaud et al., 2014]. This global methodology is applied to a series of flash floods across southern Europe. Results from the system are compared against warnings produced using the higher resolution COSMO-LEPS limited area model. The global system is evaluated by comparing forecasted warning locations against a flash flood database of media reports created in partnership with floodlist.com. To deal with the lack of objectivity in media reports we carefully assess the suitability of different skill scores and apply spatial uncertainty thresholds to the observations. To communicate the uncertainties of the flash flood system output we experiment with a dynamic region-growing algorithm. This automatically clusters regions of similar return period exceedence probabilities, thus presenting the at-risk areas at a spatial

  8. Method for programming a flash memory

    Energy Technology Data Exchange (ETDEWEB)

    Brosky, Alexander R.; Locke, William N.; Maher, Conrado M.

    2016-08-23

    A method of programming a flash memory is described. The method includes partitioning a flash memory into a first group having a first level of write-protection, a second group having a second level of write-protection, and a third group having a third level of write-protection. The write-protection of the second and third groups is disabled using an installation adapter. The third group is programmed using a Software Installation Device.

  9. Flash spectroscopy of purple membrane.

    Science.gov (United States)

    Xie, A H; Nagle, J F; Lozier, R H

    1987-04-01

    Flash spectroscopy data were obtained for purple membrane fragments at pH 5, 7, and 9 for seven temperatures from 5 degrees to 35 degrees C, at the magic angle for actinic versus measuring beam polarizations, at fifteen wavelengths from 380 to 700 nm, and for about five decades of time from 1 microsecond to completion of the photocycle. Signal-to-noise ratios are as high as 500. Systematic errors involving beam geometries, light scattering, absorption flattening, photoselection, temperature fluctuations, partial dark adaptation of the sample, unwanted actinic effects, and cooperativity were eliminated, compensated for, or are shown to be irrelevant for the conclusions. Using nonlinear least squares techniques, all data at one temperature and one pH were fitted to sums of exponential decays, which is the form required if the system obeys conventional first-order kinetics. The rate constants obtained have well behaved Arrhenius plots. Analysis of the residual errors of the fitting shows that seven exponentials are required to fit the data to the accuracy of the noise level.

  10. Improving Flash Flood Prediction in Multiple Environments

    Science.gov (United States)

    Broxton, P. D.; Troch, P. A.; Schaffner, M.; Unkrich, C.; Goodrich, D.; Wagener, T.; Yatheendradas, S.

    2009-12-01

    Flash flooding is a major concern in many fast responding headwater catchments . There are many efforts to model and to predict these flood events, though it is not currently possible to adequately predict the nature of flash flood events with a single model, and furthermore, many of these efforts do not even consider snow, which can, by itself, or in combination with rainfall events, cause destructive floods. The current research is aimed at broadening the applicability of flash flood modeling. Specifically, we will take a state of the art flash flood model that is designed to work with warm season precipitation in arid environments, the KINematic runoff and EROSion model (KINEROS2), and combine it with a continuous subsurface flow model and an energy balance snow model. This should improve its predictive capacity in humid environments where lateral subsurface flow significantly contributes to streamflow, and it will make possible the prediction of flooding events that involve rain-on-snow or rapid snowmelt. By modeling changes in the hydrologic state of a catchment before a flood begins, we can also better understand the factors or combination of factors that are necessary to produce large floods. Broadening the applicability of an already state of the art flash flood model, such as KINEROS2, is logical because flash floods can occur in all types of environments, and it may lead to better predictions, which are necessary to preserve life and property.

  11. Measuring hot flash phenomenonology using ambulatory prospective digital diaries

    Science.gov (United States)

    Fisher, William I.; Thurston, Rebecca C.

    2016-01-01

    Objective This study provides the description, protocol, and results from a novel prospective ambulatory digital hot flash phenomenon diary. Methods This study included 152 midlife women with daily hot flashes who completed an ambulatory electronic hot flash diary continuously for the waking hours of 3 consecutive days. In this diary, women recorded their hot flashes and accompanying characteristics and associations as the hot flashes occurred. Results Self-reported hot flash severity on the digital diaries indicated that the majority of hot flashes were rated as mild (41.3%) or moderate (43.7%). Severe (13.1%) and very severe (1.8%) hot flashes were less common. Hot flash bother ratings were rated as mild (43%), or moderate (33.5%), with fewer hot flashes reported bothersome (17.5%) or very bothersome (6%). The majority of hot flashes were reported as occurring on the on the face (78.9%), neck (74.7%), and chest (61.3%). Prickly skin was reported concurrently with 32% of hot flashes, 7% with anxiety and 5% with nausea. A novel finding, 38% of hot flashes were accompanied by a premonitory aura. Conclusion A prospective electronic digital hot flash diary allows for a more precise quantitation of hot flashes while overcoming many of the limitations of commonly employed retrospective questionnaires and paper diaries. Unique insights into the phenomenology, loci and associated characteristics of hot flashes were obtained using this device. The digital hot flash phenomenology diary is recommended for future ambulatory studies of hot flashes as a prospective measure of the hot flash experience. PMID:27404030

  12. Ground-Based Observations of Terrestrial Gamma Ray Flashes Associated with Downward-Directed Lightning Leaders

    Science.gov (United States)

    Belz, J.; Abbasi, R.; Krehbiel, P. R.; LeVon, R.; Remington, J.; Rison, W.; Thomas, R. J.

    2017-12-01

    Terrestrial Gamma Flashes (TGFs) have been observed in satellite-borne gamma ray detectors for several decades, starting with the BATSE instrument on the Compton Gamma-Ray observatory in 1994. TGFs consist of bursts of upwards of 1018 primary gamma rays, with a duration of up to a few milliseconds, originating in the Earth's atmosphere. More recent observations have shown that satellite-observed TGFs are generated in upward-propagating negative leaders of intracloud lightning, suggesting that they may be sensitive to the processes responsible for the initial lightning breakdown. Here, we present the first evidence that TGFs are also produced at the beginning of negative cloud-to-ground flashes, and that they may provide a new window through which ground-based observatories may contribute to understanding the breakdown process. The Telescope Array Surface Detector (TASD) is a 700 square kilometer cosmic ray observatory, an array of 507 3m2 scintillators on a 1.2 km grid. The array is triggered and read out when at least three adjacent detectors observe activity within an 8 μs window. Following the observation of bursts of anomalous TASD triggers, lasting a few hundred microseconds and correlated with local lightning activity, a Lightning Mapping Array (LMA) and slow electric field antenna were installed at the TASD site in order to study the effect. From data obtained between 2014 and 2016, correlated observations were obtained for ten -CG flashes. In 9 out of 10 cases, bursts of up to five anomalous triggers were detected during the first ms of the flash, as negative breakdown was descending into lower positive storm charge. The triggers occurred when the LMA-detected VHF radiation sources were at altitudes between 1.5 to 4.5 km AGL. The tenth flash was initiated by an unusually energetic leader that reached the ground in 2.5 ms and produced increasingly powerful triggers down to about 500 m AGL. While the TASD is not optimized for individual gamma ray detection

  13. FPGA Flash Memory High Speed Data Acquisition

    Science.gov (United States)

    Gonzalez, April

    2013-01-01

    The purpose of this research is to design and implement a VHDL ONFI Controller module for a Modular Instrumentation System. The goal of the Modular Instrumentation System will be to have a low power device that will store data and send the data at a low speed to a processor. The benefit of such a system will give an advantage over other purchased binary IP due to the capability of allowing NASA to re-use and modify the memory controller module. To accomplish the performance criteria of a low power system, an in house auxiliary board (Flash/ADC board), FPGA development kit, debug board, and modular instrumentation board will be jointly used for the data acquisition. The Flash/ADC board contains four, 1 MSPS, input channel signals and an Open NAND Flash memory module with an analog to digital converter. The ADC, data bits, and control line signals from the board are sent to an Microsemi/Actel FPGA development kit for VHDL programming of the flash memory WRITE, READ, READ STATUS, ERASE, and RESET operation waveforms using Libero software. The debug board will be used for verification of the analog input signal and be able to communicate via serial interface with the module instrumentation. The scope of the new controller module was to find and develop an ONFI controller with the debug board layout designed and completed for manufacture. Successful flash memory operation waveform test routines were completed, simulated, and tested to work on the FPGA board. Through connection of the Flash/ADC board with the FPGA, it was found that the device specifications were not being meet with Vdd reaching half of its voltage. Further testing showed that it was the manufactured Flash/ADC board that contained a misalignment with the ONFI memory module traces. The errors proved to be too great to fix in the time limit set for the project.

  14. A void distribution model-flashing flow

    International Nuclear Information System (INIS)

    Riznic, J.; Ishii, M.; Afgan, N.

    1987-01-01

    A new model for flashing flow based on wall nucleations is proposed here and the model predictions are compared with some experimental data. In order to calculate the bubble number density, the bubble number transport equation with a distributed source from the wall nucleation sites was used. Thus it was possible to avoid the usual assumption of a constant bubble number density. Comparisons of the model with the data shows that the model based on the nucleation site density correlation appears to be acceptable to describe the vapor generation in the flashing flow. For the limited data examined, the comparisons show rather satisfactory agreement without using a floating parameter to adjust the model. This result indicated that, at least for the experimental conditions considered here, the mechanistic predictions of the flashing phenomenon is possible on the present wall nucleation based model

  15. Mechanisms of nucleation in flashing flows

    International Nuclear Information System (INIS)

    Yan, F.; Giot, M.

    1989-01-01

    The mechanisms of nucleation have been analysed. Starting from the assumption that the activation of micro-cavities in the wall surfaces is the most probable nucleation mechanism in practical flashing system, the authors study in detail the nucleation in a micro-cavity. A three step nucleation criterion is proposed, namely: trapping cavity, activable cavity and active cavity. Then, a new nucleation model is presented. The output of the model is the prediction of the bubble departure frequency versus the thermodynamic state of the liquid and the geometry of the cavity. The model can also predict the nucleation site density if the nature of the wall and the surface roughness are know. The prediction have been successfully compared with some preliminary experimental results. By combining the present model with Jones'theory, the flashing inception is correctly predicted. The use of this nucleation model for the complete modelling of a flashing non-equilibrium flow is in progress

  16. Flash Builder 4 and Flex 4 Bible

    CERN Document Server

    Gassner, David

    2010-01-01

    A complete and thorough reference for developers on the new Flex 4 platform. Create desktop applications that behave identically on Windows, Mac OS X, and Linux with Adobe's new Flash Builder 4 platform and this in-depth guide. The book's tutorials and explanations walk you step-by-step through Flash Builder's new, faster tools; the new framework for generating code; how to connect to popular application servers; upgrading from Flex 3; and much more.: Shows you how to create rich applications for the Web and desktop with the very latest version of Flex, with detailed coverage for both new and

  17. Foundation Flash CS5 for Designers

    CERN Document Server

    Green, T

    2010-01-01

    Flash is one of the most engaging, innovative, and versatile technologies available - allowing the creation of anything from animated banners and simple cartoons to Rich Internet Applications, interactive videos, and dynamic user interfaces for web sites, kiosks, devices, or DVDs. The possibilities are endless, and now it just got better. Flash CS5 boasts a host of new features, including better support for mobile devices, a whole new animation engine enabling full manipulation of tweens and paths, custom easing, improved inverse kinematics, a revamped timeline, built-in 3D, and much more. Thi

  18. Data of evolutionary structure change: 1CG8A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8A-2ZLWD 1CG8 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...> 2ZLW D 2ZLWD ARHFG...fEVID> 2 2ZLW D 2ZLWD LWD... CA 218 GLN CA 251 2ZLW D

  19. Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD

  20. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  1. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  2. Kinderen met hyperthyreoïdie door verhoogd hCG

    NARCIS (Netherlands)

    Jöbsis, Jasper J.; van Trotsenburg, A. S. Paul; Merks, Johannes H. M.; Kamp, Gerdine A.

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking

  3. A novel HDAC inhibitor, CG200745, inhibits pancreatic cancer cell growth and overcomes gemcitabine resistance.

    Science.gov (United States)

    Lee, Hee Seung; Park, Soo Been; Kim, Sun A; Kwon, Sool Ki; Cha, Hyunju; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Song, Si Young

    2017-01-30

    Pancreatic cancer is predominantly lethal, and is primarily treated using gemcitabine, with increasing resistance. Therefore, novel agents that increase tumor sensitivity to gemcitabine are needed. Histone deacetylase (HDAC) inhibitors are emerging therapeutic agents, since HDAC plays an important role in cancer initiation and progression. We evaluated the antitumor effect of a novel HDAC inhibitor, CG200745, combined with gemcitabine/erlotinib on pancreatic cancer cells and gemcitabine-resistant pancreatic cancer cells. Three pancreatic cancer-cell lines were used to evaluate the antitumor effect of CG200745 combined with gemcitabine/erlotinib. CG200745 induced the expression of apoptotic proteins (PARP and caspase-3) and increased the levels of acetylated histone H3. CG200745 with gemcitabine/erlotinib showed significant growth inhibition and synergistic antitumor effects in vitro. In vivo, gemcitabine/erlotinib and CG200745 reduced tumor size up to 50%. CG200745 enhanced the sensitivity of gemcitabine-resistant pancreatic cancer cells to gemcitabine, and decreased the level of ATP-binding cassette-transporter genes, especially multidrug resistance protein 3 (MRP3) and MRP4. The novel HDAC inhibitor, CG200745, with gemcitabine/erlotinib had a synergistic anti-tumor effect on pancreatic cancer cells. CG200745 significantly improved pancreatic cancer sensitivity to gemcitabine, with a prominent antitumor effect on gemcitabine-resistant pancreatic cancer cells. Therefore, improved clinical outcome is expected in the future.

  4. CG2Real: Improving the Realism of Computer Generated Images Using a Large Collection of Photographs.

    Science.gov (United States)

    Johnson, Micah K; Dale, Kevin; Avidan, Shai; Pfister, Hanspeter; Freeman, William T; Matusik, Wojciech

    2011-09-01

    Computer-generated (CG) images have achieved high levels of realism. This realism, however, comes at the cost of long and expensive manual modeling, and often humans can still distinguish between CG and real images. We introduce a new data-driven approach for rendering realistic imagery that uses a large collection of photographs gathered from online repositories. Given a CG image, we retrieve a small number of real images with similar global structure. We identify corresponding regions between the CG and real images using a mean-shift cosegmentation algorithm. The user can then automatically transfer color, tone, and texture from matching regions to the CG image. Our system only uses image processing operations and does not require a 3D model of the scene, making it fast and easy to integrate into digital content creation workflows. Results of a user study show that our hybrid images appear more realistic than the originals.

  5. Postmenopausal pregnancy? Evaluation of elevated hCG in a 59-year-old woman.

    Science.gov (United States)

    Basham, Mary Margaret; Bryan, Teresa

    2017-06-05

    Slightly elevated serum human chorionic gonadotropin (hCG) can be a normal finding in postmenopausal women. We report a case of a 59-year-old woman with a history of abnormal uterine bleeding who presented with a concern for pregnancy after developing nausea and vomiting a few weeks after unprotected intercourse. Although pregnancy was extremely unlikely, hCG was obtained in order to reassure the patient since she reported that her mother conceived at the age of 60. Serum hCG was positive, prompting concern for malignancy versus pregnancy. Stable serum hCG levels, elevated follicle-stimulating hormone and negative transvaginal ultrasound ruled out both malignancy and pregnancy. Positive serum pregnancy test and hCG elevation was attributed to normal postmenopausal state. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  6. Mathematical modeling of the flash converting process

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, H.Y.; Perez-Tello, M.; Riihilahti, K.M. [Utah Univ., Salt Lake City, UT (United States)

    1996-12-31

    An axisymmetric mathematical model for the Kennecott-Outokumpu flash converting process for converting solid copper matte to copper is presented. The model is an adaptation of the comprehensive mathematical model formerly developed at the University of Utah for the flash smelting of copper concentrates. The model incorporates the transport of momentum, heat, mass, and reaction kinetics between gas and particles in a particle-laden turbulent gas jet. The standard k-{epsilon} model is used to describe gas-phase turbulence in an Eulerian framework. The particle-phase is treated from a Lagrangian viewpoint which is coupled to the gas-phase via the source terms in the Eulerian gas-phase governing equations. Matte particles were represented as Cu{sub 2}S yFeS, and assumed to undergo homogeneous oxidation to Cu{sub 2}O, Fe{sub 3}O{sub 4}, and SO{sub 2}. A reaction kinetics mechanism involving both external mass transfer of oxygen gas to the particle surface and diffusion of oxygen through the porous oxide layer is proposed to estimate the particle oxidation rate Predictions of the mathematical model were compared with the experimental data collected in a bench-scale flash converting facility. Good agreement between the model predictions and the measurements was obtained. The model was used to study the effect of different gas-injection configurations on the overall fluid dynamics in a commercial size flash converting shaft. (author)

  7. A hybrid ferroelectric-flash memory cells

    Science.gov (United States)

    Park, Jae Hyo; Byun, Chang Woo; Seok, Ki Hwan; Kim, Hyung Yoon; Chae, Hee Jae; Lee, Sol Kyu; Son, Se Wan; Ahn, Donghwan; Joo, Seung Ki

    2014-09-01

    A ferroelectric-flash (F-flash) memory cells having a metal-ferroelectric-nitride-oxynitride-silicon structure are demonstrated, and the ferroelectric materials were perovskite-dominated Pb(Zr,Ti)O3 (PZT) crystallized by Pt gate electrode. The PZT thin-film as a blocking layer improves electrical and memorial performance where programming and erasing mechanism are different from the metal-ferroelectric-insulator-semiconductor device or the conventional silicon-oxide-nitride-oxide-silicon device. F-flash cells exhibit not only the excellent electrical transistor performance, having 442.7 cm2 V-1 s-1 of field-effect mobility, 190 mV dec-1 of substhreshold slope, and 8 × 105 on/off drain current ratio, but also a high reliable memory characteristics, having a large memory window (6.5 V), low-operating voltage (0 to -5 V), faster P/E switching speed (50/500 μs), long retention time (>10 years), and excellent fatigue P/E cycle (>105) due to the boosting effect, amplification effect, and energy band distortion of nitride from the large polarization. All these characteristics correspond to the best performances among conventional flash cells reported so far.

  8. Electro-optical muzzle flash detection

    Science.gov (United States)

    Krieg, Jürgen; Eisele, Christian; Seiffer, Dirk

    2016-10-01

    Localizing a shooter in a complex scenario is a difficult task. Acoustic sensors can be used to detect blast waves. Radar technology permits detection of the projectile. A third method is to detect the muzzle flash using electro-optical devices. Detection of muzzle flash events is possible with focal plane arrays, line and single element detectors. In this paper, we will show that the detection of a muzzle flash works well in the shortwave infrared spectral range. Important for the acceptance of an operational warning system in daily use is a very low false alarm rate. Using data from a detector with a high sampling rate the temporal signature of a potential muzzle flash event can be analyzed and the false alarm rate can be reduced. Another important issue is the realization of an omnidirectional view required on an operational level. It will be shown that a combination of single element detectors and simple optics in an appropriate configuration is a capable solution.

  9. Mathematical modeling of the flash converting process

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, H Y; Perez-Tello, M; Riihilahti, K M [Utah Univ., Salt Lake City, UT (United States)

    1997-12-31

    An axisymmetric mathematical model for the Kennecott-Outokumpu flash converting process for converting solid copper matte to copper is presented. The model is an adaptation of the comprehensive mathematical model formerly developed at the University of Utah for the flash smelting of copper concentrates. The model incorporates the transport of momentum, heat, mass, and reaction kinetics between gas and particles in a particle-laden turbulent gas jet. The standard k-{epsilon} model is used to describe gas-phase turbulence in an Eulerian framework. The particle-phase is treated from a Lagrangian viewpoint which is coupled to the gas-phase via the source terms in the Eulerian gas-phase governing equations. Matte particles were represented as Cu{sub 2}S yFeS, and assumed to undergo homogeneous oxidation to Cu{sub 2}O, Fe{sub 3}O{sub 4}, and SO{sub 2}. A reaction kinetics mechanism involving both external mass transfer of oxygen gas to the particle surface and diffusion of oxygen through the porous oxide layer is proposed to estimate the particle oxidation rate Predictions of the mathematical model were compared with the experimental data collected in a bench-scale flash converting facility. Good agreement between the model predictions and the measurements was obtained. The model was used to study the effect of different gas-injection configurations on the overall fluid dynamics in a commercial size flash converting shaft. (author)

  10. Flash-Aware Page Replacement Algorithm

    Directory of Open Access Journals (Sweden)

    Guangxia Xu

    2014-01-01

    Full Text Available Due to the limited main memory resource of consumer electronics equipped with NAND flash memory as storage device, an efficient page replacement algorithm called FAPRA is proposed for NAND flash memory in the light of its inherent characteristics. FAPRA introduces an efficient victim page selection scheme taking into account the benefit-to-cost ratio for evicting each victim page candidate and the combined recency and frequency value, as well as the erase count of the block to which each page belongs. Since the dirty victim page often contains clean data that exist in both the main memory and the NAND flash memory based storage device, FAPRA only writes the dirty data within the victim page back to the NAND flash memory based storage device in order to reduce the redundant write operations. We conduct a series of trace-driven simulations and experimental results show that our proposed FAPRA algorithm outperforms the state-of-the-art algorithms in terms of page hit ratio, the number of write operations, runtime, and the degree of wear leveling.

  11. Interactions between Brief Flashed Lines at Threshold.

    Science.gov (United States)

    1987-12-11

    ORAIAIN 6 OFC ’PO 4 4M FMNTRIGOGNZTO lol in AFI, C 203 2- 44 . NAME OF PFN IG PORAIION lbOFFICE SYMBOL 7il PRO4MEN MINTRUNT INCNIATON NM ,.. .oAFOSR...Cass, P. C. (1986) Facilitatory interactionE between flashed lines. Perceptinn. jj,443-460. omith, P.A. and Cass, P C. (1967) Aliasing in the

  12. In Situ Flash Pyrolysis of Straw

    DEFF Research Database (Denmark)

    Bech, Niels

    In-Situ Flash Pyrolysis of Straw Ph.D. dissertation by Niels Bech Submitted: April 2007. Supervisors: Professor Kim Dam-Johansen, Associate Professor Peter Arendt Jensen Erfaringerne med forbrænding af halm opnået gennem et årti har vist, at en proces der kan koncentrere energien på marken, fjerne...

  13. Flash flood modelling for ungauged catchments

    Science.gov (United States)

    Garambois, P.-A.; Roux, H.; Larnier, K.; Dartus, D.

    2012-04-01

    Flash flood is a very intense and quick hydrologic response of a catchment to rainfall. This phenomenon has a high spatial-temporal variability as its generating storm, often hitting small catchments (few km2). Data collected by (Gaume et al. 2009) about 500 flash floods over the last 50 years showed that they could occur everywhere in Europe and more often in the Mediterranean regions, Alpine regions and continental Europe. Given the small spatial-temporal scales and high variability of flash floods, their prediction remains a hard exercise as the necessary data are often scarce. Flash flood prediction on ungauged catchments is one of the challenges of hydrological modelling as defined by (Sivapalan et al. 2003). Several studies have been headed up with the MARINE model (Modélisation de l'Anticipation du Ruissellement et des Inondations pour des évèNements Extrêmes) for the Gard region (France), (Roux et al. 2011), (Castaings et al. 2009). This physically based spatially distributed rainfall runoff model is dedicated to flash flood prediction. The study aims at finding a methodology for flash flood prediction at ungauged locations in the Cévennes-Vivarais region in particular. The regionalization method is based on multiple calibrations on gauged catchments in order to extract model structures (model + parameter values) for each catchment. Several mathematical methods (multiple regressions, transfer functions, krigging…) will then be tested to calculate a regional parameter set. The study also investigates the usability of additional hydrologic indices at different time scales to constrain model predictions from parameters obtained using these indices, and this independently of the model considered. These hydrologic indices gather information on hydrograph shape or catchment dynamic for instance. Results explaining global catchments behaviour are expected that way. The spatial-temporal variability of storms is also described through indices and linked with

  14. Physiologically assessed hot flashes and endothelial function among midlife women.

    Science.gov (United States)

    Thurston, Rebecca C; Chang, Yuefang; Barinas-Mitchell, Emma; Jennings, J Richard; von Känel, Roland; Landsittel, Doug P; Matthews, Karen A

    2017-08-01

    Hot flashes are experienced by most midlife women. Emerging data indicate that they may be associated with endothelial dysfunction. No studies have tested whether hot flashes are associated with endothelial function using physiologic measures of hot flashes. We tested whether physiologically assessed hot flashes were associated with poorer endothelial function. We also considered whether age modified associations. Two hundred seventy-two nonsmoking women reporting either daily hot flashes or no hot flashes, aged 40 to 60 years, and free of clinical cardiovascular disease, underwent ambulatory physiologic hot flash and diary hot flash monitoring; a blood draw; and ultrasound measurement of brachial artery flow-mediated dilation to assess endothelial function. Associations between hot flashes and flow-mediated dilation were tested in linear regression models controlling for lumen diameter, demographics, cardiovascular disease risk factors, and estradiol. In multivariable models incorporating cardiovascular disease risk factors, significant interactions by age (P hot flashes (beta [standard error] = -2.07 [0.79], P = 0.01), and more frequent physiologic hot flashes (for each hot flash: beta [standard error] = -0.10 [0.05], P = 0.03, multivariable) were associated with lower flow-mediated dilation. Associations were not accounted for by estradiol. Associations were not observed among the older women (age 54-60 years) or for self-reported hot flash frequency, severity, or bother. Among the younger women, hot flashes explained more variance in flow-mediated dilation than standard cardiovascular disease risk factors or estradiol. Among younger midlife women, frequent hot flashes were associated with poorer endothelial function and may provide information about women's vascular status beyond cardiovascular disease risk factors and estradiol.

  15. An unusual characteristic "flower-like" pattern: flash suppressor burns.

    Science.gov (United States)

    Gurcan, Altun

    2012-04-01

    The case on contact shots from firearms with a flash suppressor is rare. When a rifle fitted with a flash suppressor is fired, the emerging soot-laden gas in the barrel escapes from the slits of the flash suppressor. If the shot is contact or near contact, the flash suppressor will produce a characteristic "flower-like" pattern of seared, blackened zones around the entrance. This paper presents the injury pattern of the flash suppressor in a 29-year-old man who committed suicide with a G3 automatic infantry rifle.

  16. Ultrasensitive immunoradiometric assay for chorionic gonadotropin which does not cross-react with luteinizing hormone nor free β chain of hCG and which detects hCG in blood of non-pregnant humans

    International Nuclear Information System (INIS)

    Griffin, J.; Odell, W.D.

    1987-01-01

    A sensitive, non-competitive, two-monoclonal antibody, sandwich-type or immunoradiometric assay has been developed for human chorionic gonadotropin (hCG) which shows no cross-reaction with the free β chain of hCG nor with human luteinizing hormone (LH). In the assay procedure, two, highly selected monoclonal antibodies reacted in solution with hCG to be quantified. One antibody was covalently conjugated to biotin. This antibody was specific for the β subunit of hCG, and showed no reaction with LH nor the α subunit. The second antibody was labelled with 125 I and was specific for intact hCG and LH, showing no cross-reaction with βhCG nor the α subunit. The separation system was a polystyrene ball conjugated with biotin. This ball bound via an avidin bridge the monoclonal 'sandwich' containing hCG. Counts per minute bound to the ball were directly proportional to the amount of hCG present. The assay was specific for whole hCG and showed no reaction with βhCG, βLH, intact LH nor the free α subunit. Sensitivity was adequate to detect 'hCG-like' material in all post menopausal women and, when single samples were obtained, in over 2/3 of normal men. When multiple samples were obtained, 'hCG-like' material was detectable in all eugonadal adults studied. 27 refs.; 4 figs.; 1 table

  17. Flash flood forecasting, warning and risk management: the HYDRATE project

    International Nuclear Information System (INIS)

    Borga, M.; Anagnostou, E.N.; Bloeschl, G.; Creutin, J.-D.

    2011-01-01

    Highlights: → We characterize flash flood events in various regions of Europe. → We provide guidance to improve observations and monitoring of flash floods. → Flash floods are associated to orography and are influenced by initial soil moisture conditions. → Models for flash flood forecasting and flash flood hazard assessment are illustrated and discussed. → We examine implications for flood risk policy and discuss recommendations received from end users. - Abstract: The management of flash flood hazards and risks is a critical component of public safety and quality of life. Flash-floods develop at space and time scales that conventional observation systems are not able to monitor for rainfall and river discharge. Consequently, the atmospheric and hydrological generating mechanisms of flash-floods are poorly understood, leading to highly uncertain forecasts of these events. The objective of the HYDRATE project has been to improve the scientific basis of flash flood forecasting by advancing and harmonising a European-wide innovative flash flood observation strategy and developing a coherent set of technologies and tools for effective early warning systems. To this end, the project included actions on the organization of the existing flash flood data patrimony across Europe. The final aim of HYDRATE was to enhance the capability of flash flood forecasting in ungauged basins by exploiting the extended availability of flash flood data and the improved process understanding. This paper provides a review of the work conducted in HYDRATE with a special emphasis on how this body of research can contribute to guide the policy-life cycle concerning flash flood risk management.

  18. Electrical Safety and Arc Flash Protections

    Energy Technology Data Exchange (ETDEWEB)

    R. Camp

    2008-03-04

    Over the past four years, the Electrical Safety Program at PPPL has evolved in addressing changing regulatory requirements and lessons learned from accident events, particularly in regards to arc flash hazards and implementing NFPA 70E requirements. This presentation will discuss PPPL's approaches to the areas of electrical hazards evaluation, both shock and arc flash; engineered solutions for hazards mitigation such as remote racking of medium voltage breakers, operational changes for hazards avoidance, targeted personnel training and hazard appropriate personal protective equipment. Practical solutions for nominal voltage identification and zero voltage checks for lockout/tagout will also be covered. Finally, we will review the value of a comprehensive electrical drawing program, employee attitudes expressed as a personal safety work ethic, integrated safety management, and sustained management support for continuous safety improvement.

  19. Electrical Safety and Arc Flash Protections

    International Nuclear Information System (INIS)

    Camp, R.

    2008-01-01

    Over the past four years, the Electrical Safety Program at PPPL has evolved in addressing changing regulatory requirements and lessons learned from accident events, particularly in regards to arc flash hazards and implementing NFPA 70E requirements. This presentation will discuss PPPL's approaches to the areas of electrical hazards evaluation, both shock and arc flash; engineered solutions for hazards mitigation such as remote racking of medium voltage breakers, operational changes for hazards avoidance, targeted personnel training and hazard appropriate personal protective equipment. Practical solutions for nominal voltage identification and zero voltage checks for lockout/tagout will also be covered. Finally, we will review the value of a comprehensive electrical drawing program, employee attitudes expressed as a personal safety work ethic, integrated safety management, and sustained management support for continuous safety improvement.

  20. Sn whiskers removed by energy photo flashing

    International Nuclear Information System (INIS)

    Jiang, N.; Yang, M.; Novak, J.; Igor, P.; Osterman, M.

    2012-01-01

    Highlights: ► Sn whiskers were sintered by intense light flashing (Photosintering). ► Photosintering can effectively eliminate Sn whiskers. ► Photosintering would not damage electronic devices. ► Photosintering is a very promising approach to improve Sn-based electronic surface termination. - Abstract: Sn whiskers have been known to be the major issue resulting in electronic circuit shorts. In this study, we present a novel energy photo flashing approach (photosintering) to shorten and eliminate Sn whiskers. It has been found that photosintering is very effective to modify and remove Sn whiskers; only a sub-millisecond duration photosintering can amazingly get rid of over 90 vol.% of Sn whiskers. Moreover, this photosintering approach has also been proved to cause no damages to electronic devices, suggesting it is a potentially promising way to improve Sn-based electronic surface termination.

  1. Study of coal flash hydropyrolysis denitrogenation

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Lihua; Zhu, Zibin; Zhu, Hongbin; Zhang, Chengfang [Research Institute of Inorganic Chemical Technology, East China University of Science and Technology, 130 Meilong Road, Shanghai 200237 (China)

    2003-05-15

    The hydrodenitrogenation efficiency of 14 types of coals and the reaction mechanism of Zalainouer coal were studied in an experimental entrained bed reactor by flash hydropyrolysis (FHP). The results showed that flash hydropyrolysis is an efficient method for denitrogenation, and that the denitrogenation percentage increases with an increase in temperature and hydrogen pressure. For example, the denitrogenation percentage can reach up to about 60% for Zalainouer coal at 700 C and 6.0 MPa hydrogen pressure. The denitrogenation efficiency of different coal types is related to H/C. According to the conclusion of the study, the denitrogenation percentage increases with the increase in H/C ratio, reaching about 12% when H/C is equal to 0.6, and 40-55% when H/C is above 1.0. The results indicate that FHP is an efficient technique for removing nitrogen in coal.

  2. A Comparison of Cloud-to-Ground Lightning Characteristics and Observations from Multiple Networks and Videos during the 31 May 2013 El Reno, OK Tornadic Supercell Storm

    Science.gov (United States)

    Kuhlman, K. M.; Coy, J.; Seimon, A.

    2015-12-01

    Cloud-to-ground (CG) lightning flashes recorded by both the National Lightning Detection Network (NLDN) and Earth Networks Total Lightning Network (ENTLN) are compared with three-dimensional lightning mapping observations from the Oklahoma Lightning Mapping Array (OKLMA) and storm chaser video recorded of the 31 May 2013 El Reno tornadic supercell. The El Reno Survey Project (El-Reno-Survey.net) was created to crowd-source the abundance of storm chaser video from this event and provide open-access to the scientific community of the data. An initial comparison of CG lightning flashes captured on these videos with CG data from NLDN revealed a disagreement on the total number of flashes, with NLDN recording many negative CG flashes at lower peak amplitude not apparent in any of the videos. For this study, the area of the comparison was expanded to include the entire storm and data from both the ENTLN and LMA were added to compare the observations from each network in terms of timestamp, location detection, peak current, and polarity of each flash in the period 2230-2330 UTC. An initial comparison of 557 matched NLDN and ENLTN CG flashes, indicated predominately negative polairy CG flashes (58% NLDN/77% ENI) throughout the storm during this period. However, after a 15 kA peak current filter was applied, the NLDN indicated primarily positive polarity (84% +CG) while ENTLN still indicated primarily negative polarity (77% -CG) for the 264 remaining matched flashes. Before the filter was applied, the average distance between the two networks for the same flash was more than 2 km, but improved to approximately 1 km after the 15 kA filter was applied, likely removing some misidentified cloud flashes of uncertain location. This misclassification of IC flashes as CG at low peak current amplitudes for both networks is further evident when compared to video and the OKLMA data. Additionally, the charge analysis of OKLMA flashes revealed the NLDN-determined positive-polarity as

  3. Pressure drop in flashing flow through obstructions

    International Nuclear Information System (INIS)

    Weinle, M.E.; Johnston, B.S.

    1985-01-01

    An experiment was designed to investigate the pressure drop for flashing flow across obstructions of different geometries at various flow rates. Tests were run using two different orifices to determine if the two-phase pressure drop could be characterized by the single phase loss coefficient and the general behavior of the two-phase multiplier. For the geometries studied, it was possible to correlate the multiplier in a geometry-independent fashion

  4. Flash CS3 The Missing Manual

    CERN Document Server

    Grover, Chris

    2008-01-01

    Flash CS3, the latest version of the premier tool for creating web animations and interactive web sites, can be intimidating to learn. This entertaining reference tutorial provides a reader-friendly animation primer and a guided tour of all the program's tools and capabilities. Beginners will learn to use the software in no time, and experienced users will quickly take their skills to the next level.

  5. Flashing evaporation under different pressure levels

    International Nuclear Information System (INIS)

    Liao, Yixiang; Lucas, Dirk; Krepper, Eckhard; Rzehak, Roland

    2013-01-01

    Highlights: • CFD simulation based on two-fluid model for flashing boiling inside a vertical pipe. • Effect of pressure level on the maximum thermal energy available for evaporation. • Effect of presumed bubble size on the onset of flashing as well as evaporation rate. • Effect of pressure level on the critical bubble size that can start stable flashing. • Effect of pressure level on nucleation rate and mechanism. - Abstract: Flashing evaporation of water inside a vertical pipe under four pressure levels is investigated both experimentally and numerically. In the experiment depressurization is realized through a blow-off valve, and the evaporation rate is controlled by the opening rate and degree of the valve. In the CFD simulation phase change is assumed to be caused by thermal heat transfer between steam–water interface and the surrounding water. Consequently, the evaporation rate is determined by heat transfer coefficient, interfacial area density as well as liquid superheat degree. The simulated temporal course of cross-section averaged steam volume fraction is compared with the measured one. It is found that the increasing rate and maximum value of steam volume fraction is over-predicted under low-pressure conditions, which is mainly caused by the neglect of bubble growth in the mono-dispersed simulation. The agreement is notably improved by performing poly-dispersed simulations with the inhomogeneous MUSIG approach (IMUSIG). On the other hand an underestimation of the maximum steam volume fraction is observed in high-pressure cases, since the contribution of nucleation to the total steam generation rate becomes large as the system pressure increases. Reliable models for nucleation rate as well as bubble detachment size are indispensable for reliable predictions. An effect of the system pressure level on the nucleation mechanism is observed in the experiment

  6. Flashing subdiffusive ratchets in viscoelastic media

    International Nuclear Information System (INIS)

    Kharchenko, Vasyl; Goychuk, Igor

    2012-01-01

    We study subdiffusive ratchet transport in periodically and randomly flashing potentials. A central Brownian particle is elastically coupled to the surrounding auxiliary Brownian quasi-particles, which account for the influence of the viscoelastic environment. Similar to standard dynamical modeling of Brownian motion, the external force influences only the motion of the central particle, not affecting directly the environmental degrees of freedom. Just a handful of auxiliary Brownian particles suffices to model subdiffusion over many temporal decades. Time modulation of the potential violates the symmetry of thermal detailed balance and induces an anomalous subdiffusive current which exhibits a remarkably small dispersion at low temperatures, as well as a number of other surprising features such as saturation at low temperatures, and multiple inversions of the transport direction upon a change of the driving frequency in the non-adiabatic regime. It is shown that the subdiffusive current is finite at zero temperature for random flashing and can be finite for periodic flashing for a certain frequency window. Our study generalizes classical Brownian motors towards operating in sticky viscoelastic environments such as the cytosol of biological cells or dense polymer solutions. (paper)

  7. High precision timing in a FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Hoek, Matthias; Cardinali, Matteo; Dickescheid, Michael; Schlimme, Soeren; Sfienti, Concettina; Spruck, Bjoern; Thiel, Michaela [Institut fuer Kernphysik, Johannes Gutenberg-Universitaet Mainz (Germany)

    2016-07-01

    A segmented highly precise start counter (FLASH) was designed and constructed at the Institute for Nuclear Physics in Mainz. Besides determining a precise reference time, a Time-of-Flight measurement can be performed with two identical FLASH units. Thus, particle identification can be provided for mixed hadron beam environments. The detector design is based on the detection of Cherenkov light produced in fused silica radiator bars with fast multi-anode MCP-PMTs. The segmentation of the radiator improves the timing resolution while allowing a coarse position resolution along one direction. Both, the arrival time and the Time-over-Threshold are determined by the readout electronics, which enables walk correction of the arrival time. The performance of two FLASH units was investigated in test experiments at the Mainz Microton (MAMI) using an electron beam with an energy of 855 MeV and at CERN's PS T9 beam line with a mixed hadron beam with momenta between 3-8 GeV/c. Effective Time-walk correction methods based on Time-over-Threshold were developed for the data analysis. The achieved Time-Of-Flight resolution after applying all corrections was found to be 70 ps. Furthermore, the PID and position resolution capabilities are discussed in this contribution.

  8. Geographical distribution of hot flash frequencies: considering climatic influences.

    Science.gov (United States)

    Sievert, Lynnette Leidy; Flanagan, Erin K

    2005-10-01

    Laboratory studies suggest that hot flashes are triggered by small elevations in core body temperature acting within a reduced thermoneutral zone, i.e., the temperature range in which a woman neither shivers nor sweats. In the present study, it was hypothesized that women in different populations develop climate-specific thermoneutral zones, and ultimately, population-specific frequencies of hot flashes at menopause. Correlations were predicted between hot flash frequencies and latitude, elevation, and annual temperatures. Data on hot flash frequencies were drawn from 54 studies. Pearson correlation analyses and simple linear regressions were applied, first using all studies, and second using a subset of studies that included participants only to age 60 (n = 36). Regressions were repeated with all studies, controlling for method of hot flash assessment. When analyses were restricted to studies that included women up to age 60, average temperature of the coldest month was a significant predictor of hot flash frequency (P hottest and coldest temperatures was also a significant predictor (P coldest month, difference between hottest and coldest temperatures, and mean annual temperature were significant predictors of hot flash frequency. Women reported fewer hot flashes in warmer temperatures, and more hot flashes with increasing seasonality. These results suggest that acclimatization to coldest temperatures or sensitivity to seasonality may explain part of the population variation in hot flash frequency.

  9. Effect of human chorionic gonadotropin (hCG) on in vitro oocyte ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... In vitro exposure of Barilius vagra ovarian follicles to human chorionic gonadotropin (hCG) .... breakdown (GVBD) by treating them with egg clearing solution ..... trihydroxy-5Я-pregnen-20-one, in female plaice (Pleuronectes.

  10. Navy DD(X) and CG(X) Program: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    The FY2006-FY2011 Future Years Defense Plan (FYDP) reduces planned DD(X) destroyer procurement to one ship per year in FY2007-FY2011 and accelerates procurement of the first CG(X) cruiser to FY2011...

  11. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats

    OpenAIRE

    Lee, Eunjo; Song, Min-ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-01-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats...

  12. GeckoFTL: Scalable Flash Translation Techniques For Very Large Flash Devices

    DEFF Research Database (Denmark)

    Dayan, Niv; Bonnet, Philippe; Idreos, Stratos

    2016-01-01

    The volume of metadata needed by a flash translation layer (FTL) is proportional to the storage capacity of a flash device. Ideally, this metadata should reside in the device's integrated RAM to enable fast access. However, as flash devices scale to terabytes, the necessary volume of metadata...... thereby harming performance and device lifetime. In this paper, we identify a key component of the metadata called the Page Validity Bitmap (PVB) as the bottleneck. PVB is used by the garbage-collectors of state-of-the-art FTLs to keep track of which physical pages in the device are invalid. PVB...... constitutes 95% of the FTL's RAM-resident metadata, and recovering PVB after power fails takes a significant proportion of the overall recovery time. To solve this problem, we propose a page-associative FTL called GeckoFTL, whose central innovation is replacing PVB with a new data structure called Logarithmic...

  13. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

    Science.gov (United States)

    Lee, Eunjo; Song, Min-Ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-09-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats used in this study including those in the sham group had been unilaterally nephrectomized and allowed free access to drinking water containing 1% NaCl. Systolic blood pressure was measured by the tail-cuff method. Blood chemistry including sodium, potassium, glucose, triglyceride, and cholesterol levels was analyzed. Sections of the heart were visualized after trichrome and hematoxylin and eosin stain. The expression of hypertrophic genes such as atrial natriuretic peptide A (Nppa) and atrial natriuretic peptide B (Nppb) in addition to fibrotic genes such as Collagen-1, Collagen-3, connective tissue growth factor (Ctgf), and Fibronectin were measured by quantitative real-time PCR (qRT-PCR). Injection of DOCA increased systolic blood pressure, heart weight, and cardiac fibrosis, which was attenuated by CG200745. Neither DOCA nor CG200745 affected body weight, vascular contraction and relaxation responses, and blood chemistry. Injection of DOCA increased expression of both hypertrophic and fibrotic genes, which was abrogated by CG200745. These results indicate that CG200745 attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

  14. SDS-PAGE Electrophoretic Property of Human Chorionic Gonadotropin (hCG) and its β-subunit

    OpenAIRE

    Gam, Lay-Harn; Latiff, Aishah

    2005-01-01

    The microheterogeneity property of hCG with regards to its sialic acid contents resulted in variable mobility of the glycoprotein in SDS-PAGE. The intact hCG molecule is composed of two dissimilar subunits, namely α- and β-subunits. The identification of hCG bands in SDS-PAGE was accomplished by the immunoblotting experiment, whereby the antibody directed toward the specific region of β-subunit of hCG was used. The data shows that the different mobility of intact hCG was attributed to the dif...

  15. Decreased levels of genuine large free hCG alpha in men presenting with abnormal semen analysis

    Directory of Open Access Journals (Sweden)

    Plas Eugen

    2011-08-01

    Full Text Available Abstract Background The pregnancy hormone human chorionic gonadotropin (hCG and its free subunits (hCG alpha, hCG beta are produced in the male reproductive tract and found in high concentrations in seminal fluid, in particular hCG alpha. This study aimed to elucidate changes in peptide hormone profiles in patients showing abnormal semen analyses and to determine the genuineness of the highly abundant hCG alpha. Methods Seminal plasma was obtained from 45 male patients undergoing semen analysis during infertility workups. Comprehensive peptide hormone profiles were established by a panel of immunofluorometric assays for hCG, hCG alpha, hCG beta and its metabolite hCG beta core fragment, placental lactogen, growth hormone and prolactin in seminal plasma of patients with abnormal semen analysis results (n = 29 versus normozoospermic men (n = 16. The molecular identity of large hyperglycosylated hCG alpha was analyzed by mass-spectrometry and selective deglycosylation. Results hCG alpha levels were found to be significantly lower in men with impaired semen quality (1346 +/- 191 vs. 2753 +/- 533 ng/ml, P = 0.022. Moreover, patients with reduced sperm count had reduced intact hCG levels compared with normozoospermic men (0.097 +/- 0.022 vs. 0.203 +/- 0.040 ng/ml, P = 0.028. Using mass-spectrometry, the biochemical identity of hCG alpha purified from seminal plasma was verified. Under non-reducing conditions in SDS-PAGE, hCG alpha isolated from seminal plasma migrated in a manner comparable with large free hCG alpha with an apparent molecular mass (Mr, app of 24 kDa, while hCG alpha dissociated from pregnancy-derived holo-hCG migrated at approximately 22 kDa. After deglycosylation with PNGase F under denaturing conditions, all hCG alpha variants showed an Mr, app of 15 kDa, indicating identical amino acid backbones. Conclusions The findings indicate a pathophysiological relevance of hCG, particularly its free alpha subunit, in spermatogenesis. The

  16. A Comparative Study of Reduced-Variables-Based Flash and Conventional Flash

    DEFF Research Database (Denmark)

    Yan, Wei; Stenby, Erling Halfdan; Michelsen, Michael Locht

    2013-01-01

    ) with zero binary-interaction parameters (BIPs) and later generalized to situations with nonzero-BIP matrices. Most of the studies in the last decade suggest that the reduced-variables methods are much more efficient than the conventional flash method. However, Haugen and Beckner (2011) questioned...... with the conventional minimization-based flash. A test with the use of the SPE 3 example (Kenyon and Behie 1987) showed that the best reduction in time was less than 20% for the extreme situation of 25 components and just one row/column with nonzero BIPs. A better performance can be achieved by a simpler implementation...... directly using the sparsity of the BIP matrix....

  17. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor's Extracellular Hinge Region.

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) - secreted by the placenta, and lutropin (LH) - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge

  18. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor’s Extracellular Hinge Region

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) – secreted by the placenta, and lutropin (LH) – produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor’s leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the

  19. Flash memories economic principles of performance, cost and reliability optimization

    CERN Document Server

    Richter, Detlev

    2014-01-01

    The subject of this book is to introduce a model-based quantitative performance indicator methodology applicable for performance, cost and reliability optimization of non-volatile memories. The complex example of flash memories is used to introduce and apply the methodology. It has been developed by the author based on an industrial 2-bit to 4-bit per cell flash development project. For the first time, design and cost aspects of 3D integration of flash memory are treated in this book. Cell, array, performance and reliability effects of flash memories are introduced and analyzed. Key performance parameters are derived to handle the flash complexity. A performance and array memory model is developed and a set of performance indicators characterizing architecture, cost and durability is defined.   Flash memories are selected to apply the Performance Indicator Methodology to quantify design and technology innovation. A graphical representation based on trend lines is introduced to support a requirement based pr...

  20. Simple flash evaporator for making thin films of compounds

    Energy Technology Data Exchange (ETDEWEB)

    Hemanadhan, M.; Bapanayya, Ch.; Agarwal, S. C. [Department of Physics, Indian Institute of Technology, Kanpur 208016 (India)

    2010-07-15

    A simple and compact arrangement for flash evaporation is described. It uses a cell phone vibrator for powder dispensing that can be incorporated into a vacuum deposition chamber without any major alterations. The performance of the flash evaporation system is checked by making thin films of the optical memory chalcogenide glass Ge{sub 2}Sb{sub 2}Te{sub 5} (GST). Energy dispersive x-ray analysis shows that the flash evaporation preserves the stoichiometry in thin films.

  1. History of hot flashes and aortic calcification among postmenopausal women.

    Science.gov (United States)

    Thurston, Rebecca C; Kuller, Lewis H; Edmundowicz, Daniel; Matthews, Karen A

    2010-03-01

    Menopausal hot flashes are considered largely a quality-of-life issue. However, emerging research also links hot flashes to cardiovascular risk. In some investigations, this risk is particularly apparent among women using hormone therapy. The aim of this study was to determine whether a longer history of reported hot flashes over the study period was associated with greater aortic and coronary artery calcification. Interactions with hormone therapy use were examined in an exploratory fashion. Participants included 302 women participating in the Healthy Women Study, a longitudinal study of cardiovascular risk during perimenopause and postmenopause, which was initiated in 1983. Hot flashes (any/none) were assessed when women were 1, 2, 5, and 8 years postmenopausal. Electron beam tomography measures of coronary artery calcification and aortic calcification were completed in 1997-2004. Associations between the number of visits with report of hot flashes, divided by the number of visits attended, and aortic or coronary artery calcification (transformed) were examined in linear regression models. Interactions by hormone therapy use were evaluated. Among women using hormone therapy, a longer history of reported hot flashes was associated with increased aortic calcification, controlling for traditional cardiovascular risk factors (b = 2.87, SE = 1.21, P history of hot flashes and coronary artery calcification. Among postmenopausal women using hormone therapy, a longer history of reported hot flashes measured prospectively was associated with increased aortic calcification, controlling for traditional cardiovascular risk factors. Hot flashes may signal adverse cardiovascular changes among certain postmenopausal women.

  2. Flashes and floaters - a practical approach to assessment and management.

    Science.gov (United States)

    Kahawita, Shyalle; Simon, Sumu; Gilhotra, Jolly

    2014-04-01

    Flashes and floaters are common ophthalmic issues for which patients may initially present to their general practitioner. It may be a sign of benign, 
age-related changes of the vitreous or more serious retinal detachment. This article provides a guide to the assessment and management of a patient presenting with flashes and floaters. Although most patients presenting with flashes and floaters have benign 
age-related changes, they must be referred to an ophthalmologist to rule out sight-threatening conditions. Key examination features include the nature of the flashes and floaters, whether one or both eyes are affected and changes in visual acuity or visual field.

  3. The echo-enabled harmonic generation options for FLASH II

    International Nuclear Information System (INIS)

    Deng, Haixiao; Decking, Winfried; Faatz, Bart

    2011-03-01

    FLASH II is an upgrade to the existing free electron laser (FEL) FLASH. The echo-enabled harmonic generation (EEHG) scheme is proposed to be a potential seeding option of FLASH II. In this paper, the possibility of EEHG operation of FLASH II is investigated for the first time. With a combination of existing numerical codes, i.e. a laser-beam interaction code in an undulator (LBICU), a beam tracking code in a chicane (ELEGANT) and an universal FEL simulating code (GENESIS), the effects of beam energy chirp and coherent synchrotron radiation (CSR) on EEHG operation are studied as well. In addition, several interesting issues concerning EEHG simulation are discussed. (orig.)

  4. The Evolution and Structure of Extreme Optical Lightning Flashes.

    Science.gov (United States)

    Peterson, Michael; Rudlosky, Scott; Deierling, Wiebke

    2017-12-27

    This study documents the composition, morphology, and motion of extreme optical lightning flashes observed by the Lightning Imaging Sensor (LIS). The furthest separation of LIS events (groups) in any flash is 135 km (89 km), the flash with the largest footprint had an illuminated area of 10,604 km 2 , and the most dendritic flash has 234 visible branches. The longest-duration convective LIS flash lasted 28 s and is overgrouped and not physical. The longest-duration convective-to-stratiform propagating flash lasted 7.4 s, while the longest-duration entirely stratiform flash lasted 4.3 s. The longest series of nearly consecutive groups in time lasted 242 ms. The most radiant recorded LIS group (i.e., "superbolt") is 735 times more radiant than the average group. Factors that impact these optical measures of flash morphology and evolution are discussed. While it is apparent that LIS can record the horizontal development of the lightning channel in some cases, radiative transfer within the cloud limits the flash extent and level of detail measured from orbit. These analyses nonetheless suggest that lightning imagers such as LIS and Geostationary Lightning Mapper can complement ground-based lightning locating systems for studying physical lightning phenomena across large geospatial domains.

  5. Flash CS5.5 The Missing Manual

    CERN Document Server

    Grover, Chris

    2011-01-01

    You can build everything from simple animations to full-fledged iOS and Android apps with Flash CS5.5, but learning this complex program can be difficult-unless you have this fully updated, bestselling guide. Learn how to create gorgeous Flash effects even if you have no programming experience. With Flash CS5.5: The Missing Manual, you'll move from the basics to power-user tools with ease. Learn animation basics. Discover how to turn simple ideas into stunning animations.Master Flash's tools. Learn the animation and effects tools with clear explanations and hands-on examples.Use 3D effects. R

  6. Muzzle flash localization for the dismounted soldier

    Science.gov (United States)

    Kennedy Scott, Will

    2015-05-01

    The ability to accurately and rapidly know the precise location of enemy fire would be a substantial capability enhancement to the dismounted soldier. Acoustic gun-shot detections systems can provide an approximate bearing but it is desired to precisely know the location (direction and range) of enemy fire; for example to know from `which window' the fire is coming from. Funded by the UK MOD (via Roke Manor Research) QinetiQ is developing an imaging solution built around an InGaAs camera. This paper presents work that QinetiQ has undertaken on the Muzzle Flash Locator system. Key technical challenges that have been overcome are explained and discussed in this paper. They include; the design of the optical sensor and processing hardware to meet low size, weight and power requirements; the algorithm approach required to maintain sensitivity whilst rejecting false alarms from sources such as close passing insects and sun glint from scene objects; and operation on the move. This work shows that such a sensor can provide sufficient sensitivity to detect muzzle flash events to militarily significant ranges and that such a system can be combined with an acoustic gunshot detection system to minimize the false alarm rate. The muzzle flash sensor developed in this work operates in real-time and has a field of view of approximately 29° (horizontal) by 12° (vertical) with a pixel resolution of 0.13°. The work has demonstrated that extension to a sensor with realistic angular rotation rate is feasible.

  7. Fermi GBM Observations of Terrestrial Gamma Flashes

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Briggs, M. S.; Connaughton, V.; Fishman, G. J.; Bhat, P. N.; Paciesas, W. S.; Preece, R. D.; Kippen, R. M.; vonKienlin, A.; Dwyer, J. R.; hide

    2010-01-01

    In its first two years of operation, the Fermi Gamma Ray Burst Monitor (GBM) has observed 79 Terrestrial Gamma Flashes (TGFs). The thick Bismuth Germanate (BGO) detectors are excellent for TGF spectroscopy, having a high probability of recording the full energy of an incident photon, spanning a broad energy range from 150 keV to 40 MeV, and recording a large number of photons per TGF. Correlations between GBM TGF triggers and lightning sferics detected with the World-Wide Lightning Location Network indicate that TGFs and lightning are simultaneous to within tens of microseconds.

  8. Helium Extraction from LNG End Flash

    OpenAIRE

    Kim, Donghoi

    2014-01-01

    Helium is an invaluable element as it is widely used in industry such as cryo-genics and welding due to its unique properties. However, helium shortage is expected in near future because of increasing demand and the anxiety of sup-ply. Consequently, helium production has attracted the attention of industry. The main source of He is natural gas and extracting it from LNG end-flash is considered as the most promising way of producing crude helium. Thus, many process suppliers have proposed proc...

  9. Flash floods in Catalonia: a recurrent situation

    Science.gov (United States)

    Llasat, M. C.; Lindbergh, S.; Llasat-Botija, M.; Rodríguez, A.; Zaragoza, A.

    2009-09-01

    A database with information about the social impact produced by all the flood events recorded in Catalonia between 1982 and 2007 has been built. Original information comes from the INUNGAMA database (1900-2000) presented by Barnolas and Llasat (2007), the PRESSGAMA database (1982-2007) (Llasat et al., in rev.) and information from different published works (Barriendos et al, 2003; Barriendos and Pomés, 1993). Social impact has been obtained systematically in basis to news press data and, occasionally, in basis to insurance data. Flood events have been classified in ordinary floods, extraordinary floods and catastrophic ones, following the proposal of Llasat et al (2005). However, having in mind the flash floods effects, some new categories concerning casualties and car damages have also been introduced. The spatial and temporal distribution of these flood events has been analysed. Results have been compared with those obtained for the period 1900-2000 (Barnolas and Llasat, 2007) and 1350-2000 (Barrera et al, 2006). In order to better estimate the social impact and vulnerability some indicators have been defined and analyzed for some specific cases and a specific region. Besides the indicators applied in the INUNCAT Plan to obtain a cartography of flood risk in Catalonia, other ones like the number of cars affected or the number of request received by the meteorological service, has been also taken into account. These indicators allow analyzing global and temporal trends as well as characterizing the events. The selected region has been the Maresme, which is a flood prone region with a great density of population and that experiences every year one or more flash floods. The annual number of floods shows a positive trend that cannot be justified by the rainfall trend. Both vulnerability and hazard components have been considered and a discussion about the flood prevention measures is presented. The third part of this work has been centred in the analysis and

  10. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    International Nuclear Information System (INIS)

    Lu Zhiping; Ma Yunbao; Zhang Xiaoyi; Lv Weihua

    2005-01-01

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C 3 b receptor ratio (RBCC 3 bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C 3 levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P 0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC 3 bRR (%), CG, C 3 , IgG levels were significantly higher than those in controls (P 0.05). Conclusion: Various infectious diseases in pediatric patients could induce mild liver damage, which was closely related to the depressed immune status. High CG and HA levels in liver cancer patients suggested high mortality at 4 months. Women in late pregnancy might harbour disturbances in CG metabolism and mild liver injury though without overt symptoms. (authors)

  11. Exploring Branded Flash Mobs : A study of the impact of branded flash mobs on consumer behavior and consumer experience

    OpenAIRE

    Grant, Philip

    2014-01-01

    The desire of every marketer is to develop and maintain strong customer relationships. One way this can be accomplished is through effective advertising. Marketers have recently begun to brand flash mobs as a way to effectuate strong brand relationships. Even so, it is unclear whether or not the branding of flash mobs supports or frustrates this pursuit. Therefore, the goal of this thesis is to help marketers understand the potential impact that branded flash mobs may have on consumer behavio...

  12. Differences in signal activation by LH and hCG are mediated by the LH/CG receptor`s extracellular hinge region

    Directory of Open Access Journals (Sweden)

    Paul eGrzesik

    2015-09-01

    Full Text Available The human lutropin/choriogonadotropin receptor (LHCGR can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG - secreted by the placenta, and lutropin (LH - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich repeat domain (LRRD, as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting mutations. These helix preserving modifications showed no effect on hormone induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10 deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region s. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge region

  13. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    Energy Technology Data Exchange (ETDEWEB)

    Zhiping, Lu; Yunbao, Ma; Xiaoyi, Zhang; Weihua, Lv [Changshu Hospital Attached to Medical College of Yangzhou Univ., Changshu No.2 People' s Hospital, Changshu (China)

    2005-12-15

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C{sub 3}b receptor ratio (RBCC{sub 3} bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C{sub 3} levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P<0.01 ) with the exception of HA in CPH patients (P > 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P < 0.05). Among pregnant women, serum levels of HA and CG were significantly higher during the second and third trimesters (P<0.05-0.01) than those in the controls but not so during the first trimester. In the pediatric patients with infectious diseases, CG and HA levels were significantly higher in all these patients (P<0.01) with the only exception of HA in patients with mumps (P>0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC{sub 3}bRR (%), CG, C{sub 3}, IgG levels were significantly higher than those in controls (P<0.05 ) with no significant differences in the case of RBCICR (%), HA, IgM and IgA levels (P>0

  14. Functional reconstitution into liposomes of purified human RhCG ammonia channel.

    Directory of Open Access Journals (Sweden)

    Isabelle Mouro-Chanteloup

    Full Text Available BACKGROUND: Rh glycoproteins (RhAG, RhBG, RhCG are members of the Amt/Mep/Rh family which facilitate movement of ammonium across plasma membranes. Changes in ammonium transport activity following expression of Rh glycoproteins have been described in different heterologous systems such as yeasts, oocytes and eukaryotic cell lines. However, in these complex systems, a potential contribution of endogenous proteins to this function cannot be excluded. To demonstrate that Rh glycoproteins by themselves transport NH(3, human RhCG was purified to homogeneity and reconstituted into liposomes, giving new insights into its channel functional properties. METHODOLOGY/PRINCIPAL FINDINGS: An HA-tag introduced in the second extracellular loop of RhCG was used to purify to homogeneity the HA-tagged RhCG glycoprotein from detergent-solubilized recombinant HEK293E cells. Electron microscopy analysis of negatively stained purified RhCG-HA revealed, after image processing, homogeneous particles of 9 nm diameter with a trimeric protein structure. Reconstitution was performed with sphingomyelin, phosphatidylcholine and phosphatidic acid lipids in the presence of the C(12E(8 detergent which was subsequently removed by Biobeads. Control of protein incorporation was carried out by freeze-fracture electron microscopy. Particle density in liposomes was a function of the Lipid/Protein ratio. When compared to empty liposomes, ammonium permeability was increased two and three fold in RhCG-proteoliposomes, depending on the Lipid/Protein ratio (1/300 and 1/150, respectively. This strong NH(3 transport was reversibly inhibited by mercuric and copper salts and exhibited a low Arrhenius activation energy. CONCLUSIONS/SIGNIFICANCE: This study allowed the determination of ammonia permeability per RhCG monomer, showing that the apparent Punit(NH3 (around 1x10(-3 microm(3xs(-1 is close to the permeability measured in HEK293E cells expressing a recombinant human RhCG (1.60x10

  15. Case studies of selected Project "Flash" events

    Directory of Open Access Journals (Sweden)

    K. A. Nicolaides

    2009-03-01

    Full Text Available Flooding is a consequence of the prevailing meteorological situation, the intensity and duration of precipitation, geomorphology, human activities over a geographical region and other factors. Floods result in damage and destruction of infrastructure and private property and, in some cases, in fatalities. Flash floods are sudden and quite localized in extend, characterized by excessive amounts of rainfall within a short period of time and are distinguished from other floods by their degree of severity. The broader knowledge concerning flash floods is useful for the better understanding of the underlying thermodynamic and dynamic mechanisms, as well as the associated physical processes. The wider understanding of flashfloods can form part of an integrated system for short and very short forecasting of these events. In the present study, the synoptic, dynamic and thermodynamic conditions during the development of a baroclinic depression which affected the area of Cyprus on 6 November 2005 are studied. The depression was associated with extreme weather phenomena, such as thunderstorms, a water spout and high precipitation accumulations. The results indicate the importance of the dynamic parameters in the system's development and the thermodynamic analysis has shown the convective potential of the atmosphere.

  16. Flash pyrolysis fuel oil: BIO-POK

    Energy Technology Data Exchange (ETDEWEB)

    Gust, S [Neste Oy, Porvoo (Finland)

    1996-12-31

    Flash pyrolysis oil from Ensyn Tech., Canada and Union Fenosa, Spain was combusted with simple pressure atomisation equipment commonly used with light fuel oils in intermediate size (0.1-1 MW) boilers. With a number of modifications to the combustion system, carbon monoxide (CO) and nitrous oxide (NO{sub x}) could be reduced to acceptable levels: CO < 30 ppm and NO{sub x} < 140 ppm. Particulate emissions which were initially very high (Bacharach 4-5) were reduced (Bach. 2-3) by system changes but are still higher than from light fuel oil (Bach. <1). The modifications to the combustion system were: acid resistant progressive cavity pump, higher oil preheat temperature and higher oil pressure than for light fuel oils, refractory section between burner and boiler warmed up to at least 800 deg C. In addition, it was necessary to store pyrolysis oil samples under inert conditions to prevent oxidation and to rinse nozzles with alcohol after shutdown to prevent coking. The complexity and cost of these system modifications are considered to be too great for current grades of flash pyrolysis oil to be sold as a light fuel oil replacement. Improvements to fuel quality will be necessary. The main improvements are lowering of viscosity and improving of stability

  17. Flash Infrared Thermography Contrast Data Analysis Technique

    Science.gov (United States)

    Koshti, Ajay

    2014-01-01

    This paper provides information on an IR Contrast technique that involves extracting normalized contrast versus time evolutions from the flash thermography inspection infrared video data. The analysis calculates thermal measurement features from the contrast evolution. In addition, simulation of the contrast evolution is achieved through calibration on measured contrast evolutions from many flat-bottom holes in the subject material. The measurement features and the contrast simulation are used to evaluate flash thermography data in order to characterize delamination-like anomalies. The thermal measurement features relate to the anomaly characteristics. The contrast evolution simulation is matched to the measured contrast evolution over an anomaly to provide an assessment of the anomaly depth and width which correspond to the depth and diameter of the equivalent flat-bottom hole (EFBH) similar to that used as input to the simulation. A similar analysis, in terms of diameter and depth of an equivalent uniform gap (EUG) providing a best match with the measured contrast evolution, is also provided. An edge detection technique called the half-max is used to measure width and length of the anomaly. Results of the half-max width and the EFBH/EUG diameter are compared to evaluate the anomaly. The information provided here is geared towards explaining the IR Contrast technique. Results from a limited amount of validation data on reinforced carbon-carbon (RCC) hardware are included in this paper.

  18. Flash pyrolysis fuel oil: BIO-POK

    Energy Technology Data Exchange (ETDEWEB)

    Gust, S. [Neste Oy, Porvoo (Finland)

    1995-12-31

    Flash pyrolysis oil from Ensyn Tech., Canada and Union Fenosa, Spain was combusted with simple pressure atomisation equipment commonly used with light fuel oils in intermediate size (0.1-1 MW) boilers. With a number of modifications to the combustion system, carbon monoxide (CO) and nitrous oxide (NO{sub x}) could be reduced to acceptable levels: CO < 30 ppm and NO{sub x} < 140 ppm. Particulate emissions which were initially very high (Bacharach 4-5) were reduced (Bach. 2-3) by system changes but are still higher than from light fuel oil (Bach. <1). The modifications to the combustion system were: acid resistant progressive cavity pump, higher oil preheat temperature and higher oil pressure than for light fuel oils, refractory section between burner and boiler warmed up to at least 800 deg C. In addition, it was necessary to store pyrolysis oil samples under inert conditions to prevent oxidation and to rinse nozzles with alcohol after shutdown to prevent coking. The complexity and cost of these system modifications are considered to be too great for current grades of flash pyrolysis oil to be sold as a light fuel oil replacement. Improvements to fuel quality will be necessary. The main improvements are lowering of viscosity and improving of stability

  19. Radiation damage in flash memory cells

    International Nuclear Information System (INIS)

    Claeys, C.; Ohyama, H.; Simoen, E.; Nakabayashi, M.; Kobayashi, K.

    2002-01-01

    Results are presented of a study on the effects of total ionization dose and displacement damage, induced by high-energy electrons, protons and alphas, on the performance degradation of flash memory cells integrated in a microcomputer. A conventional stacked-gate n-channel flash memory cell using a 0.8 μm n-polysilicon gate technology is employed. Irradiations by 1-MeV electrons and 20-MeV protons and alpha particles were done at room temperature. The impact of the fluence on the input characteristics, threshold voltage shift and drain and gate leakage was investigated. The threshold voltage change for proton and alpha irradiations is about three orders of magnitude larger than that for electrons. The performance degradation is mainly caused by the total ionization dose (TID) damage in the tunnel oxide and in the interpoly dielectric layer and by the creation of interface traps at the Si-SiO 2 interface. The impact of the irradiation temperature on the device degradation was studied for electrons and gammas, pointing out that irradiation at room temperature is mostly the worst case. Finally, attention is given to the impact of isochronal and isothermal annealing on the recovery of the degradation introduced after room temperature proton and electron irradiation

  20. Honeywell optical investigations on FLASH program

    Science.gov (United States)

    O'Rourke, Ken; Peterson, Eric; Yount, Larry

    1995-05-01

    The increasing performance and reduction of life cycle cost requirements placed on commercial and military transport aircraft are resulting in more complex, highly integrated aircraft control and management systems. The use of fiber optic data transmission media can make significant contributions in achieving these performance and cost goals. The Honeywell portion of Task 2A on the Fly-by-Light Advanced System Hardware (FLASH) program is evaluating a Primary Flight Control System (PFCS) using pilot and copilot inputs from Active Hand Controllers (AHC) which are optically linked to the primary flight Control Computers (PFCC). Customer involvement is an important element of the Task 2A activity. Establishing customer requirements and perspectives on productization of systems developed under FLASH are key to future product success. The Honeywell elements of the PFCS demonstrator provide a command path that is optically interfaced from crew inputs to commands of distributed, smart actuation subsystems commands. Optical communication architectures are implemented using several protocols including the new AS-1773A 20 Mbps data bus standard. The interconnecting fiber optic cable plant is provided by our Task 1A teammate McDonnell Douglas Aerospace (West). Fiber optic cable plant fabrication uses processed, tools and materials reflecting necessary advances in manufacturing required to make fly-by-light avionics systems marketable.

  1. System of ispFlash configuration

    International Nuclear Information System (INIS)

    Bourrion, Olivier

    2003-01-01

    The aim of this module is to allow the use of FPGA components instead of EPLD components which for an equivalent or even inferior capacity are more expensive. For instance, the idea is to replace CPLD components having 512 macro-cells by one FPGA spartan II of Xilinx. However, due to the configuration's volatility, one configuration means is needed to put under voltage. A solution appears to be the using of a high capacity Flash memory coupled to a CPLD of small size to comply with the FPGA configuration protocol; also, one has to provide an in situ configuration means for this memory. Obviously, a product having an equivalent functionality already exists, since Xilinx and ALTERA supply PROMs of serial configuration. Unfortunately, they are expensive and a dealer is implied while the FLASH, the small CPLD and the FPGA spartan II are currently available. In conclusion, by using this assembly, which requires a small supplementary surface and a delay of upmost 240 ms (for the largest FPGA 1 Mbit), one obtains a solution cheaper and more performing than an EPLD of high capacity

  2. Intrauterine administration of human chorionic gonadotropin (hCG) for subfertile women undergoing assisted reproduction.

    Science.gov (United States)

    Craciunas, Laurentiu; Tsampras, Nikolaos; Coomarasamy, Arri; Raine-Fenning, Nick

    2016-05-20

    Subfertility affects 15% of couples and represents the inability to conceive naturally following 12 months of regular unprotected sexual intercourse. Assisted reproduction refers to procedures involving the in vitro handling of both human gametes and represents a key option for many subfertile couples. Most women undergoing assisted reproduction treatment will reach the stage of embryo transfer (ET) but the proportion of embryos that successfully implant following ET has remained small since the mid-1990s. Human chorionic gonadotropin (hCG) is a hormone synthesised and released by the syncytiotrophoblast and has a fundamental role in embryo implantation and the early stages of pregnancy. Intrauterine administration of synthetic or natural hCG via an ET catheter during a mock procedure around the time of ET is a novel approach that has recently been suggested to improve the outcomes of assisted reproduction. To investigate whether the intrauterine administration of hCG around the time of ET improves the clinical outcomes in subfertile women undergoing assisted reproduction. We performed a comprehensive literature search of the Cochrane Gynaecology and Fertility Group Specialised Register, Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, EMBASE, CINAHL, PsycINFO, registers of ongoing trials andreference lists of all included studies and relevant reviews (from inception to 10 November 2015), in consultation with the Cochrane Gynaecology and Fertility Group Trials Search Co-ordinator. We included all randomised controlled trials (RCTs) evaluating intrauterine administration of hCG around the time of ET in this review irrespective of language and country of origin. Two authors independently selected studies, assessed risk of bias, extracted data from studies and attempted to contact the authors where data were missing. We performed statistical analysis using Review Manager 5 in accordance with the Cochrane Handbook for Systematic Reviews of

  3. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM).

    Science.gov (United States)

    Sinitskiy, Anton V; Voth, Gregory A

    2018-01-07

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  4. Characterization of CG6178 gene product with high sequence similarity to firefly luciferase in Drosophila melanogaster.

    Science.gov (United States)

    Oba, Yuichi; Ojika, Makoto; Inouye, Satoshi

    2004-03-31

    This is the first identification of a long-chain fatty acyl-CoA synthetase in Drosophila by enzymatic characterization. The gene product of CG6178 (CG6178) in Drosophila melanogaster genome, which has a high sequence similarity to firefly luciferase, has been expressed and characterized. CG6178 showed long-chain fatty acyl-CoA synthetic activity in the presence of ATP, CoA and Mg(2+), suggesting a fatty acyl adenylate is an intermediate. Recently, it was revealed that firefly luciferase has two catalytic functions, monooxygenase (luciferase) and AMP-mediated CoA ligase (fatty acyl-CoA synthetase). However, unlike firefly luciferase, CG6178 did not show luminescence activity in the presence of firefly luciferin, ATP, CoA and Mg(2+). The enzymatic properties of CG6178 including substrate specificity, pH dependency and optimal temperature were close to those of firefly luciferase and rat fatty acyl-CoA synthetase. Further, phylogenic analyses strongly suggest that the firefly luciferase gene may have evolved from a fatty acyl-CoA synthetase gene as a common ancestral gene.

  5. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM)

    Science.gov (United States)

    Sinitskiy, Anton V.; Voth, Gregory A.

    2018-01-01

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  6. Critical flashing flows in nozzles with subcooled inlet conditions

    International Nuclear Information System (INIS)

    Abuaf, N.; Jones, O.C. Jr.; Wu, B.J.C.

    1983-01-01

    Examination of a large number of experiments dealing with flashing flows in converging and converging-diverging nozzles reveals that knowledge of the flashing inception point is the key to the prediction of critical flow rates. An extension of the static flashing inception correlation of Jones [16] and Alamgir and Lienhard [17] to flowing systems has allowed the determination of the location of flashing inception in nozzle flows with subcooled inlet conditions. It is shown that in all the experiments examined with subcooled inlet regardless of the degree of inlet subcooling, flashing inception invariably occurred very close to the throat. A correlation is given to predict flashing inception in both pipes and nozzles which matches all data available, but is lacking verification in intermediate nozzle geometries where turbulence may be important. A consequence of this behavior is that the critical mass flux may be correlated to the pressure difference between the nozzle inlet and flashing inception, through a single phase liquid discharge coefficient and an accurate prediction of the flashing inception pressure at the throat. Comparison with the available experiments indicate that the predicted mass fluxes are within 5 percent of the measurements

  7. Assessment of vulnerability to extreme flash floods in design storms.

    Science.gov (United States)

    Kim, Eung Seok; Choi, Hyun Il

    2011-07-01

    There has been an increase in the occurrence of sudden local flooding of great volume and short duration caused by heavy or excessive rainfall intensity over a small area, which presents the greatest potential danger threat to the natural environment, human life, public health and property, etc. Such flash floods have rapid runoff and debris flow that rises quickly with little or no advance warning to prevent flood damage. This study develops a flash flood index through the average of the same scale relative severity factors quantifying characteristics of hydrographs generated from a rainfall-runoff model for the long-term observed rainfall data in a small ungauged study basin, and presents regression equations between rainfall characteristics and the flash flood index. The aim of this study is to develop flash flood index-duration-frequency relation curves by combining the rainfall intensity-duration-frequency relation and the flash flood index from probability rainfall data in order to evaluate vulnerability to extreme flash floods in design storms. This study is an initial effort to quantify the flash flood severity of design storms for both existing and planned flood control facilities to cope with residual flood risks due to extreme flash floods that have ocurred frequently in recent years.

  8. Phototoxic effects of commercial photographic flash lamp on rat eyes.

    Science.gov (United States)

    Inoue, Makoto; Shinoda, Kei; Ohde, Hisao; Tezuka, Keiji; Hida, Tetsuo

    2006-11-01

    To determine whether exposure of the cornea and retina of rats to flashes from a commercial photographic flash lamp is phototoxic. Sprague-Dawley rats were exposed to 10, 100, or 1,000 flashes of the OPTICAM 16M photographic flash lamp (Fujikoeki, Japan) placed 0.1, 1, or 3 m from the eyes. Corneal damage was assessed by a fluorescein staining score, and the retinal damage by eletroretinography (ERG) and histology before and 24 h after exposure. Exposure of the eyes to 1,000 flashes at 0.1 m increased the fluorescein staining score significantly (P = 0.009, the Mann-Whitney test). Scanning electron microscopy (SEM) of the cornea showed a detachment of the epithelial cells from the surface after this exposure. The amplitude of the a-wave was decreased significantly by 23.0% (P = 0.026) of the amplitude before the exposure, and the b-wave by 19.7% (P = 0.0478) following 1,000 flashes at 0.1 m but not by the other exposures. TUNEL-positive cells were present in the outer nuclear layer only after the extreme exposure, but no significant decrease in retinal thickness was seen under any condition. The fluorescein staining score and ERGs recovered to control levels within 1 week. Light exposure to a photographic flash lamp does not induce damage to the cornea and retina except when they are exposed to 1,000 flashes at 0.1 m.

  9. Microstructure of wood charcoal prepared by flash heating

    NARCIS (Netherlands)

    Kurosaki, F; Ishimaru, K; Hata, T; Bronsveld, P; Kobayashi, E; Imamura, Y

    2003-01-01

    Carbonized wood prepared by flash heating at 800 degreesC for I h shows a different microstructure and surface chemical structure than char formed after slow heating at 4 degreesC/min to 800 degreesC for I h. Flash heating produces pores that are surrounded by aggregates of carbon structures 25 to

  10. Flash radiographic technique applied to fuel injector sprays

    International Nuclear Information System (INIS)

    Vantine, H.C.

    1977-01-01

    A flash radiographic technique, using 50 ns exposure times, was used to study the pattern and density distribution of a fuel injector spray. The experimental apparatus and method are described. An 85 kVp flash x-ray generator, designed and fabricated at the Lawrence Livermore Laboratory, is utilized. Radiographic images, recorded on standard x-ray films, are digitized and computer processed

  11. Flash-induced fading: Dependence on colour and shape similarity

    NARCIS (Netherlands)

    Vergeer, M.L.T.; Lier, R.J. van

    2005-01-01

    We investigated the effects of perceptual grouping by colour and shape similarity on flash-induced perceptual fading. This flash-induced fading effect (Kanai et al, 2003 Journal of Cognitive Neuroscience 15 664 - 672) is considered as a time-locked variant of the Troxler effect. In the original

  12. Clinical significance of changes of serum TBA, CG, HA levels in neonate with parenteral nutrition

    International Nuclear Information System (INIS)

    Huang Weiliang; Zhou Jiongying; Zhang Xiaoyi; Lv Weihua; Ma Yunbao; He Qizhi

    2010-01-01

    Objective: To study the clinical significance of changes of serum levels of TBA, CG, HA in neonate with parenteral nutrition. Methods: Serum total bile acid (TBA, with biochemistry) and CG, HA (with RIA) contents were measured in 52 neonates (full-term 32, preterm 20) with parenteral nutrition and 28 neonates (full-term 16, preterm 12) without parenteral nutrition (as controls). Results: Before parenteral nutrition,the serum TBA, CG and HA levels in full-term neonates were not significantly different from those in the controls (P>0.05). After parenteral nutrition,serum levels were significantly higher than those before parenteral nutrition (P<0.01). The levels in pre-term neonates were significantly higher after parenteral nutrition than those in full-term neonates (P<0.05). Conclusion: Long term parenteral nutrition might be harmful to hepatic and gall bladder function in neonates especially in premature ones. (authors)

  13. Micro-dose hCG as luteal phase support without exogenous progesterone administration

    DEFF Research Database (Denmark)

    Andersen, C Yding; Fischer, R; Giorgione, V

    2016-01-01

    RHa trigger to induce ovulation showed that exogenous progesterone administration without hCG supplementation was insufficient to obtain satisfactory pregnancy rates. This has prompted development of alternative strategies for LPS. Augmenting the local endogenous production of progesterone by the multiple......For the last two decades, exogenous progesterone administration has been used as luteal phase support (LPS) in connection with controlled ovarian stimulation combined with use of the human chorionic gonadotropin (hCG) trigger for the final maturation of follicles. The introduction of the Gn...... corpora lutea has been one focus with emphasis on one hand to avoid development of ovarian hyper-stimulation syndrome and, on the other hand, to provide adequate levels of progesterone to sustain implantation. The present study evaluates the use of micro-dose hCG for LPS support and examines the potential...

  14. NELIOTA: First temperature measurement of lunar impact flashes

    Science.gov (United States)

    Bonanos, A. Z.; Avdellidou, C.; Liakos, A.; Xilouris, E. M.; Dapergolas, A.; Koschny, D.; Bellas-Velidis, I.; Boumis, P.; Charmandaris, V.; Fytsilis, A.; Maroussis, A.

    2018-04-01

    We report the first scientific results from the NELIOTA (NEO Lunar Impacts and Optical TrAnsients) project, which has recently begun lunar monitoring observations with the 1.2-m Kryoneri telescope. NELIOTA aims to detect faint impact flashes produced by near-Earth meteoroids and asteroids and thereby help constrain the size-frequency distribution of near-Earth objects in the decimeter to meter range. The NELIOTA setup, consisting of two fast-frame cameras observing simultaneously in the R and I bands, enables - for the first time - direct analytical calculation of the flash temperatures. We present the first ten flashes detected, for which we find temperatures in the range 1600 to 3100 K, in agreement with theoretical values. Two of these flashes were detected on multiple frames in both filters and therefore yield the first measurements of the temperature drop for lunar flashes. In addition, we compute the impactor masses, which range between 100 g and 50 kg.

  15. Serum Beta-hCG of 11 Days after Embryo Transfer to Predict Pregnancy Outcome

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Objective To assess the clinic value of a single maternal serum beta-human chorionic gonadotropin (β-hCG) assay 11 d after embryo transfer in ART pregnancies and to predict pregnancy outcome.Methods A total of 384 pregnancies after embryo transfer were included.Inviable pregnancies were defined as biochemical pregnancies,ectopic pregnancies and first trimester abortions.Ongoing pregnancies were defined as singleton pregnancies and multiple pregnancies whose gestation were achieved more than 12 weeks.Serum β-hCG concentrations were compared among different groups.Results On the post embryo transfer d 11,the mean β-hCG concentration of the ongoing pregnancy group (323.7±285.2 mIU/ml) was significantly higher than that of the inviable pregnancy group(81.4±68.1 mmIU/ml)(P<0.001).In multiple gestations,the levels of β-hCG were significantly higher compared with singleton pregnancies.If the β-hCG level was between 10 mIU/ml and 50 mIU/ml,the positive predictive value of biochemical pregnancies and ectopic pregnancies was 81.8%,the negative predictive value was 94.4%.If the level was less than 100 mIU/ml,the positive predictive value of first trimester abortions was 80.8% the negative predictive value was 77.8%.If the level was greater than 250 mIU/ml,the positive predictive value of multiple pregnancies was 83.3%.the negative predictive value was 74.4%.Conclusions A single serum β-hCG level on d 11 after embryo transfer has good predictive valuefor clinical pregnancy outcome in controlled ovarian stimulation cycles and helps to plan the subsequent follow-up.

  16. Development of Mycoplasma synoviae (MS) core genome multilocus sequence typing (cgMLST) scheme.

    Science.gov (United States)

    Ghanem, Mostafa; El-Gazzar, Mohamed

    2018-05-01

    Mycoplasma synoviae (MS) is a poultry pathogen with reported increased prevalence and virulence in recent years. MS strain identification is essential for prevention, control efforts and epidemiological outbreak investigations. Multiple multilocus based sequence typing schemes have been developed for MS, yet the resolution of these schemes could be limited for outbreak investigation. The cost of whole genome sequencing became close to that of sequencing the seven MLST targets; however, there is no standardized method for typing MS strains based on whole genome sequences. In this paper, we propose a core genome multilocus sequence typing (cgMLST) scheme as a standardized and reproducible method for typing MS based whole genome sequences. A diverse set of 25 MS whole genome sequences were used to identify 302 core genome genes as cgMLST targets (35.5% of MS genome) and 44 whole genome sequences of MS isolates from six countries in four continents were used for typing applying this scheme. cgMLST based phylogenetic trees displayed a high degree of agreement with core genome SNP based analysis and available epidemiological information. cgMLST allowed evaluation of two conventional MLST schemes of MS. The high discriminatory power of cgMLST allowed differentiation between samples of the same conventional MLST type. cgMLST represents a standardized, accurate, highly discriminatory, and reproducible method for differentiation between MS isolates. Like conventional MLST, it provides stable and expandable nomenclature, allowing for comparing and sharing the typing results between different laboratories worldwide. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  17. Flood hazard assessment in areas prone to flash flooding

    Science.gov (United States)

    Kvočka, Davor; Falconer, Roger A.; Bray, Michaela

    2016-04-01

    Contemporary climate projections suggest that there will be an increase in the occurrence of high-intensity rainfall events in the future. These precipitation extremes are usually the main cause for the emergence of extreme flooding, such as flash flooding. Flash floods are among the most unpredictable, violent and fatal natural hazards in the world. Furthermore, it is expected that flash flooding will occur even more frequently in the future due to more frequent development of extreme weather events, which will greatly increase the danger to people caused by flash flooding. This being the case, there will be a need for high resolution flood hazard maps in areas susceptible to flash flooding. This study investigates what type of flood hazard assessment methods should be used for assessing the flood hazard to people caused by flash flooding. Two different types of flood hazard assessment methods were tested: (i) a widely used method based on an empirical analysis, and (ii) a new, physically based and experimentally calibrated method. Two flash flood events were considered herein, namely: the 2004 Boscastle flash flood and the 2007 Železniki flash flood. The results obtained in this study suggest that in the areas susceptible to extreme flooding, the flood hazard assessment should be conducted using methods based on a mechanics-based analysis. In comparison to standard flood hazard assessment methods, these physically based methods: (i) take into account all of the physical forces, which act on a human body in floodwater, (ii) successfully adapt to abrupt changes in the flow regime, which often occur for flash flood events, and (iii) rapidly assess a flood hazard index in a relatively short period of time.

  18. The October 2014 United States Treasury bond flash crash and the contributory effect of mini flash crashes.

    Directory of Open Access Journals (Sweden)

    Zachary S Levine

    Full Text Available We investigate the causal uncertainty surrounding the flash crash in the U.S. Treasury bond market on October 15, 2014, and the unresolved concern that no clear link has been identified between the start of the flash crash at 9:33 and the opening of the U.S. equity market at 9:30. We consider the contributory effect of mini flash crashes in equity markets, and find that the number of equity mini flash crashes in the three-minute window between market open and the Treasury Flash Crash was 2.6 times larger than the number experienced in any other three-minute window in the prior ten weekdays. We argue that (a this statistically significant finding suggests that mini flash crashes in equity markets both predicted and contributed to the October 2014 U.S. Treasury Bond Flash Crash, and (b mini-flash crashes are important phenomena with negative externalities that deserve much greater scholarly attention.

  19. The October 2014 United States Treasury bond flash crash and the contributory effect of mini flash crashes.

    Science.gov (United States)

    Levine, Zachary S; Hale, Scott A; Floridi, Luciano

    2017-01-01

    We investigate the causal uncertainty surrounding the flash crash in the U.S. Treasury bond market on October 15, 2014, and the unresolved concern that no clear link has been identified between the start of the flash crash at 9:33 and the opening of the U.S. equity market at 9:30. We consider the contributory effect of mini flash crashes in equity markets, and find that the number of equity mini flash crashes in the three-minute window between market open and the Treasury Flash Crash was 2.6 times larger than the number experienced in any other three-minute window in the prior ten weekdays. We argue that (a) this statistically significant finding suggests that mini flash crashes in equity markets both predicted and contributed to the October 2014 U.S. Treasury Bond Flash Crash, and (b) mini-flash crashes are important phenomena with negative externalities that deserve much greater scholarly attention.

  20. Effects of hormonehCG following injection of estnanate of reproductive performances ofswamp buffalo (Bubalus bubalis

    Directory of Open Access Journals (Sweden)

    Polmer Situmorang

    1998-12-01

    Full Text Available Low reproductive performance of buffalo resulted the population growth in Indonesia was only slightly increase during the last 50 year. Reproductive performance can be improved by hormone treatment during synchronization . One study was conducted in Porsea and Siborong-borong to see the effects of hormone hCG on the reproductive performances of swamp buffalo . A total of 34 buffaloes were kept in field grazing and commercial concentrate 4 kg/head/day was given for supplementation in 27 buffaloes and the rest 7 buffaloes treated as control with no supplemeniation . Synchronization performed by two intromuscular (IM injections of2 ml estrumate in 11 days interval . The buffaloes were divided into 2 groups of 16 buffaloes without hCG (Control group and 18 buffaloes with hCG (Treated group. Treated group wereinjected with 500 IU hCG intro-muscularly (IM 24-48 hours following second injection of estrumate . All buffaloes were artificially inseminated (AI 48 and 72 hours after the second injection of estrumate. Results showed that injection of estrurnate twice in 11 days interval was very effective to synchronize oestrus of buffaloes. The persentage of buffalo showing oestrus was 67 .5 and 85 .3% following 48 and 72 Ins of thesecond injection of estrumate resfectively . The effectiveness of estrumate was significantly affected by body condition of buffaloes where the persentage of oestrus 48 and 72 hours following estrumate injection was significantly higher (P<0.01 in buffaloes with good body condition than those in poor body condition (74.5 and 92.5% vs 42 .9 and 57 .1%. Injection ofhCG following estrumate increased the percentage of oestrus and pregnancy of buffalo. Percentages of oestrus of buffaloes 48 and 72 hours following estrumate injections was significantly higher (P<0 .01 in hCG treatment (83 .3 and 100% than those in control groups (68 .8 and 81 .3% . The pregnancy rate of buffalo with good body condition was significantly higher (P<0

  1. Amphiregulin mediates hCG-induced StAR expression and progesterone production in human granulosa cells

    OpenAIRE

    Fang, Lanlan; Yu, Yiping; Zhang, Ruizhe; He, Jingyan; Sun, Ying-Pu

    2016-01-01

    Progesterone plays critical roles in maintaining a successful pregnancy at the early embryonic stage. Human chorionic gonadotropin (hCG) rapidly induces amphiregulin (AREG) expression. However, it remains unknown whether AREG mediates hCG-induced progesterone production. Thus, the objective of this study was to investigate the role of AREG in hCG-induced progesterone production and the underlying molecular mechanism in human granulosa cells; primary cells were used as the experimental model. ...

  2. Education System Using Interactive 3D Computer Graphics (3D-CG) Animation and Scenario Language for Teaching Materials

    Science.gov (United States)

    Matsuda, Hiroshi; Shindo, Yoshiaki

    2006-01-01

    The 3D computer graphics (3D-CG) animation using a virtual actor's speaking is very effective as an educational medium. But it takes a long time to produce a 3D-CG animation. To reduce the cost of producing 3D-CG educational contents and improve the capability of the education system, we have developed a new education system using Virtual Actor.…

  3. WMO World Record Lightning Extremes: Longest Reported Flash Distance and Longest Reported Flash Duration.

    Science.gov (United States)

    Lang, Timothy J; Pédeboy, Stéphane; Rison, William; Cerveny, Randall S; Montanyà, Joan; Chauzy, Serge; MacGorman, Donald R; Holle, Ronald L; Ávila, Eldo E; Zhang, Yijun; Carbin, Gregory; Mansell, Edward R; Kuleshov, Yuriy; Peterson, Thomas C; Brunet, Manola; Driouech, Fatima; Krahenbuhl, Daniel S

    2017-06-01

    A World Meteorological Organization weather and climate extremes committee has judged that the world's longest reported distance for a single lightning flash occurred with a horizontal distance of 321 km (199.5 mi) over Oklahoma in 2007, while the world's longest reported duration for a single lightning flash is an event that lasted continuously for 7.74 seconds over southern France in 2012. In addition, the committee has unanimously recommended amendment of the AMS Glossary of Meteorology definition of lightning discharge as a "series of electrical processes taking place within 1 second" by removing the phrase "within one second" and replacing with "continuously." Validation of these new world extremes (a) demonstrates the recent and on-going dramatic augmentations and improvements to regional lightning detection and measurement networks, (b) provides reinforcement regarding the dangers of lightning, and (c) provides new information for lightning engineering concerns.

  4. Flash hydropyrolysis of bituminous coal . III. Research on flash hydropyrolysis tar

    Energy Technology Data Exchange (ETDEWEB)

    Dong, M.; Zhu, Z.; He, Y.; Ding, N.; Tang, L. [East China University of Science and Technology, Shanghai (China)

    2000-02-01

    Tar sample obtained by flash hydropyrolysis (FHP) from Dongshen coal at high pressure entrained reactor was investigated. An effect of flash hydropyrolysis temperature on the main components in tar was studied and the quality of the tar was compared with high temperature coke oven tar. The results showed that: the yields of liquid hydrocarbon in FHP tar were more than 15%, which is twofold of that in coke oven tar; the FHP tar has high oil fraction and low pitch; high phenol components and pure condensed polycyclic aromatic hydrocarbon, and low aliphatic hydrocarbon. The components of the FHP tar were simpler than that of high temperature coke oven tar. Therefore, FHP has improved the quantity and quality of tar. 11 refs., 3 figs., 5 tabs.

  5. Sphinx, the high speed flash radiography

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    Sphinx (Nanosecond Pulse X-Photon Source) is the most compact (0.1 m 3 ) existing system which can generates short pulses (10 to 30 nanoseconds) of 5 to 180 keV X-photon radiation with a repeating cadence of 100 pulses per second and doses which can reach 2 mR at 1 m. This system was developed by the Research Group on Energetics of Ionized Media (GREMI) from the CNRS (French National Center for Scientific Research) and the University of Orleans (France). Sphinx is the smallest device from a series of compact X-ray sources ranging from 5 to 400 keV. These devices can have several possible applications such as the study of ultra-fast phenomena, the high cadence flash radiography in medicine, biology, materials studies, pre-ionizing of gas lasers, self-excitation and photo-ionization of atoms, molecules or aggregates. (J.S.)

  6. Coherence properties of the radiation from FLASH

    International Nuclear Information System (INIS)

    Schneidmiller, E.A.; Yurkov, M.V.

    2015-02-01

    FLASH is the first free electron laser user facility operating in the vacuum ultraviolet and soft x-ray wavelength range. Many user experiments require knowledge of the spatial and temporal coherence properties of the radiation. In this paper we present an analysis of the coherence properties of the radiation for the fundamental and for the higher odd frequency harmonics. We show that temporal and spatial coherence reach maximum close to the FEL saturation but may degrade significantly in the post-saturation regime. We also find that the pointing stability of short FEL pulses is limited due to the fact that non-azimuthal FEL eigenmodes are not sufficiently suppressed. We discuss possible ways for improving the degree of transverse coherence and the pointing stability.

  7. Article coated with flash bonded superhydrophobic particles

    Science.gov (United States)

    Simpson, John T [Clinton, TN; Blue, Craig A [Knoxville, TN; Kiggans, Jr., James O [Oak Ridge, TN

    2010-07-13

    A method of making article having a superhydrophobic surface includes: providing a solid body defining at least one surface; applying to the surface a plurality of diatomaceous earth particles and/or particles characterized by particle sizes ranging from at least 100 nm to about 10 .mu.m, the particles being further characterized by a plurality of nanopores, wherein at least some of the nanopores provide flow through porosity, the particles being further characterized by a plurality of spaced apart nanostructured features that include a contiguous, protrusive material; flash bonding the particles to the surface so that the particles are adherently bonded to the surface; and applying a hydrophobic coating layer to the surface and the particles so that the hydrophobic coating layer conforms to the nanostructured features.

  8. Collimation techniques for dense object flash radiography

    International Nuclear Information System (INIS)

    Mueller, K.H.

    1984-08-01

    In explosively driven experiments, flash radiography can record a wealth of information about material densities and boundaries. Obtaining accurate quantitative data from these radiographs requires careful design of the experiment so that one can control and measure the scattered radiation background that is a part of any experiment. We have used collimators at the x-ray source to match the incident x-ray flux to the transmission of the object, thereby reducing the production of scattered radiation while still preserving a complete view of the object. Multi-hole collimators (at the film plane) with a length-to-diameter ratio of approx. 20:1 have been used to measure the scattered radiation field with several exposure geometries and with various shielding methods

  9. Flash photolysis-shock tube studies

    Energy Technology Data Exchange (ETDEWEB)

    Michael, J.V. [Argonne National Laboratory, IL (United States)

    1993-12-01

    Even though this project in the past has concentrated on the measurement of thermal bimolecular reactions of atomic species with stable molecules by the flash or laser photolysis-shock tube (FP- or LP-ST) method using atomic resonance absorption spectrometry (ARAS) as the diagnostic technique, during the past year the authors have concentrated on studies of the thermal decompositions of selected chlorocarbon molecules. These studies are necessary if the degradation of chlorine containing organic molecules by incineration are to be understood at the molecular level. Clearly, destruction of these molecules will not only involve abstraction reactions, when possible, but also thermal decomposition followed by secondary reactions of the initially formed atoms and radicals. Studies on the thermal decomposition of CH{sub 3}Cl are complete, and the curve-of-growth for Cl-atom atomic resonance absorption has been determined. The new thermal decomposition studies are similar to those already reported for CH{sub 3}Cl.

  10. Measurement of g Using a Flashing LED

    Science.gov (United States)

    Terzella, T.; Sundermier, J.; Sinacore, J.; Owen, C.; Takai, H.

    2008-10-01

    In one of the classic free-fall experiments, a small mass is attached to a strip of paper tape and both are allowed to fall through a spark timer, where sparks are generated at regular time intervals. Students analyze marks (dots) left on the tape by the timer, thereby generating distance-versus-time data, which they analyze to extract the acceleration due to gravity g with good results. The apparatus, however, is cumbersome and often frustrating for students. High-tech versions of this experiment are done with an object dropped and followed by a motion sensor connected to a computer. The sensor relies on ultrasonic ranging to record distance and time data, which may then be displayed graphically. Students inspect the graphs to determine the value of g. Although the results are excellent, the emphasis on the computer's ability to collect and analyze data leaves little analysis for the students to perform.2 Furthermore, neither technique gives an intuitive display of what is happening. The motivation for our work was to overcome these issues by developing an innovative method for measuring g. In our version of the experiment, students drop a flashing LED at a known frequency and record its trajectory using long exposure photography with a digital camera. Proper choice of flashing LED timing parameters produces an image that allows for an accurate measurement of g and at the same time helps to explain what happens during free fall. The experiment remains high-tech in the sense that students learn to use updated equipment to record data and to carry out the analysis.

  11. A new French flash flood warning service

    Directory of Open Access Journals (Sweden)

    de Saint-Aubin Céline

    2016-01-01

    Full Text Available The French State services in charge of flood forecasting supervise about 22,000 km among the 120,000 km of the French rivers within a warning procedure called Vigilance Crues (http://www.vigicrues.gouv.fr. Some recent dramatic flood events on small watershed not covered by Vigilance Crues highlight the need for a new warning procedure to anticipate violent flash floods that regularly affect rapid river-basins. Thus the concept emerged of an automatic warning service specifically dedicated to local crisis managers. This service will be less elaborated than Vigilance Crues, probably with false alarms and missed events sometimes, but it will deliver a first information. The generation of the warning is based on a simple rainfall-runoff hydrological model developed by Irstea on all French rivers, fed with radar-gauge rainfall grids provided by Meteo-France. Every fifteen minutes, the hydrological model estimates the discharges on the rivers eligible to the service and determine if certain thresholds corresponding to a high or very high flood are likely to be exceeded. The last step of the real-time system is to determine which municipalities are concerned with flood risk and send them an automatic warning by voice call, optionally by sms or email. A specific web interface is available for users to monitor the evolution of the flood risk on maps that are updated every 15 minutes. This new flash flood warning service will be operational early 2017 as a free service for about 8,000 French municipalities.

  12. Numerical analyses of flashing jet structure and droplet size characteristics

    International Nuclear Information System (INIS)

    Duan Riqiang; Jiang Shengyao; Koshizuka, Seiichi; Oka, Yoshiaki; Yamaguchi, Akira; Takata, Takashi

    2006-01-01

    In this paper, flashing jets are numerically simulated using the MPS method. The boiling mode for flashing is identified as surface boiling mode, based on the postulation of jets from a short nozzle under high depressurization. The Homogeneous Non-equilibrium Relaxation Model (HRM) is used for calculating the evaporation rate of flashing. The numerical simulation results show that flashing jets comprise an inner intact core which is surrounded by two-phase droplet flow. The effect of degree of superheat on the jet topological geometry is investigated. With increasing degree of superheat, the topological shape of flashing jets evolves from cylindrical core for low degree of superheat to cone-shaped core for high degree of superheat, and meanwhile the extinction length comes to decrease and tends asymptotically constant as the injection temperature approaches the saturation temperature corresponding to the injection pressure. The analyses of the droplet size distribution engendered from primary breakup of flashing jets show that: two peaks exist for droplet size distribution at lower degree of superheat; however, merely one peak for higher degree of superheat. From droplet size distribution, it is revealed that the primary breakup mechanism of flashing jets can be attributed to dominant mechanical breakup mode plus enhancement via surface evaporation. (author)

  13. Simulated CONUS Flash Flood Climatologies from Distributed Hydrologic Models

    Science.gov (United States)

    Flamig, Z.; Gourley, J. J.; Vergara, H. J.; Kirstetter, P. E.; Hong, Y.

    2016-12-01

    This study will describe a CONUS flash flood climatology created over the period from 2002 through 2011. The MRMS reanalysis precipitation dataset was used as forcing into the Ensemble Framework For Flash Flood Forecasting (EF5). This high resolution 1-sq km 5-minute dataset is ideal for simulating flash floods with a distributed hydrologic model. EF5 features multiple water balance components including SAC-SMA, CREST, and a hydrophobic model all coupled with kinematic wave routing. The EF5/SAC-SMA and EF5/CREST water balance schemes were used for the creation of dual flash flood climatologies based on the differing water balance principles. For the period from 2002 through 2011 the daily maximum streamflow, unit streamflow, and time of peak streamflow was stored along with the minimum soil moisture. These variables are used to describe the states of the soils right before a flash flood event and the peak streamflow that was simulated during the flash flood event. The results will be shown, compared and contrasted. The resulting model simulations will be verified on basins less than 1,000-sq km with USGS gauges to ensure the distributed hydrologic models are reliable. The results will also be compared spatially to Storm Data flash flood event observations to judge the degree of agreement between the simulated climatologies and observations.

  14. Frequency and seasonality of flash floods in Slovenia

    Directory of Open Access Journals (Sweden)

    Trobec Tajan

    2017-01-01

    Full Text Available The purpose of this paper is to assess and analyse the dynamics of flash flooding events in Slovenia. The paper examines in particular the frequency of flash floods and their seasonal distribution. The methodology is based on the analysis of historical records and modern flood data. The results of a long-term frequency analysis of 138 flash floods that occurred between 1550 and 2015 are presented. Because of the lack of adequate historical flood data prior to 1950 the main analysis is based on data for the periodbetween1951 and2015, while the analysis of data for the period between1550 and1950 is added as a supplement to the main analysis. Analysis of data for the period after 1950 shows that on average 1.3 flash floods occur each year in Slovenia. The linear trend for the number of flash floods is increasing but is not statistically significant. Despite the fact that the majority of Slovenian rivers have one of the peaks in spring and one of the lows in summer, 90% of flash floods actually occur during meteorological summer or autumn - i.e. between June and November, which shows that discharge regimes and flood regimes are not necessarily related. Because of the lack of flood records from the more distant past as well as the large variability of flash flood events in the last several decades, we cannot provide a definitive answer to the question about possible changes in their frequency and seasonality by relying solely on the detected trends. Nevertheless, considering the results of analysis and future climate change scenarios the frequency of flash floods in Slovenia could increase while the period of flash flood occurrence could be extended.

  15. Student production: making a realistic stereo CG short film in six months

    Science.gov (United States)

    Ramasamy, Celambarasan

    2010-02-01

    This paper breaks down the R&D and production challenges faced on a stereoscopic CG short film that was developed on a six month time budget. Using this film as an example, the manner in which technical innovation and story telling techniques can be used to emphasize the strengths and hide the weaknesses of a limited timeframe student production is discussed.

  16. First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign

    Science.gov (United States)

    van Westrum, D.; Kanney, J.

    2017-12-01

    First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign AGU Fall Meeting 2017 Derek van Westrum and Jeff Kanney NOAA's National Geodetic Survey conducted its third and final Geoid Slope Validation Survey (GSVS) this past summer in the rugged mountains of southern Colorado. In addition to leveling, long period GPS, and defelction of vertical observations, absolute gravity and vertical gravity gradients were measured at 235 bench marks (approximately 1.5 km spacing) along US-160 between Durango and Walsenburg, Colorado. In previous surveys (Texas-2011 and Iowa-2014), an A10 absolute gravimeter was used to measure graivty at approximately 10-15% of the bench marks. The remaining marks were determined by using LaCoste & Romberg relative gravimeters. The same relative instruments were also used to measure two-tier (linear) vertical gravity gradients at the A10 sites. In the current work - becuase of the rapidly changing terrain in the Rocky Mountains - it was decided to employ the A10 at all 235 bench marks, and acquire three-tier (quadratic) gradients at every bench mark using the new Scintrex CG-6 Autograv relative gravimeter. Using these results, we will provide a real worldsummary of the CG-6's behavior by examining noise levels, repeatability, and acquisition rates. In addition, the coincident A10 absolute data set allows us to evaluate the CG-6's accuracy, and allows us to simulate and discuss various relative gravity survey designs.

  17. Empty follicle syndrome after GnRHa triggering versus hCG triggering in COS

    DEFF Research Database (Denmark)

    Castillo, Juan C; Garcia-Velasco, Juan; Humaidan, Peter

    2012-01-01

    This study aimed to explore the incidence of empty follicle syndrome (EFS) in oocyte donors who had final oocyte maturation triggered with GnRHa and to compare the incidence of EFS in this group of patients with IVF patients who had final oocyte maturation with hCG....

  18. Targeted therapy of renal cell carcinoma: synergistic activity of cG250-TNF and IFNg.

    NARCIS (Netherlands)

    Bauer, S.; Oosterwijk-Wakka, J.C.; Adrian, N.; Oosterwijk, E.; Fischer, E.; Wuest, T.; Stenner, F.; Perani, A.; Cohen, L.; Knuth, A.; Divgi, C.; Jager, D.; Scott, A.M.; Ritter, G.; Old, L.J.; Renner, C.

    2009-01-01

    Immunotherapeutic targeting of G250/Carbonic anhydrase IX (CA-IX) represents a promising strategy for treatment of renal cell carcinoma (RCC). The well characterized human-mouse chimeric G250 (cG250) antibody has been shown in human studies to specifically enrich in CA-IX positive tumors and was

  19. Pre-evacuation hCG glycoforms in uneventful complete hydatidiform mole and persistent trophoblastic disease.

    NARCIS (Netherlands)

    Thomas, C.M.G.; Kerkmeijer, L.G.W.; Ariaens, H.J.; Steen, R. van der; Massuger, L.F.A.G.; Sweep, F.C.

    2010-01-01

    OBJECTIVE: To investigate whether the glycoform distribution patterns of human chorionic gonadotropin (hCG) obtained by chromatofocusing in pre-evacuation serum are different for patients who will eventually develop into persistent trophoblastic disease in case of complete hydatidiform mole

  20. Negative βhCG and Molar Pregnancy: The Hook Effect

    Directory of Open Access Journals (Sweden)

    Isabel Lobo Antunes

    2017-09-01

    Full Text Available Molar pregnancy, included in gestational trophoblastic disease, is a benign pathology with ability to metastasize, usually occurring with excessively high βhCG levels. Clinical scenario is usually a woman in extremes of reproductive age presenting with amenorrhoea, pain and vaginal blood loss; signs derived from high βhCG levels may be present (hyperthyroidism, hyperemesis. Diagnosis is based on a positive pregnancy test – usually a qualitative urinary test. The limitation of this test results from its inability to become positive in presence of markedly high levels of βhCG, saturating the antigens used – known as the ‘hook effect’. With the widespread use of gynaecological ultrasound cases of molar pregnancy have been diagnosed in timely fashion. We describe a case referred as a degenerating fibroid, with a negative urinary pregnancy test. Transvaginal ultrasound was highly suggestive of molar pregnancy, which was confirmed with a quantitative βhCG test, allowing for timely treatment. The importance of a high index of suspicion for this pathology is tremendous to avoid the devastating consequences of a delayed diagnosis.

  1. Prediction of late failure after medical abortion from serial beta-hCG measurements and ultrasonography

    DEFF Research Database (Denmark)

    Rørbye, C; Nørgaard, M; Nilas, Lisbeth

    2004-01-01

    BACKGROUND: Surgical treatment of failed medical abortion may be performed several weeks after initiation of the abortion. There are no recognized methods for early identification of these late failures. We assessed the prognostic values of beta-hCG and ultrasonography in predicting late failure ...

  2. Methotrexate treatment in progressive tubal ectopic pregnancies and hCG-related clinicosurgical implications

    Directory of Open Access Journals (Sweden)

    Askin Dogan

    2016-06-01

    Full Text Available Our aim was to evaluate the relationship between the success of methotrexate treatment and β-hCG levels in progressive tubal ectopic pregnancies. We defined a retrospective cohort of 394 progressive tubal ectopic pregnancy patients treated with methotrexate. A single-dose methotrexate protocol using 50 mg/m2 was administered to patients with progressive tubal ectopic pregnancy. Surgery was performed in patients who exhibited signs of acute abdomen due to tubal rupture. Of 394 patients that received methotrexate treatment, 335 (84.6% responded to medical treatment, while the remaining 59 (15.36% underwent surgery due to treatment failure. β-hCG levels in the failure group were significantly higher as compared with the success group at Day 1, Day 4, and Day 7 (2116±3157 vs. 4178±3422, 2062±3551 vs. 4935±4103, and 1532±3007 vs. 3900±4783, respectively. The receiver operating characteristics curve for β-hCG levels at Day 1 was 0.738, with a cutoff value of 1418 mIU/mL, while sensitivity and specificity values reached the optimum for treatment success (83.1% and 59.4%, respectively. Medical treatment with methotrexate achieved an 85.02% success rate for the treatment of progressive tubal ectopic pregnancy, while success rates for medical treatment decreased significantly when initial β-hCG levels were >1418 mIU/mL.

  3. Vaginal Fluid hCG Levels for Detecting Premature Rupture of Membranes

    Directory of Open Access Journals (Sweden)

    T. Artimani

    2004-04-01

    Full Text Available The aim of this study was to determine whether there is any different in hCG levels of vaginal fluids from normal pregnant women, women with confirmed PROM and with suspected PROM. After irrigating the posterior vaginal fornix with 3 ml of sterile saline and procuring vaginal washing , we measured hCG levels. Samples were analyzed from 38 normal pregnant women , 31 women with confirmed PROM , 28 women with suspected PROM. The mean of vaginal fluid hCG levels of normal pregnant women were 11.2 (0.00-98.6 mIu/ml. That of women with PROM was 140.2 (0.5 , 390.1 and that of women with suspected PROM was 21.5 (0.0 , 143.9. Sensivity was 80%, specility 83% , positive predictive value 73.7% , negative predictive value 88.1% , using a cut-value 20. It was concluded that the hCG level in vaginal fluid is a marker of PROM during third trimester.

  4. Data of evolutionary structure change: 1CG8B-1OUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available DHKQI >HHHH -- HHHH> ATOM 1228 C...ryIDChain>1OUTA FWGKISGKADVV ucture>HHHHHGGGHHHH...1CG8B GKHQE-IGVDT >HHHHH- G... >HHHH > ATOM 631 CA ASP A 86 48...ure>G - re> ATOM 329 CA PHE A 43 34.744

  5. Bridging CAGD knowledge into CAD/CG applications: Mathematical theories as stepping stones of innovations

    Science.gov (United States)

    Gobithaasan, R. U.; Miura, Kenjiro T.; Hassan, Mohamad Nor

    2014-07-01

    Computer Aided Geometric Design (CAGD) which surpasses the underlying theories of Computer Aided Design (CAD) and Computer Graphics (CG) has been taught in a number of Malaysian universities under the umbrella of Mathematical Sciences' faculty/department. On the other hand, CAD/CG is taught either under the Engineering or Computer Science Faculty. Even though CAGD researchers/educators/students (denoted as contributors) have been enriching this field of study by means of article/journal publication, many fail to convert the idea into constructive innovation due to the gap that occurs between CAGD contributors and practitioners (engineers/product/designers/architects/artists). This paper addresses this issue by advocating a number of technologies that can be used to transform CAGD contributors into innovators where immediate impact in terms of practical application can be experienced by the CAD/CG practitioners. The underlying principle of solving this issue is twofold. First would be to expose the CAGD contributors on ways to turn mathematical ideas into plug-ins and second is to impart relevant CAGD theories to CAD/CG to practitioners. Both cases are discussed in detail and the final section shows examples to illustrate the importance of turning mathematical knowledge into innovations.

  6. "hCG priming" effect in controlled ovarian stimulation through a long protocol

    Directory of Open Access Journals (Sweden)

    Antsaklis Aris

    2009-08-01

    Full Text Available Abstract Background Recently, it has been demonstrated that, in patients down-regulated by GnRH analogues (GnRHa, a short-term pre-treatment with recombinant LH (rLH, prior to recombinant FSH (rFSH administration, increases the number of small antral follicle prior to FSH stimulation and the yield of normally fertilized embryos. However, no data exist in the literature regarding the potential beneficial effect of "hCG priming" in controlled ovarian hyperstimulation (COH through a long GnRH-a protocol, which binds the same receptor (LH/hCGR, though it is a much more potent compared to LH. The primary aims of this study were to assess the effect of short-term pre-rFSH administration of hCG in women entering an ICSI treatment cycle on follicular development, quality of oocytes and early embryo development. The secondary endpoints were to record the effects on endometrial quality and pregnancy rate. Methods Patients with a history of at least one previous unsuccessful ICSI cycle were randomly assigned into two groups to receive treatment with either a long protocol with rFSH (control group or a long protocol with rFSH and pre-treatment with hCG (hCG group. In particular, in the latter group, a fixed 7 days course of 200 IU/day hCG was administered as soon as pituitary desensitization was confirmed. Results The mean number of oocytes retrieved was not significantly different between the two treatment groups, although the percentage of mature oocytes tended to be higher but not significantly different in hCG-treated patients. The percentage of patients with more than one grade 3 embryos was higher in the pre-treatment group, which also showed a higher pregnancy rate. Conclusion All the above clinical observations, in conjunction with previous data, suggest a point towards a beneficial "hCG priming" effect in controlled ovarian hyperstimulation through a long GnRH-a down-regulation protocol, particularly in patients with previous ART failures.

  7. Characteristics of Laser Flash Technique for Thermal Diffusivity Measurement

    Energy Technology Data Exchange (ETDEWEB)

    Park, D. G.; Kim, H. M.; Hong, G. P

    2008-08-15

    In relation to selection of thermal conductivity measurement technology, various thermal conductivity measurement technique are investigated for characteristics of each technique and it's measurable range. For the related laser flash techniques, various technical characteristics are reviewed and discussed. Especially, Parker adiabatic model are reviewed because of importance for basic theory of the thermal diffusivity determination. Finite pulse time effect, heat loss effect and non-uniform heating effect, which are main technical factors for laser flash technique, are considered. Finally, characteristics of constituent elements for laser flash measurement system are reviewed and investigated in detail.

  8. Gamma ray flashes add to mystery of upper atmosphere

    Science.gov (United States)

    Atmospheric electricity research has come a long way since Benjamin Franklin's kite-flying days. But what researchers have been learning lately about above-thunderstorm electricity has wrought a whole new era of mysteries.For a start, last summer a Colorado meteorologist sparked interest in a terrestrial phenomenon that the community first observed more than 100 years ago: optical flashes that occur above thunderstorms—at least 30 km above Earth. Walter Lyons with the Ft. Collins-based Mission Research Corporation, demonstrated that such flashes are not anomalies, as conventional scientific wisdom had held. He filmed hundreds of flashes during a 2-week period.

  9. Freeware eLearning Flash-ECG for learning electrocardiography.

    Science.gov (United States)

    Romanov, Kalle; Kuusi, Timo

    2009-06-01

    Electrocardiographic (ECG) analysis can be taught in eLearning programmes with suitable software that permits the effective use of basic tools such as a ruler and a magnifier, required for measurements. The Flash-ECG (Research & Development Unit for Medical Education, University of Helsinki, Finland) was developed to enable teachers and students to use scanned and archived ECGs on computer screens and classroom projectors. The software requires only a standard web browser with a Flash plug-in and can be integrated with learning environments (Blackboard/WebCT, Moodle). The Flash-ECG is freeware and is available to medical teachers worldwide.

  10. Cardiac and vascular imaging with snapshot FLASH MR imaging

    International Nuclear Information System (INIS)

    Matthaei, D.; Haase, A.; Norris, D.; Leibfritz, D.; Henrich, D.; Duhmke, E.

    1989-01-01

    Acceleration of fast low-angle-shot (FLASH) MR imaging to about 200 msec measuring time on dedicated MR systems is called snapshot FLASH MR imaging. It snaps real-time series of MR images of the MR relaxation and of physiologic motions with nearly absent motion and susceptibility artifacts. Results in animals (4.7T) and human volunteers (2.0T) show plain vascular and cardiac snapshot FLASH MR images obtained as single shot, triggered reconstructed motion, or real-time films. The reduction of artifacts and the high resolution (triggered, three-dimensional moving heart images are possible) result in favorable applications in myocardial and great vascular disease

  11. Space-time analysis of the Seismic Waves propagation and World Wide Lightning Location Network data association with the Terrestrial Gamma-ray Flashes detected by the Fermi Gamma-ray Burst Monitor

    International Nuclear Information System (INIS)

    Sorokin, L.

    2017-01-01

    The natural high intensity sub-millisecond electromagnetic pulses associated with seismic waves from earthquakes can trigger +CG, -CG and IC lightning discharges, transient luminous events (TLEs) and non luminous events as TGFS. The lightning discharges with higher peak currents are more probable during the moments when seismic waves from earthquakes pass through a place of lightning. Huge charge transfer of triggered +CG, -CG and IC lightning discharges can radiate powerful electromagnetic emission. Space-time analysis of the seismic wave’s propagation and WWLLN data was done together with the second Fermi GBM Terrestrial Gamma-ray Flashes (TGF) Catalog. A total number of 1203 events from the WWLLN associations table were associated with the entrance the exact seismic waves from earthquakes in the place of lightning. Only 11 events from 1214 associations were rejected. After that the full list of 1049 TGFs has been checked out. As the result the 1038 TGFS has been associated with earthquakes. Among them 42 events with time difference exceeding ±100 sec were found. As the result 996 events get inside the time interval for the space-time analysis ±100 sec, they correspond to 95% from the total number of 1049 TGFS. The probability density function for the Time difference data was calculated and more preferably can be explained by the probability density functions of Cauchy distribution. The Phases of Seismic Waves and earthquakes magnitude associated with selected 996 TGFS from WWLLN associations table were studied. (author)

  12. Development of SCINFUL-CG code to calculate response functions of scintillators in various shapes used for neutron measurement

    Energy Technology Data Exchange (ETDEWEB)

    Endo, Akira; Kim, Eunjoo; Yamaguchi, Yasuhiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2001-10-01

    A Monte Carlo code SCINFUL has been utilized for calculating response functions of organic scintillators for high-energy neutron spectroscopy. However, the applicability of SCINFUL is limited to the calculations for cylindrical NE213 and NE110 scintillators. In the present study, SCINFUL-CG was developed by introducing a geometry specifying function and high-energy neutron cross section data into SCINFUL. The geometry package MARS-CG, the extended version of the CG (Combinatorial Geometry), was programmed into SCINFUL-CG to express various geometries of detectors. Neutron spectra in the regions specified by the CG can be evaluated by the track length estimator. The cross section data of silicon, oxygen and aluminum for neutron transport calculation were incorporated up to 100 MeV using the data of LA150 library. Validity of SCINFUL-CG was examined by comparing calculated results with those by SCINFUL and MCNP and experimental data measured using high-energy neutron fields. SCINFUL-CG can be used for the calculations of the response functions and neutron spectra in the organic scintillators in various shapes. The computer code will be applicable to the designs of high-energy neutron spectrometers and neutron monitors using the organic scintillators. The present report describes the new features of SCINFUL-CG and explains how to use the code. (author)

  13. CG13250, a novel bromodomain inhibitor, suppresses proliferation of multiple myeloma cells in an orthotopic mouse model

    International Nuclear Information System (INIS)

    Imayoshi, Natsuki; Yoshioka, Makoto; Chauhan, Jay; Nakata, Susumu; Toda, Yuki; Fletcher, Steven; Strovel, Jeffrey W.; Takata, Kazuyuki; Ashihara, Eishi

    2017-01-01

    Multiple myeloma (MM) is characterized by the clonal proliferation of neoplastic plasma cells. Despite a stream of new molecular targets based on better understanding of the disease, MM remains incurable. Epigenomic abnormalities contribute to the pathogenesis of MM. bromodomain 4 (BRD4), a member of the bromodomain and extraterminal (BET) family, binds to acetylated histones during M/G1 transition in the cell cycle promoting progression to S phase. In this study, we investigated the effects of a novel BET inhibitor CG13250 on MM cells. CG13250 inhibited ligand binding to BRD4 in a dose-dependent manner and with an IC 50 value of 1.1 μM. It inhibited MM proliferation in a dose-dependent manner and arrested cells in G1, resulting in the induction of apoptosis through caspase activation. CG13250 inhibited the binding of BRD4 to c-MYC promoter regions suppressing the transcription of the c-MYC gene. Administered in vivo, CG13250 significantly prolonged survival of an orthotopic MM-bearing mice. In conclusion, CG13250 is a novel bromodomain inhibitor that is a promising molecular targeting agent against MM. - Highlights: • A novel bromodomain inhibitor CG13250 suppresses MM cell proliferation. • CG13250 decreases C-MYC expression, resulting in the induction of apoptosis. • CG13250 prolongs the survivals of MM-bearing mice.

  14. cgHeliParm : analysis of dsDNA helical parameters for coarse-grained MARTINI molecular dynamics simulations

    NARCIS (Netherlands)

    Faustino, Ignacio; Marrink, S. J.

    2017-01-01

    Summary: We introduce cgHeliParm, a python program that provides the conformational analysis of Martini-based coarse-grained double strand DNA molecules. The software calculates the helical parameters such as base, base pair and base pair step parameters. cgHeliParm can be used for the analysis of

  15. Photosynthetic efficiency of Chlamydomonas reinhardtii in flashing light

    NARCIS (Netherlands)

    Vejrazka, C.; Janssen, M.G.J.; Streefland, M.; Wijffels, R.H.

    2011-01-01

    Efficient light to biomass conversion in photobioreactors is crucial for economically feasible microalgae production processes. It has been suggested that photosynthesis is enhanced in short light path photobioreactors by mixing-induced flashing light regimes. In this study, photosynthetic

  16. Interim report on flash floods, Area 5 - Nevada Test Site

    International Nuclear Information System (INIS)

    French, R.H.

    1980-09-01

    Examination of the presently available data indicates that consideration must be given to the possibility of flash floods when siting waste management facilities in Area 5 of the Nevada Test Site. 6 figures, 7 tables

  17. The Essential Guide to 3D in Flash

    CERN Document Server

    Olsson, Ronald A

    2010-01-01

    If you are an ActionScript developer or designer and you would like to work with 3D in Flash, this book is for you. You will learn the core Flash 3D concepts, using the open source Away3D engine as a primary tool. Once you have mastered these skills, you will be able to realize the possibilities that the available Flash 3D engines, languages, and technologies have to offer you with Flash and 3D.* Describes 3D concepts in theory and their implementation using Away3D* Dives right in to show readers how to quickly create an interactive, animated 3D scene, and builds on that experience throughout

  18. The design of the light-flash warning light

    Science.gov (United States)

    Wang, Junli

    2018-05-01

    In today's society, the warning light has been used widely in people's daily life and various industries and agricultures. It is important to protect people's life and security. Light-flashing warning light is a kind of warning light control equipment which can control warning light automatically open and work in the state of blinking after dark, and it can automatically shut down after the dawn. It can achieve the flashing light automatic control and dual function. At present, light-flashing warning lights are mainly used in the projects of municipal construction. It is helpful to warn people and vehicles that passed in the construction site and ensure personal safety through using light-flashing warning light. Its design is simple, its performance is stable and it is also very convince to use it.

  19. FORGING DEFECTS ANALYSIS IN SUSPENSION ARMAND FLASH CONTROL

    OpenAIRE

    Mr Jadhav Vijay B. , Prof. Mundhe V.L. , Dr. Narve N.G.

    2018-01-01

    The suspension arms in the process of fogging are made by different material and in that processes get various problems are found. In that paper list out that problem and solving flash wastage problem.

  20. Hot Flashes and Quality of Life among Breast Cancer Patients

    National Research Council Canada - National Science Library

    Jacobs, Linda A

    2005-01-01

    This ongoing longitudinal study examines hot flashes and Quality of Life (QoL) in breast cancer (BC) patients undergoing initial treatment, and develops a taxonomy of the medical and Complementary and Alternative Medicine...

  1. Dynamic simulation of flash drums using rigorous physical property calculations

    Directory of Open Access Journals (Sweden)

    F. M. Gonçalves

    2007-06-01

    Full Text Available The dynamics of flash drums is simulated using a formulation adequate for phase modeling with equations of state (EOS. The energy and mass balances are written as differential equations for the internal energy and the number of moles of each species. The algebraic equations of the model, solved at each time step, are those of a flash with specified internal energy, volume and mole numbers (UVN flash. A new aspect of our dynamic simulations is the use of direct iterations in phase volumes (instead of pressure for solving the algebraic equations. It was also found that an iterative procedure previously suggested in the literature for UVN flashes becomes unreliable close to phase boundaries and a new alternative is proposed. Another unusual aspect of this work is that the model expressions, including the physical properties and their analytical derivatives, were quickly implemented using computer algebra.

  2. Some design aspects of multistage flash distillation process

    International Nuclear Information System (INIS)

    Ahmad, Mohammad.

    1975-01-01

    The purpose of this paper is to examine the effect of the design variables of multistage flash (MSF) process on the performance and/or the cost of the desalting plant, and to establish certain design trends

  3. Flash-flood potential assessment and mapping by integrating the ...

    Indian Academy of Sciences (India)

    Romulus Costache

    2017-06-16

    Jun 16, 2017 ... torrential phenomena considered for the study (training area) and for the results' testing (validating ... Service (USA). At that ... to improve the quality of flash-flood forecasts. ...... offers the possibility to obtain more credible and.

  4. Flash 3D Rendezvous and Docking Sensor, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — 3D Flash Ladar is a breakthrough technology for many emerging and existing 3D vision areas, and sensor improvements will have an impact on nearly all these fields....

  5. Portable flash X-ray systems: applications and techniques

    International Nuclear Information System (INIS)

    Bryant, L.E.

    1976-01-01

    Three portable flash x-ray equipments are described, and applications such as jet and high explosive studies, bullet impact and lead casting experiments are given as well as techniques for triggering and protection of equipment and film

  6. Space Qualified, Radiation Hardened, Dense Monolithic Flash Memory, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Space Micro proposes to build a radiation hardened by design (RHBD) flash memory, using a modified version of our RH-eDRAM Memory Controller to solve all the single...

  7. Flash x-radiography for material motion detection

    International Nuclear Information System (INIS)

    Choate, L.M.; Buckalew, W.H.; Posey, L.D.

    1977-01-01

    A significant part of the experimental program dealing with the behavior of prototypic LMFBR fuel pin bundles under mild to severe power transients is that of the observation of fuel/cladding/coolant motion. The feasibility of using electron beam flash x-radiography as a diagnostic tool for safety test facilities is presently under evaluation. A summary of the objectives and approach of the flash x-radiography program is presented

  8. New principle of feeding for flash evaporation MOCVD devices

    International Nuclear Information System (INIS)

    Kaul, A.R.; Seleznev, B.V.

    1993-01-01

    A novel scheme of flash evaporation feeding for MOCVD processes of multi-component oxide films deposition is proposed. The scheme comprises 1) microdozage of organic solution of solid volatile precursors on the glass fiber belt, 2) evaporation of the solvent and 3) flash evaporation of MOC microdoses from the belt. The functioning of the designed feeder is described and the features of proposed scheme in comparison to existing feeding principles are discussed. (orig.)

  9. Looking for the best flash floods indicators in Mediterranean Region

    Science.gov (United States)

    Llasat, Maria-Carmen; Llasat-Botija, Montserrat; Turco, Marco

    2010-05-01

    Flash floods are a recurrent hazard in Mediterranean Region. From a global point of view, a distinction between two kinds of floods can be made (Llasat, 2009): a) Short-lived and strongly convective events (cases recorded between 2005 and 2006. This sample has been increased with some selected cases of the European project HYDRATE. Information from all the flash-floods recorded in Catalonia (Spain) since 1982, completed with data about population density and so on, has also been considered.

  10. The Role of Serotonin in Hot Flashes after Breast Cancer

    Science.gov (United States)

    2009-03-01

    physiological mechanisms involved in hot flashes c.fter breast cancer will enable us to develop more targeted behavioral and/or pharmacological therapi ...s to be used in lieu of, or in addition to, currently available therapies so that we can eradicate hot flashes and improve the quality of life for...flavorings were most palatable - chocolate mint and orange. We rejected a lemon flavoring as being unpalatable. We eliminated the mid-day snack per

  11. Tutorial Pengenalan Adobe Photoshop Menggunakan Adobe Flash CS3

    OpenAIRE

    Mayoka, Rio

    2011-01-01

    Kajian ini bertujuan untuk membangun sebuah aplikasi yang dapat menjadi alat bantu dalam pembelajaran Adobe Photoshop, dimana terdapat beberapa materi pengenalan dasar Adobe Photoshop. Aplikasi ini suatu gagasan dengan membuat tutorial beranimasi yang interatif. Aplikasi ini dibuat dengan menggunakan Adobe Flash CS3 dan dapat dijalankan dengan Flash player. Aplikasi ini dapat membantu para penggunanya dalam memahami pengenalan Adobe Photoshop, terutama pengenalan tool pada Adob...

  12. Theoretical Characterizaiton of Visual Signatures (Muzzle Flash)

    Science.gov (United States)

    Kashinski, D. O.; Scales, A. N.; Vanderley, D. L.; Chase, G. M.; di Nallo, O. E.; Byrd, E. F. C.

    2014-05-01

    We are investigating the accuracy of theoretical models used to predict the visible, ultraviolet and infrared spectra of product materials ejected from the muzzle of currently fielded systems. Recent advances in solid propellants has made the management of muzzle signature (flash) a principle issue in weapons development across the calibers. A priori prediction of the electromagnetic spectra of formulations will allow researchers to tailor blends that yield desired signatures and determine spectrographic detection ranges. We are currently employing quantum chemistry methods at various levels of sophistication to optimize molecular geometries, compute vibrational frequencies, and determine the optical spectra of specific gas-phase molecules and radicals of interest. Electronic excitations are being computed using Time Dependent Density Functional Theory (TD-DFT). A comparison of computational results to experimental values found in the literature is used to assess the affect of basis set and functional choice on calculation accuracy. The current status of this work will be presented at the conference. Work supported by the ARL, and USMA.

  13. Flash pyrolysis fuel oil: bio-pok

    Energy Technology Data Exchange (ETDEWEB)

    Gust, S [Neste Oy, Porvoo (Finland)

    1997-12-01

    Samples of flash pyrolysis liquid produced by Union Fenosa, Spain from pine and straw and samples produced by Ensyn of Canada from mixed hardwoods were combusted with simple pressure atomization equipment commonly used with light fuel oils in intermediate size (0.1-1 MW) boilers. With a number of modifications to the combustion system, carbon monoxide (CO) and nitrous oxide (NO{sub x}) could be reduced to acceptable levels: CO < 30 ppm and NO{sub x} < 140 ppm. Particulate emissions which were initially very high (Bacharach 4-5) were reduced (Bach. 2-3) by system improvements but are still higher than from light fuel oil (Bach. <1). The modifications to the combustion system were: refractory section between burner and boiler, acid resistant progressive cavity pump, higher liquid preheat temperature and higher pressure than for light fuel oils. The main problems with pyrolysis liquids concerns their instability or reactivity. At temperatures above 100 deg C they begin to coke, their viscosity increases during storage and oxygen from air causes skin formation. This requires that special handling procedures are developed for fuel storage, delivery and combustion systems. (orig.)

  14. Variation, Evolution, and Correlation Analysis of C+G Content and Genome or Chromosome Size in Different Kingdoms and Phyla

    Science.gov (United States)

    Li, Xiu-Qing; Du, Donglei

    2014-01-01

    C+G content (GC content or G+C content) is known to be correlated with genome/chromosome size in bacteria but the relationship for other kingdoms remains unclear. This study analyzed genome size, chromosome size, and base composition in most of the available sequenced genomes in various kingdoms. Genome size tends to increase during evolution in plants and animals, and the same is likely true for bacteria. The genomic C+G contents were found to vary greatly in microorganisms but were quite similar within each animal or plant subkingdom. In animals and plants, the C+G contents are ranked as follows: monocot plants>mammals>non-mammalian animals>dicot plants. The variation in C+G content between chromosomes within species is greater in animals than in plants. The correlation between average chromosome C+G content and chromosome length was found to be positive in Proteobacteria, Actinobacteria (but not in other analyzed bacterial phyla), Ascomycota fungi, and likely also in some plants; negative in some animals, insignificant in two protist phyla, and likely very weak in Archaea. Clearly, correlations between C+G content and chromosome size can be positive, negative, or not significant depending on the kingdoms/groups or species. Different phyla or species exhibit different patterns of correlation between chromosome-size and C+G content. Most chromosomes within a species have a similar pattern of variation in C+G content but outliers are common. The data presented in this study suggest that the C+G content is under genetic control by both trans- and cis- factors and that the correlation between C+G content and chromosome length can be positive, negative, or not significant in different phyla. PMID:24551092

  15. Novel histone deacetylase inhibitor CG200745 induces clonogenic cell death by modulating acetylation of p53 in cancer cells.

    Science.gov (United States)

    Oh, Eun-Taex; Park, Moon-Taek; Choi, Bo-Hwa; Ro, Seonggu; Choi, Eun-Kyung; Jeong, Seong-Yun; Park, Heon Joo

    2012-04-01

    Histone deacetylase (HDAC) plays an important role in cancer onset and progression. Therefore, inhibition of HDAC offers potential as an effective cancer treatment regimen. CG200745, (E)-N(1)-(3-(dimethylamino)propyl)-N(8)-hydroxy-2-((naphthalene-1-loxy)methyl)oct-2-enediamide, is a novel HDAC inhibitor presently undergoing a phase I clinical trial. Enhancement of p53 acetylation by HDAC inhibitors induces cell cycle arrest, differentiation, and apoptosis in cancer cells. The purpose of the present study was to investigate the role of p53 acetylation in the cancer cell death caused by CG200745. CG200745-induced clonogenic cell death was 2-fold greater in RKO cells expressing wild-type p53 than in p53-deficient RC10.1 cells. CG200745 treatment was also cytotoxic to PC-3 human prostate cancer cells, which express wild-type p53. CG200745 increased acetylation of p53 lysine residues K320, K373, and K382. CG200745 induced the accumulation of p53, promoted p53-dependent transactivation, and enhanced the expression of MDM2 and p21(Waf1/Cip1) proteins, which are encoded by p53 target genes. An examination of CG200745 effects on p53 acetylation using cells transfected with various p53 mutants showed that cells expressing p53 K382R mutants were significantly resistant to CG200745-induced clonogenic cell death compared with wild-type p53 cells. Moreover, p53 transactivation in response to CG200745 was suppressed in all cells carrying mutant forms of p53, especially K382R. Taken together, these results suggest that acetylation of p53 at K382 plays an important role in CG200745-induced p53 transactivation and clonogenic cell death.

  16. Production of bio-oil with flash pyrolysis; Biooeljyn tuotanto flash-pyrolyysillae ja sen poltto

    Energy Technology Data Exchange (ETDEWEB)

    Nyroenen, T [Vapo Oy, Jyvaeskylae (Finland)

    1997-12-01

    The target of the R and D work is to study the production of bio-oils using Flash-pyrolysis technology and utilisation of the bio-oil in oil-fuelled boilers. The PDU-unit was installed at VTT Energy in Otaniemi in April 1996. The first test were carried out in June. In the whole project Vapo Oy is responsible for: acquiring the 20 kg/h PDU-device for development; follow up of the engine tests; the investment of 5 MW demonstration plant; to carry on the boiler and engine tests with Finnish bio-oils. (orig.)

  17. Spectral measurements of muzzle flash with multispectral and hyperspectral sensor

    Science.gov (United States)

    Kastek, M.; Dulski, R.; Trzaskawka, P.; Piątkowski, T.; Polakowski, H.

    2011-08-01

    The paper presents some practical aspects of the measurements of muzzle flash signatures. Selected signatures of sniper shot in typical scenarios has been presented. Signatures registered during all phases of muzzle flash were analyzed. High precision laboratory measurements were made in a special ballistic laboratory and as a result several flash patterns were registered. The field measurements of a muzzle flash were also performed. During the tests several infrared cameras were used, including the measurement class devices with high accuracy and frame rates. The registrations were made in NWIR, SWIR and LWIR spectral bands simultaneously. An ultra fast visual camera was also used for visible spectra registration. Some typical infrared shot signatures were presented. Beside the cameras, the LWIR imaging spectroradiometer HyperCam was also used during the laboratory experiments and the field tests. The signatures collected by the HyperCam device were useful for the determination of spectral characteristics of the muzzle flash, whereas the analysis of thermal images registered during the tests provided the data on temperature distribution in the flash area. As a result of the measurement session the signatures of several types handguns, machine guns and sniper rifles were obtained which will be used in the development of passive infrared systems for sniper detection.

  18. KENO-IV/CG, the combinatorial geometry version of the KENO Monte Carlo criticality safety program

    International Nuclear Information System (INIS)

    West, J.T.; Petrie, L.M.; Fraley, S.K.

    1979-09-01

    KENO-IV/CG was developed to merge the simple geometry input description utilized by combinatorial geometry with the repeating lattice feature of the original KENO geometry package. The result is a criticality code with the ability to model a complex system of repeating rectangular lattices inside a complicated three-dimensional geometry system. Furthermore, combinatorial geometry was modified to differentiate between combinatorial zones describing a particular KENO BOX to be repeated in a KENO array and those combinatorial zones describing geometry external to an array. This allows the user to maintain a simple coordinate system without any geometric conflict due to spatial overlap. Several difficult criticality design problems have been solved with the new geometry package in KENO-IV/CG, thus illustrating the power of the code to model difficult geometries with a minimum of effort

  19. Cannonball lung metastases as a presenting feature of ectopic hCG expression

    Directory of Open Access Journals (Sweden)

    Rong-Hsin Yang

    2016-08-01

    Full Text Available Cannonball metastases refer to well-defined spherical nodules scattered over both lungs, being a classical presentation of hematogenous tumor spreading. Striking progression of lung metastases without established primary malignancy can raise a diagnostic challenge. We herein report three cases with cannonball metastases at initial presentation. Two patients ended up having a choriocarcinoma but no awareness of the presence of primary tumors, and the third had abrupt lung metastases of endometrial cancer while she was being asymptomatic. Relentless progression was illustrated by clinical and radiographic changes. Ectopic expression of human chorionic gonadotropin (hCG would seemingly go some way responsible for fulminant cancer spreading associated with poor prognosis in our patients. The goal of this presentation is to raise awareness of ectopic hCG expression in patients presenting with similar astonishing scenarios.

  20. Prediction of late failure after medical abortion from serial beta-hCG measurements and ultrasonography

    DEFF Research Database (Denmark)

    Rørbye, C; Nørgaard, M; Nilas, Lisbeth

    2004-01-01

    on day 15 were greater among late failures than successes. Used as a predictive test, the positive predictive values of these variables were low. CONCLUSION: Neither beta-hCG nor endometrial thickness can be used clinically as diagnostic tests in predicting late failure after medical abortion.......BACKGROUND: Surgical treatment of failed medical abortion may be performed several weeks after initiation of the abortion. There are no recognized methods for early identification of these late failures. We assessed the prognostic values of beta-hCG and ultrasonography in predicting late failure...... thickness by ultrasonography was performed on day 15 after induction of medical abortion. Failures diagnosed after day 15 and within 15 weeks were identified and classified as late failures. All interventions in this group were due to bleeding problems. The predictive values of different absolute...

  1. Future Directions in Computer Graphics and Visualization: From CG&A's Editorial Board

    Energy Technology Data Exchange (ETDEWEB)

    Encarnacao, L. M.; Chuang, Yung-Yu; Stork, Andre; Kasik, David; Rhyne, Theresa-Marie; Avila, Lisa; Kohlhammer, Jorn; LaViola, Joseph; Tory, Melanie; Dill, John; Domik, Gitta; Owen, G. Scott; Wong, Pak C.

    2015-01-01

    With many new members joining the CG&A editorial board over the past year, and with a renewed commitment to not only document the state of the art in computer graphics research and applications but to anticipate and where possible foster future areas of scientific discourse and industrial practice, we asked editorial and advisory council members about where they see their fields of expertise going. The answers compiled here aren’t meant to be all encompassing or deterministic when it comes to the opportunities computer graphics and interactive visualization hold for the future. Instead, we aim to accomplish two things: give a more in-depth introduction of members of the editorial board to the CG&A readership and encourage cross-disciplinary discourse toward approaching, complementing, or disputing the visions laid out in this compilation.

  2. Abnormal hCG levels in a patient with treated stage I seminoma: a diagnostic dilemma.

    LENUS (Irish Health Repository)

    Aherne, Noel J

    2008-01-01

    BACKGROUND: We report the case of a patient with treated Stage Ia seminoma who was found to have an elevated beta human chorionic gonadotrophin (hCG) on routine follow - up. This instigated restaging and could have lead to commencement of chemotherapy. CASE PRESENTATION: The patient was a bodybuilder, and following a negative metastatic work - up, admitted to injecting exogenous beta hCG. This was done to reduce withdrawal symptoms from androgen abuse. The patient remains well eight years post diagnosis. CONCLUSION: This case highlights the need for surgical oncologists to conduct vigilant screening of young male patients with a history of testicular germ cell tumours and who may indulge in steroid abuse.

  3. Abnormal hCG levels in a patient with treated stage I seminoma: a diagnostic dilemma

    Directory of Open Access Journals (Sweden)

    Fitzpatrick David G

    2008-06-01

    Full Text Available Abstract Background We report the case of a patient with treated Stage Ia seminoma who was found to have an elevated beta human chorionic gonadotrophin (hCG on routine follow – up. This instigated restaging and could have lead to commencement of chemotherapy. Case presentation The patient was a bodybuilder, and following a negative metastatic work – up, admitted to injecting exogenous beta hCG. This was done to reduce withdrawal symptoms from androgen abuse. The patient remains well eight years post diagnosis. Conclusion This case highlights the need for surgical oncologists to conduct vigilant screening of young male patients with a history of testicular germ cell tumours and who may indulge in steroid abuse.

  4. Analytical characterization of recombinant hCG and comparative studies with reference product.

    Science.gov (United States)

    Thennati, Rajamannar; Singh, Sanjay Kumar; Nage, Nitin; Patel, Yena; Bose, Sandip Kumar; Burade, Vinod; Ranbhor, Ranjit Sudhakar

    2018-01-01

    Regulatory agencies recommend a stepwise approach for demonstrating biosimilarity between a proposed biosimilar and reference biological product emphasizing for functional and structural characterization to trace if there is any difference which may impact safety and efficacy. We studied the comparative structural and biological attributes of recombinant human chorionic gonadotropin (rhCG), SB005, with reference product, Ovidrel ® and Ovitrelle ® . Recombiant hCG was approved in 2000 by the US Food and Drug Administration for the induction of final follicular maturation, early luteinization in infertile women as part of assisted reproductive technology program. It is also indicated for the induction of ovulation and pregnancy in ovulatory infertile patients whose cause of infertility is not due to ovarian failure. Primary structure was studied by intact mass analysis, peptide fingerprinting, peptide mass fingerprinting and sequence coverage analysis. Higher order structure was studied by circular dichroism, ultraviolet-visible spectroscopy, fluorescence spectroscopy, and disulfide bridge analysis. Different isoforms of reference product and SB005 were identified using capillary isoelectric focusing and capillary zone electrophoresis. Glycosylation was studied by N-glycan mapping using LC-ESI-MS, point of glycosylation, released glycan analysis using ultra performance liquid chromatography and sialic acid analysis. Product related impurities such as oligomer content analysis and oxidized impurities were studied using size exclusion chromatography and reverse phase high performance liquid chromatography, respectively. Biological activity in term of potency of reference product and SB005 was studied by in vivo analysis. In this study we have compared analytical similarity of recombinant rhCG (SB005) produced at Sun Pharmaceuticals with the reference product with respect to its primary, higher order structure, isoforms, charge variants, glycosylation, sialyation

  5. A MALE CASE OF KALLMANN'S SYNDROME : FERTILITY INDUCED BY GONADOTROPIN (hCG/hMG) THERAPY

    OpenAIRE

    Okamoto, Shingo; Mayumi Mimura, Mayumi; Moch, Tadao; Sakamoto, Takemi; Izumi, Yukiko; Matzui, Yuhji; Hosokawa, Akiko; Kuriyama, Shigeki; Fukui, Hiroshi

    1998-01-01

    A 24-year-old male patient with Kallmann's syndrome who fathered two children after gonadotropin therapy is reported here. He was diagnosed with Kallmann's syndrome because of hypothalamic hypogonadism associated with anosmia. The gonadotropin therapy was initiated which involved treatment with human chorionic gonadotropin (hCG) and human menopausal gonadotropin (hMG). After 3 years of treatment, his secondary sexual characteristics developed to near the adult level and sperm were detected in...

  6. A novel HDAC inhibitor, CG200745, inhibits pancreatic cancer cell growth and overcomes gemcitabine resistance

    OpenAIRE

    Lee, Hee Seung; Park, Soo Been; Kim, Sun A; Kwon, Sool Ki; Cha, Hyunju; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Song, Si Young

    2017-01-01

    Pancreatic cancer is predominantly lethal, and is primarily treated using gemcitabine, with increasing resistance. Therefore, novel agents that increase tumor sensitivity to gemcitabine are needed. Histone deacetylase (HDAC) inhibitors are emerging therapeutic agents, since HDAC plays an important role in cancer initiation and progression. We evaluated the antitumor effect of a novel HDAC inhibitor, CG200745, combined with gemcitabine/erlotinib on pancreatic cancer cells and gemcitabine-resis...

  7. "Know What to Do If You Encounter a Flash Flood": Mental Models Analysis for Improving Flash Flood Risk Communication and Public Decision Making.

    Science.gov (United States)

    Lazrus, Heather; Morss, Rebecca E; Demuth, Julie L; Lazo, Jeffrey K; Bostrom, Ann

    2016-02-01

    Understanding how people view flash flood risks can help improve risk communication, ultimately improving outcomes. This article analyzes data from 26 mental models interviews about flash floods with members of the public in Boulder, Colorado, to understand their perspectives on flash flood risks and mitigation. The analysis includes a comparison between public and professional perspectives by referencing a companion mental models study of Boulder-area professionals. A mental models approach can help to diagnose what people already know about flash flood risks and responses, as well as any critical gaps in their knowledge that might be addressed through improved risk communication. A few public interviewees mentioned most of the key concepts discussed by professionals as important for flash flood warning decision making. However, most interviewees exhibited some incomplete understandings and misconceptions about aspects of flash flood development and exposure, effects, or mitigation that may lead to ineffective warning decisions when a flash flood threatens. These include important misunderstandings about the rapid evolution of flash floods, the speed of water in flash floods, the locations and times that pose the greatest flash flood risk in Boulder, the value of situational awareness and environmental cues, and the most appropriate responses when a flash flood threatens. The findings point to recommendations for ways to improve risk communication, over the long term and when an event threatens, to help people quickly recognize and understand threats, obtain needed information, and make informed decisions in complex, rapidly evolving extreme weather events such as flash floods. © 2015 Society for Risk Analysis.

  8. T2CG1, a package of preconditioned conjugate gradient solvers for TOUGH2

    International Nuclear Information System (INIS)

    Moridis, G.; Pruess, K.; Antunez, E.

    1994-03-01

    Most of the computational work in the numerical simulation of fluid and heat flows in permeable media arises in the solution of large systems of linear equations. The simplest technique for solving such equations is by direct methods. However, because of large storage requirements and accumulation of roundoff errors, the application of direct solution techniques is limited, depending on matrix bandwidth, to systems of a few hundred to at most a few thousand simultaneous equations. T2CG1, a package of preconditioned conjugate gradient solvers, has been added to TOUGH2 to complement its direct solver and significantly increase the size of problems tractable on PCs. T2CG1 includes three different solvers: a Bi-Conjugate Gradient (BCG) solver, a Bi-Conjugate Gradient Squared (BCGS) solver, and a Generalized Minimum Residual (GMRES) solver. Results from six test problems with up to 30,000 equations show that T2CG1 (1) is significantly (and invariably) faster and requires far less memory than the MA28 direct solver, (2) it makes possible the solution of very large three-dimensional problems on PCs, and (3) that the BCGS solver is the fastest of the three in the tested problems. Sample problems are presented related to heat and fluid flow at Yucca Mountain and WIPP, environmental remediation by the Thermal Enhanced Vapor Extraction System, and geothermal resources

  9. hCG-dependent regulation of angiogenic factors in human granulosa lutein cells.

    Science.gov (United States)

    Phan, B; Rakenius, A; Pietrowski, D; Bettendorf, H; Keck, C; Herr, D

    2006-07-01

    As prerequisite for development and maintenance of many diseases angiogenesis is of particular interest in medicine. Pathologic angiogenesis takes place in chronic arthritis, collagen diseases, arteriosclerosis, retinopathy associated with diabetes, and particularly in cancers. However, angiogenesis as a physiological process regularly occurs in the ovary. After ovulation the corpus luteum is formed by rapid vascularization of initially avascular granulosa lutein cell tissue. This process is regulated by gonadotropic hormones. In order to gain further insights in the regulatory mechanisms of angiogenesis in the ovary, we investigated these mechanisms in cell culture of human granulosa lutein cells. In particular, we determined the expression and production of several angiogenic factors including tissue inhibitor of matrix metalloproteinases-1 (TIMP-1), Leptin, connective tissue growth factor (CTGF), meningioma-associated complimentary DNA (Mac25), basic fibroblast growth factor (bFGF), and Midkine. In addition, we showed that human chorionic gonadotropin (hCG) has distinct effects on their expression and production. hCG enhances the expression and production of TIMP-1, whereas it downregulates the expression of CTGF and Mac25. Furthermore it decreases the expression of Leptin. Our results provide evidence that hCG determines growth and development of the corpus luteum by mediating angiogenic pathways in human granulosa lutein cells. Hence we describe a further approach to understand the regulation of angiogenesis in the ovary.

  10. Iterative methods for solving Ax=b, GMRES/FOM versus QMR/BiCG

    Energy Technology Data Exchange (ETDEWEB)

    Cullum, J. [IBM Research Division, Yorktown Heights, NY (United States)

    1996-12-31

    We study the convergence of GMRES/FOM and QMR/BiCG methods for solving nonsymmetric Ax=b. We prove that given the results of a BiCG computation on Ax=b, we can obtain a matrix B with the same eigenvalues as A and a vector c such that the residual norms generated by a FOM computation on Bx=c are identical to those generated by the BiCG computations. Using a unitary equivalence for each of these methods, we obtain test problems where we can easily vary certain spectral properties of the matrices. We use these test problems to study the effects of nonnormality on the convergence of GMRES and QMR, to study the effects of eigenvalue outliers on the convergence of QMR, and to compare the convergence of restarted GMRES, QMR, and BiCGSTAB across a family of normal and nonnormal problems. Our GMRES tests on nonnormal test matrices indicate that nonnormality can have unexpected effects upon the residual norm convergence, giving misleading indications of superior convergence over QMR when the error norms for GMRES are not significantly different from those for QMR. Our QMR tests indicate that the convergence of the QMR residual and error norms is influenced predominantly by small and large eigenvalue outliers and by the character, real, complex, or nearly real, of the outliers and the other eigenvalues. In our comparison tests QMR outperformed GMRES(10) and GMRES(20) on both the normal and nonnormal test matrices.

  11. Jet models of X-Ray Flashes

    International Nuclear Information System (INIS)

    Lamb, D.Q.; Donaghy, T.Q.; Graziani, C.

    2005-01-01

    One third of all HETE-2-localized bursts are X-Ray Flashes (XRFs), a class of events first identified by Heise in which the fluence in the 2-30 keV energy band exceeds that in the 30-400 keV energy band We summarize recent HETE-2 and other results on the properties of XRFs. These results show that the properties of XRFs, X-ray-rich gamma-ray bursts (GRBs), and GRBs form a continuum, and thus provide evidence that all three kinds of bursts are closely related phenomena. As the most extreme burst population, XRFs provide severe constraints on burst models and unique insights into the structure of GRB jets, the GRB rate, and the nature of Type Ib/Ic supernovae. We briefly mention a number of the physical models that have been proposed to explain XRFs. We then consider two fundamentally different classes of phenomenological jet models: universal jet models, in which it is posited that all GRBs jets are identical and that differences in the observed properties of the bursts are due entirely to differences in the viewing angle; and variable-opening angle jet models, in which it is posited that GRB jets have a distribution of jet opening angles and that differences in the observed properties of the bursts are due to differences in the emissivity and spectra of jets having different opening angles. We consider three shapes far the emissivity as a function of the viewing angle θ ν from the axis of the jet: power law, top hat (or uniform) , and Gaussian (or Fisher). We then discuss the effect of relativistic beaming on each of these models. We show that observations can distinguish between these various models

  12. GnRHa trigger and individualized luteal phase hCG support according to ovarian response to stimulation

    DEFF Research Database (Denmark)

    Humaidan, Peter; Polyzos, N P; Alsbjerg, B

    2013-01-01

    , there was a lack of blinding in the RCTs. WIDER IMPLICATIONS OF THE FINDINGS: Although a non-significant result, one bolus of 1.500 IU hCG after GnRHa trigger tended to reduce the OHSS rate in patients with 15-25 follicles ≥11 mm as well as secure the ongoing pregnancy rate. In contrast, in patients at low risk......STUDY QUESTION: Does a GnRH agonist (GnRHa) trigger followed by a bolus of 1.500 IU hCG in a group of patients at risk of ovarian hyperstimulation syndrome (OHSS) reduce the OHSS incidence compared with hCG trigger? SUMMARY ANSWER: A GnRHa trigger followed by early luteal hCG support with one bolus...... of 1.500 IU hCG appears to reduce OHSS in patients at risk of OHSS; however, in a low-risk group a second bolus of 1.500 IU hCG induced two cases of late onset OHSS. WHAT IS KNOWN ALREADY: A GnRHa trigger is an alternative to hCG in GnRH antagonist co-treated cycles. STUDY DESIGN, SIZE, DURATION: Two...

  13. Effect of hCG priming on embryonic development of immature oocytes collected from unstimulated women with polycystic ovarian syndrome

    Directory of Open Access Journals (Sweden)

    Zheng Xiaoying

    2012-05-01

    Full Text Available Abstract Backgroud The effect of hCG priming on oocyte maturation and subsequently outcome in IVM cycles has remained a debated issue. A randomized controlled study was performed to investigate whether or not hCG priming prior to oocyte aspiration can improve the developmental competence of immature oocytes from unstimulated ovaries in women with polycystic ovarian syndrome (PCOS. Methods Eighty two patients with PCOS underwent IVM cycles. Each patient was randomly assigned to the hCG-primed (10,000 IU or non-primed groups 36–38 hours before oocyte retrieval depending on the computerized random table. After the oocytes had in vitro matured, fertilization, culture and embryo transfer were performed. Results The average number of cumulus-oocyte complexes (COCs recovered was 13.80 and 14.35 in the hCG-primed and non-primed groups, respectively (p > 0.05. The maturation rate of COCs was significantly improved in the hCG-primed group (55.43% vs. 42.29%; p  Conclusions While a significant improvement in the nuclear maturation rate of immature oocytes was observed in hCG-primed IVM cycles with PCOS patients, the use of hCG prior to oocyte retrieval did not improve the subsequent embryo developmental competence. The high rate of pregnancy loss in IVM cycles should receive more attention.

  14. Revisiting the role of hCG: new regulation of the angiogenic factor EG-VEGF and its receptors.

    Science.gov (United States)

    Brouillet, S; Hoffmann, P; Chauvet, S; Salomon, A; Chamboredon, S; Sergent, F; Benharouga, M; Feige, J J; Alfaidy, N

    2012-05-01

    Endocrine gland-derived vascular endothelial growth factor (EG-VEGF) is an angiogenic factor reported to be specific for endocrine tissues, including the placenta. Its biological activity is mediated via two G protein-coupled receptors, prokineticin receptor 1 (PROKR1) and prokineticin receptor 2 (PROKR2). We have recently shown that (i) EG-VEGF expression peaks between the 8th and 11th weeks of gestation, (ii) its mRNA and protein levels are up-regulated by hypoxia, (iii) EG-VEGF is a negative regulator of trophoblast invasion and (iv) its circulating levels are increased in preeclampsia (PE), the most threatening pathology of pregnancy. Here, we investigated the regulation of the expression of EG-VEGF and its receptors by hCG, a key pregnancy hormone that is also deregulated in PE. During the first trimester of pregnancy, hCG and EG-VEGF exhibit the same pattern of expression, suggesting that EG-VEGF is potentially regulated by hCG. Both placental explants (PEX) and primary cultures of trophoblasts from the first trimester of pregnancy were used to investigate this hypothesis. Our results show that (i) LHCGR, the hCG receptor, is expressed both in cyto- and syncytiotrophoblasts, (ii) hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, (iii) hCG increases the release of EG-VEGF from PEX conditioned media, (iv) hCG effects are transcriptional and post-transcriptional and (v) the hCG effects are mediated by cAMP via cAMP response elements present in the EG-VEGF promoter region. Altogether, these results demonstrate a new role for hCG in the regulation of EG-VEGF and its receptors, an emerging regulatory system in placental development.

  15. Analytical characterization of recombinant hCG and comparative studies with reference product

    Directory of Open Access Journals (Sweden)

    Thennati R

    2018-01-01

    Full Text Available Rajamannar Thennati,1 Sanjay Kumar Singh,1 Nitin Nage,1 Yena Patel,1 Sandip Kumar Bose,1 Vinod Burade,2 Ranjit Sudhakar Ranbhor1 1Sun Pharmaceutical Industries Limited, 2Sun Pharmaceutical Advanced Research Center, Vadodara, Gujarat, India Introduction: Regulatory agencies recommend a stepwise approach for demonstrating biosimilarity between a proposed biosimilar and reference biological product emphasizing for functional and structural characterization to trace if there is any difference which may impact safety and efficacy. We studied the comparative structural and biological attributes of recombinant human chorionic gonadotropin (rhCG, SB005, with reference product, Ovidrel® and Ovitrelle®. Recombiant hCG was approved in 2000 by the US Food and Drug Administration for the induction of final follicular maturation, early luteinization in infertile women as part of assisted reproductive technology program. It is also indicated for the induction of ovulation and pregnancy in ovulatory infertile patients whose cause of infertility is not due to ovarian failure. Materials and methods: Primary structure was studied by intact mass analysis, peptide fingerprinting, peptide mass fingerprinting and sequence coverage analysis. Higher order structure was studied by circular dichroism, ultraviolet-visible spectroscopy, fluorescence spectroscopy, and disulfide bridge analysis. Different isoforms of reference product and SB005 were identified using capillary isoelectric focusing and capillary zone electrophoresis. Glycosylation was studied by N-glycan mapping using LC-ESI-MS, point of glycosylation, released glycan analysis using ultra performance liquid chromatography and sialic acid analysis. Product related impurities such as oligomer content analysis and oxidized impurities were studied using size exclusion chromatography and reverse phase high performance liquid chromatography, respectively. Biological activity in term of potency of reference product

  16. Lunar Impact Flash Locations from NASA's Lunar Impact Monitoring Program

    Science.gov (United States)

    Moser, D. E.; Suggs, R. M.; Kupferschmidt, L.; Feldman, J.

    2015-01-01

    Meteoroids are small, natural bodies traveling through space, fragments from comets, asteroids, and impact debris from planets. Unlike the Earth, which has an atmosphere that slows, ablates, and disintegrates most meteoroids before they reach the ground, the Moon has little-to-no atmosphere to prevent meteoroids from impacting the lunar surface. Upon impact, the meteoroid's kinetic energy is partitioned into crater excavation, seismic wave production, and the generation of a debris plume. A flash of light associated with the plume is detectable by instruments on Earth. Following the initial observation of a probable Taurid impact flash on the Moon in November 2005,1 the NASA Meteoroid Environment Office (MEO) began a routine monitoring program to observe the Moon for meteoroid impact flashes in early 2006, resulting in the observation of over 330 impacts to date. The main objective of the MEO is to characterize the meteoroid environment for application to spacecraft engineering and operations. The Lunar Impact Monitoring Program provides information about the meteoroid flux in near-Earth space in a size range-tens of grams to a few kilograms-difficult to measure with statistical significance by other means. A bright impact flash detected by the program in March 2013 brought into focus the importance of determining the impact flash location. Prior to this time, the location was estimated to the nearest half-degree by visually comparing the impact imagery to maps of the Moon. Better accuracy was not needed because meteoroid flux calculations did not require high-accuracy impact locations. But such a bright event was thought to have produced a fresh crater detectable from lunar orbit by the NASA spacecraft Lunar Reconnaissance Orbiter (LRO). The idea of linking the observation of an impact flash with its crater was an appealing one, as it would validate NASA photometric calculations and crater scaling laws developed from hypervelocity gun testing. This idea was

  17. Venlafaxine and desvenlafaxine in the management of menopausal hot flashes

    Directory of Open Access Journals (Sweden)

    Johnson ED

    2011-09-01

    Full Text Available Vasomotor flushes are common complaints of women during and after menopause, affecting about 75 percent of this population. Estrogen therapy is the most effective treatment for hot flashes. However, there are a significant number of women who have contraindications or choose not to use estrogen due to potential risks such as breast cancer and thromboembolic disorders. These women need alternative options. The selective norepinephrine reuptake inhibitors, venlafaxine and desvenlafaxine, have shown efficacy in alleviating hot flashes.Objective: The purpose of this review is to assess the efficacy and tolerability of these two agents for treatment of hot flashes in healthy postmenopausal women.Methods: A literature search of the MEDLINE and Ovid databases from inception to June 2011 was conducted. Randomized controlled trials, published in English, with human participants were included. Studies included postmenopausal women, and trials with breast cancer only populations were excluded.Results: Venlafaxine reduced hot flashes by 37 to 61 percent and desvenlafaxine by 55 to 69 percent. Both agents were well tolerated. The most common adverse effects were headache, dry mouth, nausea, insomnia, somnolence, and dizziness.Conclusion: Based on the evidence, venlafaxine and desvenlafaxine are both viable options for reducing the frequency and severity of hot flashes.

  18. Search for the radio occulation flash at Jupiter

    International Nuclear Information System (INIS)

    Martin, J.M.; Tyler, G.L.; Eshleman, V.R.; Wood, G.E.; Lindall, G.F.

    1981-01-01

    The 'evolute flash' a focusing effect caused by the curvature of a planet's limb, was sought in the radio data taken during the occulation of Voyager 1 by Jupiter, using a modified matched-filter technique. The expected frequency structure of the flash signal is double branched, while the intensity structure is highly localized in time. The search for the signal was carried out over a 6.4 s period. The signal parameters were varied to span the uncertainties introduced by imperfect knowledge of the orbit of the spacecraft and the shape of Jupiter. Several peaks at the 8 standard deviation level were present in the filter output. However, these peaks were separated in time by up to 3.3 s, and none could be identified as the flash. From this negative result a lower bound on the absorption along a ray with periapsis near the 4 bar level in Jupiter's atmosphere can be established at 25 dB. Employing the new Voyager results on the structure of the atmosphere of Jupiter and the mixing ratio of the absorbent ammonia, as well as the improved knowledge of flash characteristics resulting from this study, we estimate that the flash would have been detected if the distance behind the planet where the spacecraft trajectory crossed the evolute were at least 20 Jupiter radii, as compared with a value near 7 in the experiment. For focusing at this greater distance, the atmospheric pressure at the ray periapsis would be between 1.5 and 2 bar

  19. Desorption of deuterium from beryllium codeposits using flash heating

    Energy Technology Data Exchange (ETDEWEB)

    Yu, J.H., E-mail: jyu@ferp.ucsd.edu [Center for Energy Research, University of California at San Diego, La Jolla, CA 92093-0417 (United States); Baldwin, M.J.; Doerner, R.P. [Center for Energy Research, University of California at San Diego, La Jolla, CA 92093-0417 (United States); Pitts, R.A. [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France); Smirnov, R.D. [Center for Energy Research, University of California at San Diego, La Jolla, CA 92093-0417 (United States); Xu, H.W. [General Atomics, P.O. Box 85608, San Diego, CA 92186-5608 (United States)

    2013-07-15

    As a result of safety concerns, limits will be placed on the allowable tritium inventory retained inside the ITER vacuum vessel. The primary motivation for the present work is to test the proposed method of removing tritium from main chamber codeposits using radiative heat flashing from controlled ITER plasma shutdowns. Detritiation of Be codeposits is studied in the PISCES-B facility using flash-heating by a 10 ms laser with up to 2 MJ/m{sup 2} of absorbed energy density. Three types of codeposits are flash-heated with layer thickness ranging from 0.1 to 1.2 μm. Less than 25% of the D in the Be layer escapes at ITER-relevant flash energy densities and with peak surface temperature up to ∼900 °C. Repetitive flashing with peak surface temperature of 400–500 °C results in an increased population of higher energy trap sites, implying that transient heating which causes appropriate surface temperature excursion redistributes D among codeposit trap sites.

  20. Environmental Effects on Data Retention in Flash Cells

    Science.gov (United States)

    Katz, Rich; Flowers, David; Bergevin, Keith

    2017-01-01

    Flash technology is being utilized in fuzed munition applications and, based on the development of digital logic devices in the commercial world, usage of flash technology will increase. Antifuse technology, prevalent in non-volatile field programmable gate arrays (FPGAs), will eventually be phased out as new devices have not been developed for approximately a decade. The reliance on flash technology presents a long-term reliability issue for both DoD and NASA safety- and mission-critical applications. A thorough understanding of the data retention failure modes and statistics associated with Flash data retention is of vital concern to the fuze safety community. A key retention parameter for a flash cell is the threshold voltage (VTH), which is an indirect indicator of the amount of charge stored on the cells floating gate. This paper will present the results of our on-going tests: long-term storage at 150 C for a small population of devices, neutron radiation exposure, electrostatic discharge (ESD) testing, and the trends of large populations (over 300 devices for each condition) exposed to three difference temperatures: 25 C, 125 C, and 150 C.

  1. Flash photolysis of rhodopsin in the cat retina

    International Nuclear Information System (INIS)

    Ripps, H.; Mehaffey, L.; Siegel, I.M.; Ernst, W.; Kemp, C.M.

    1981-01-01

    The bleaching of rhodopsin by short-duration flashes of a xenon discharge lamp was studied in vivo in the cat retina with the aid of a rapid, spectral-scan fundus reflectometer. Difference spectra recorded over a broad range of intensities showed that the bleaching efficacy of high-intensity flashes was less than that of longer duration, steady lights delivering the same amount of energy. Both the empirical results and those derived from a theoretical analysis of flash photolysis indicate that, under the conditions of these experiments, the upper limit of the flash bleaching of rhodopsin in cat is approximately 90%. Although the fact that a full bleach could not be attained is attributable to photoreversal, i.e., the photic regeneration of rhodopsin from its light-sensitive intermediates, the 90% limit is considerably higher than the 50% (or lower) value obtained under other experimental circumstances. Thus, it appears that the duration (approximately 1 ms) and spectral composition of the flash, coupled with the kinetic parameters of the thermal and photic reactions in the cat retina, reduce the light-induced regeneration of rhodopsin to approximately 10%

  2. Multi-Level Bitmap Indexes for Flash Memory Storage

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Kesheng; Madduri, Kamesh; Canon, Shane

    2010-07-23

    Due to their low access latency, high read speed, and power-efficient operation, flash memory storage devices are rapidly emerging as an attractive alternative to traditional magnetic storage devices. However, tests show that the most efficient indexing methods are not able to take advantage of the flash memory storage devices. In this paper, we present a set of multi-level bitmap indexes that can effectively take advantage of flash storage devices. These indexing methods use coarsely binned indexes to answer queries approximately, and then use finely binned indexes to refine the answers. Our new methods read significantly lower volumes of data at the expense of an increased disk access count, thus taking full advantage of the improved read speed and low access latency of flash devices. To demonstrate the advantage of these new indexes, we measure their performance on a number of storage systems using a standard data warehousing benchmark called the Set Query Benchmark. We observe that multi-level strategies on flash drives are up to 3 times faster than traditional indexing strategies on magnetic disk drives.

  3. Theoretical investigation of flash vaporisation in a screw expander

    Science.gov (United States)

    Vasuthevan, Hanushan; Brümmer, Andreas

    2017-08-01

    In the present study flash vaporisation of liquid injection in a twin screw expander for a Trilateral Flash Cycle (TFC) is examined theoretically. The TFC process comprises a pressure increase in the working fluid, followed by heating the liquid close to boiling point. The hot liquid is injected into the working chamber of a screw expander. During this process the pressure of the liquid drops below the saturation pressure, while the temperature of the liquid remains virtually constant. Hence the liquid is superheated and in a metastable state. The liquid jet seeks to achieve a stable state in thermodynamic equilibrium and is therefore partially vaporised. This effect is referred to as flash vaporisation. Accordingly, a two-phase mixture, consisting of vapour and liquid, exists in the working chamber. Thermodynamic simulations were carried out using water as the working fluid for representative screw expander geometry. The simulations presented are performed from two different aspects during the filling process of a screw expander. The first case is the vaporisation of the injected liquid in a state of thermodynamic equilibrium, whereby the two-phase mixture is treated entirely as a compressible and homogeneous gas. The second case considers flashing efficiency. It describes the quantity of flashed vapour and consists of a liquid and vapour domain. Both models are compared and analysed with respect to the operational behaviour of a screw expander.

  4. Replacing HDDs with Solid-State Flash Disks in PXIbus-Based Systems

    International Nuclear Information System (INIS)

    Zhao, Z W; Zeng, L

    2006-01-01

    New security features, constantly decreasing prices, solid-state Flash disks are becoming a popular alternative for replacing failure-prone mechanical Hard Disk Drives (HDDs) in PXIbus-based military systems. The key component in high-capacity solid-state Flash disks is NAND Flash, but with a specification that shows only 100,000-300,000 write/erase cycles, engineers may be concerned that the lifetime of Flash disks cannot meet their application requirements. With the right Flash management, Flash disks are able to provide the reliability and endurance that military applications need

  5. Modeling midwave infrared muzzle flash spectra from unsuppressed and flash-suppressed large caliber munitions

    Science.gov (United States)

    Steward, Bryan J.; Perram, Glen P.; Gross, Kevin C.

    2012-07-01

    Time-resolved infrared spectra of firings from a 152 mm howitzer were acquired over an 1800-6000 cm-1 spectral range using a Fourier-transform spectrometer. The instrument collected primarily at 32 cm-1 spectral and 100 Hz temporal resolutions. Munitions included unsuppressed and chemically flash suppressed propellants. Secondary combustion occurred with unsuppressed propellants resulting in flash emissions lasting ˜100 ms and dominated by H2O and CO2 spectral structure. Non-combusting plume emissions were one-tenth as intense and approached background levels within 20-40 ms. A low-dimensional phenomenological model was used to reduce the data to temperatures, soot absorbances, and column densities of H2O, CO2, CH4, and CO. The combusting plumes exhibit peak temperatures of ˜1400 K, areas of greater than 32 m2, low soot emissivity of ˜0.04, with nearly all the CO converted to CO2. The non-combusting plumes exhibit lower temperatures of ˜1000 K, areas of ˜5 m2, soot emissivity of greater than 0.38 and CO as the primary product. Maximum fit residual relative to peak intensity are 14% and 8.9% for combusting and non-combusting plumes, respectively. The model was generalized to account for turbulence-induced variations in the muzzle plumes. Distributions of temperature and concentration in 1-2 spatial regions demonstrate a reduction in maximum residuals by 40%. A two-region model of combusting plumes provides a plausible interpretation as a ˜1550 K, optically thick plume core and ˜2550 K, thin, surface-layer flame-front. Temperature rate of change was used to characterize timescales and energy release for plume emissions. Heat of combustion was estimated to be ˜5 MJ/kg.

  6. Intrafollicular Endocrine Milieu After Addition of hCG to Recombinant FSH During Controlled Ovarian Stimulation for In Vitro Fertilization

    DEFF Research Database (Denmark)

    Thuesen, L L; Andersen, A Nyboe; Loft, A

    2014-01-01

    CONTEXT: The role of human chorionic gonadotropin (hCG) supplementation on the intrafollicular steroid milieu has been studied. OBJECTIVE: The objective of the study was to assess the impact on steroid levels in follicular fluids (FFs) after different doses of hCG supplementation to recombinant FSH...... protocol with recombinant FSH 150 IU/d and randomized from stimulation day 1 to supplementation with hCG: D0, 0 IU/d; D50, 50 IU/d; D100, 100 IU/d; and D150, 150 IU/d. MAIN OUTCOME MEASURE: Intrafollicular hormone concentrations in relation to treatment groups, follicular sizes, and embryo quality were...... measured. RESULTS: In large follicles, hCG supplementation induced a nearly 3-fold increase of estradiol (nanomoles per liter) [D0: 1496; D50: 3138; D100: 4338; D150: 4009 (P

  7. Flash Points of Secondary Alcohol and n-Alkane Mixtures.

    Science.gov (United States)

    Esina, Zoya N; Miroshnikov, Alexander M; Korchuganova, Margarita R

    2015-11-19

    The flash point is one of the most important characteristics used to assess the ignition hazard of mixtures of flammable liquids. To determine the flash points of mixtures of secondary alcohols with n-alkanes, it is necessary to calculate the activity coefficients. In this paper, we use a model that allows us to obtain enthalpy of fusion and enthalpy of vaporization data of the pure components to calculate the liquid-solid equilibrium (LSE) and vapor-liquid equilibrium (VLE). Enthalpy of fusion and enthalpy of vaporization data of secondary alcohols in the literature are limited; thus, the prediction of these characteristics was performed using the method of thermodynamic similarity. Additionally, the empirical models provided the critical temperatures and boiling temperatures of the secondary alcohols. The modeled melting enthalpy and enthalpy of vaporization as well as the calculated LSE and VLE flash points were determined for the secondary alcohol and n-alkane mixtures.

  8. Boiling water reactor stability revisited: The effects of flashing

    Energy Technology Data Exchange (ETDEWEB)

    Yadigaroglu, G. [Institute of Energy Technology, Swiss Federal Institute of Technology, ETH, ETH-Zentrum, CLT-C1, CH-8092 Zurich (Switzerland)]. E-mail: yadi@ethz.ch; Askari, B. [Institute of Energy Technology, Swiss Federal Institute of Technology, ETH, ETH-Zentrum, CLT-C1, CH-8092 Zurich (Switzerland)

    2005-05-01

    There are numerous investigations of two-phase flow stability with particular emphasis to BWR stability; these have become increasingly sophisticated and complete over the years. The basic features of a new development and frequency-domain code capable of considering all the channels (bundles) in a BWR, flashing of the coolant at low pressure, full coupling with 3D, two-group neutronics, etc. are described. The basic thermal-hydraulic model is used to study the effects of flashing on stability in a BWR-like channel. The behavior of the channel is highly dynamic. Contrary to what could have been intuitively guessed, the effect of flashing is stabilizing; the reasons and mechanisms leading to this are discussed.

  9. Boiling water reactor stability revisited: The effects of flashing

    International Nuclear Information System (INIS)

    Yadigaroglu, G.; Askari, B.

    2005-01-01

    There are numerous investigations of two-phase flow stability with particular emphasis to BWR stability; these have become increasingly sophisticated and complete over the years. The basic features of a new development and frequency-domain code capable of considering all the channels (bundles) in a BWR, flashing of the coolant at low pressure, full coupling with 3D, two-group neutronics, etc. are described. The basic thermal-hydraulic model is used to study the effects of flashing on stability in a BWR-like channel. The behavior of the channel is highly dynamic. Contrary to what could have been intuitively guessed, the effect of flashing is stabilizing; the reasons and mechanisms leading to this are discussed

  10. Model of UV flashes due to gigantic blue jets

    International Nuclear Information System (INIS)

    Milikh, G M; Shneider, M N

    2008-01-01

    Analysis of UV flashes observed by the UV detector on board the 'Tatiana' microsatellite suggests, based on their location, pulse width and energy of the source of the photons, that the flashes were generated by gigantic blue jets (GBJs). Presented in this paper is a numerical model of UV flashes due to a bunch of long streamers which form a leader, a prong such as that observed in a GBJ. Using a previously developed model of upward propagation of a long streamer in the exponential atmosphere the paper describes temporal evolution of the UV flux generated by a bunch of long streamers, in the given spectral range 300-400 nm used by the UV detector on board 'Tatiana'. The model is in agreement with the observations.

  11. Visualization on triangle concept using Adobe Flash Professional SC6

    Science.gov (United States)

    Sagita, Laela; Ratih Kusumarini, Adha

    2017-12-01

    The purpose of this paper is to develop teaching aids using Adobe Flash Professional CS6 emphasize on Triangle concept. A new alternative way to deliver a basic concept in geometry with visualization is software Adobe Flash Professional CS 6. Research method is research and development with 5 phase of Ploom’s model, namely (1) preliminary, (2) design, (3) realization/ construction, (4) test, evaluation and revision, and 5) implementation. The results showed that teaching aids was valid, practice, and effective. Validity: expert judgement for material score is 3.95 and media expert judgement produce an average score of 3,2, both in the category are valid. Practically: the average of questionnaire response is 4,04 (good). Effectiveness: n-gain test value is 0,36 (medium). It concluded that developed of teaching aids using Adobe Flash CS6 on triangle can improve student achievement.

  12. Flash trajectory imaging of target 3D motion

    Science.gov (United States)

    Wang, Xinwei; Zhou, Yan; Fan, Songtao; He, Jun; Liu, Yuliang

    2011-03-01

    We present a flash trajectory imaging technique which can directly obtain target trajectory and realize non-contact measurement of motion parameters by range-gated imaging and time delay integration. Range-gated imaging gives the range of targets and realizes silhouette detection which can directly extract targets from complex background and decrease the complexity of moving target image processing. Time delay integration increases information of one single frame of image so that one can directly gain the moving trajectory. In this paper, we have studied the algorithm about flash trajectory imaging and performed initial experiments which successfully obtained the trajectory of a falling badminton. Our research demonstrates that flash trajectory imaging is an effective approach to imaging target trajectory and can give motion parameters of moving targets.

  13. Assessment and association of two useful tumour markers: alpha feto protein and human chornionic gonodotropin (beta hCG) hormone

    International Nuclear Information System (INIS)

    Subhan, F.; Tahir, F.; Sultan, S.; Subhan, K.

    2008-01-01

    This study was designed to determine serum Alpha-fetoprotein (AFP) and beta-h Chornionic Gonodotropin hormone (beta-hCG) levels among adult Pakistani population, and to observe their correlation. Serum AFP and beta-hCG levels were evaluated, using Micro-particle Enzyme Immuno Assay (MEIA) technology of M/s Abbott Laboratories. Data were compared using students t-test and correlation was computed. In the patients advised serum AFP assessment, 52% had normal AFP levels. comprising 37% male and 63% female subjects. For patients having a non-pathological picture, AFP levels varied non-significantly (p>0.05) between the Genders however, age varied highly significantly (p 0.05) and highly significant (p 0.05). Comparison of the population in the same age groups of both genders revealed significant (p 0.05), due to a large standard error. Although the differences in beta-hCG levels were highly significant (p 0.05). Among the studied cases, 67% patients had normal and 33% patients had raised beta-hCG levels. Beta-hCG levels show a decreasing trend with increasing age and beta-hCG levels were statistically significant (p<0.05) when patients under 50 years of age were compared with patients above 50 years. The coefficient of correlation between serum AFP and beta- hCG levels was 0.996454, which indicated a very strong. Significant positive correlation between the two tumour markers. The study showed that both serum AFP and beta-hCG are useful tumour markers and had a very strong positive correlation. (author)

  14. The structure of the polynomials in preconditioned BiCG algorithms and the switching direction of preconditioned systems

    OpenAIRE

    Itoh, Shoji; Sugihara, Masaaki

    2016-01-01

    We present a theorem that defines the direction of a preconditioned system for the bi-conjugate gradient (BiCG) method, and we extend it to preconditioned bi-Lanczos-type algorithms. We show that the direction of a preconditioned system is switched by construction and by the settings of the initial shadow residual vector. We analyze and compare the polynomial structures of four preconditioned BiCG algorithms.

  15. Epigenetic Modulation with HDAC Inhibitor CG200745 Induces Anti-Proliferation in Non-Small Cell Lung Cancer Cells

    OpenAIRE

    Chun, Sung-Min; Lee, Ji-Young; Choi, Jene; Lee, Je-Hwan; Hwang, Jung Jin; Kim, Chung-Soo; Suh, Young-Ah; Jang, Se Jin

    2015-01-01

    Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of his...

  16. Flash Flood Type Identification within Catchments in Beijing Mountainous Area

    Science.gov (United States)

    Nan, W.

    2017-12-01

    Flash flood is a common type of disaster in mountainous area, Flash flood with the feature of large flow rate, strong flushing force, destructive power, has periodically caused loss to life and destruction to infrastructure in mountainous area. Beijing as China's political, economic and cultural center, the disaster prevention and control work in Beijing mountainous area has always been concerned widely. According to the transport mechanism, sediment concentration and density, the flash flood type identification within catchment can provide basis for making the hazards prevention and mitigation policy. Taking Beijing as the study area, this paper extracted parameters related to catchment morphological and topography features respectively. By using Bayes discriminant, Logistic regression and Random forest, the catchments in Beijing mountainous area were divided into water floods process, fluvial sediment transport process and debris flows process. The results found that Logistic regression analysis showed the highest accuracy, with the overall accuracy of 88.2%. Bayes discriminant and Random forest had poor prediction effects. This study confirmed the ability of morphological and topography features to identify flash flood process. The circularity ratio, elongation ratio and roughness index can be used to explain the flash flood types effectively, and the Melton ratio and elevation relief ratio also did a good job during the identification, whereas the drainage density seemed not to be an issue at this level of detail. Based on the analysis of spatial patterns of flash flood types, fluvial sediment transport process and debris flow process were the dominant hazards, while the pure water flood process was much less. The catchments dominated by fluvial sediment transport process were mainly distributed in the Yan Mountain region, where the fault belts were relatively dense. The debris flow process prone to occur in the Taihang Mountain region thanks to the abundant

  17. Location accuracy evaluation of lightning location systems using natural lightning flashes recorded by a network of high-speed cameras

    Science.gov (United States)

    Alves, J.; Saraiva, A. C. V.; Campos, L. Z. D. S.; Pinto, O., Jr.; Antunes, L.

    2014-12-01

    This work presents a method for the evaluation of location accuracy of all Lightning Location System (LLS) in operation in southeastern Brazil, using natural cloud-to-ground (CG) lightning flashes. This can be done through a multiple high-speed cameras network (RAMMER network) installed in the Paraiba Valley region - SP - Brazil. The RAMMER network (Automated Multi-camera Network for Monitoring and Study of Lightning) is composed by four high-speed cameras operating at 2,500 frames per second. Three stationary black-and-white (B&W) cameras were situated in the cities of São José dos Campos and Caçapava. A fourth color camera was mobile (installed in a car), but operated in a fixed location during the observation period, within the city of São José dos Campos. The average distance among cameras was 13 kilometers. Each RAMMER sensor position was determined so that the network can observe the same lightning flash from different angles and all recorded videos were GPS (Global Position System) time stamped, allowing comparisons of events between cameras and the LLS. The RAMMER sensor is basically composed by a computer, a Phantom high-speed camera version 9.1 and a GPS unit. The lightning cases analyzed in the present work were observed by at least two cameras, their position was visually triangulated and the results compared with BrasilDAT network, during the summer seasons of 2011/2012 and 2012/2013. The visual triangulation method is presented in details. The calibration procedure showed an accuracy of 9 meters between the accurate GPS position of the object triangulated and the result from the visual triangulation method. Lightning return stroke positions, estimated with the visual triangulation method, were compared with LLS locations. Differences between solutions were not greater than 1.8 km.

  18. Addition of low dose hCG to rFSh benefits older women during ovarian stimulation for IVF

    Directory of Open Access Journals (Sweden)

    Gomaa Hala

    2012-08-01

    Full Text Available Abstract Background To compare the outcome of IVF cycles in women receiving controlled ovarian stimulation with recFSH or recFSH plus low dose hCG. Methods A retrospective case control study, performed at a private practice affiliated with an academic institute. Patients were infertile women who were treated with IVF/ICSI and controlled ovarian stimulation in a long GnRH agonist protocol using either low dose hCG in addition to recFSH [N = 88] or recFSH alone [N = 99]. Primary outcomes were mean FSH dose, number of mature eggs, number of fertilized eggs, and serum levels of estradiol. Secondary outcomes were endometrial thickness, cycle cancellations and pregnancy rates. Results A significant increase in number of mature and fertilized eggs was observed in women over 40 years of age using low dose hCG in addition to recFSH. The estradiol level was significantly higher on the day of hCG administration and the serum level of FSH on cycle day 7 and on the day of hCG administration were lower. Conclusion Addition of low dose hCG to recFSH compared with recFSH alone significantly modified cycle characteristics in patients >/= 40 years and could be of potential benefit for IVF cycles in older infertile women.

  19. Inception and development of voids in flashing liquids

    International Nuclear Information System (INIS)

    Jones, O.C. Jr.

    1979-06-01

    Recent work aimed at correctly describing nonequilibrium vapor generation rates in flashing liquids in decompressing flows similar to those which might be encountered in a loss of coolant accident in a nuclear reactor is summarized. Analysis is reviewed which describes the flashing inception superheat in terms of the turbulence intensity for a given expansion rate and initial temperature, and interfacial area density and interfacial heat flux, and the volumetric vapor generation rates. Comparisons with existing data are included and further experiments being undertaken are described, including typical recent results

  20. Fenomena Kerak Dalam Desalinasi Dengan Multi Stage Flash Distillation (Msf)

    OpenAIRE

    Alimah, Siti

    2006-01-01

    SCALING PHENOMENA IN DESALINATION WITH MULTI STAGE FLASH DISTILLATION (MSF). Assessment of scaling phenomena in MSF desalination has been carried out. Scale is one of predominantly problem in multi stage flash (MSF) desalination installation. The main types of scale in MSF are carbonat calcium (CaC03), hydroxide magnesium (Mg(OH)2) dan sulphate calcium (CaS04). CaC03 dan Mg(OH)2 scales result from the thermal decomposition of bicarbonate ion, however sulphate calcium scale result from reactio...

  1. [Contact shot from infantry weapons with a flash-suppressor].

    Science.gov (United States)

    Perdekamp, Markus Grosse; Braunwarth, Roland; Schmidt, Ulrike; Schmidt, Wolfgang; Pollak, Stefan

    2003-01-01

    The number of reports on contact shots from firearms with a flash suppressor attached to the muzzle is small. On the basis of a case report (suicidal shot to the forehead with a Kalschnikow AKMS 47 assault rifle) the morphological peculiarities (characteristics soot pattern, relatively small powder cavity and only minor skin tears in the presence of a bony support) are presented and the conclusions to be drawn from the findings regarding the flash-suppressor, the shot distance, the angle of the shot and the way of holding the weapon are discussed.

  2. Effect of Soybeans on Hot Flashes in Postmenopausal Women

    Directory of Open Access Journals (Sweden)

    H Mozaffari-khosravi

    2009-10-01

    Full Text Available Introduction: Hot flashes are common and discomfortable signs of menopause that present with blazing sweatiness, sense of hotness, tachycardia and agitation. Hot flashes cause disturbances in daily activity and quality of night sleep. In spite of the effect of Hormone Replacement Therapy (HRT on hot flashes, nowadays, there are diverse opinions about HRT and the reason is that it has chronic complications. In addition, the acceptance of HRT by Iranian women is very low. Study of numerous texts has shown that isofliavone present in soybean is a phytoestrogen that could be effective in control of hot flashes. The purpose of the study is to examine the changes in time periods of hot flashes in response to consumption of 74 mg Isoflavone/day present in 60 grams soybeans in menopausal women. Methods: This study was a clinical trial with before and after design that included 31 postmenopausal women. The participants were assessed with respect to daily hot flashes at baseline and after one, two and three months of intervention. Participants consumed daily 60 grams soybeans for 3 months. Blood samples were taken at the start and end of intervention for determining levels of gonadotropins and estradiol. Data was analyzed by SPSS software. Results: There was a decrease in time period of hot flashes from baseline of 5.88±2.61 to 3.45±1.82 after one month, 2.73±1.57 after two months and 2.16±1.48 after three months of consumption of soybeans (P<0.001. There was decrease in levels of FSH, LH & estradiol after 3 months, but this decrease was not significant, except in the case of estradiol. Conclusion: In line with various studies proposing the use of soybeans in the form of concentrate, drink or capsule, this study suggests that consumption of soybeans (60 gr daily as snacks may be a safe and effective method for controlling hot flashes in postmenopausal women..

  3. Early hCG addition to rFSH for ovarian stimulation in IVF provides better results and the cDNA copies of the hCG receptor may be an indicator of successful stimulation

    Directory of Open Access Journals (Sweden)

    Paraskevis Dimitris

    2009-10-01

    Full Text Available Abstract A simple, safe and cost-effective treatment protocol in ovarian stimulation is of great importance in IVF practice, especially in the case of previous unsuccessful attempts. hCG has been used as a substitute of LH because of the degree of homology between the two hormones. The main aim of this prospective randomized study was to determine, for the first time, whether low dose hCG added to rFSH for ovarian stimulation could produce better results compared to the addition of rLH in women entering IVF-ET, especially in those women that had previous IVF failures. An additional aim was to find an indicator that would allow us to follow-up ovarian stimulation and, possibly, modify it in order to achieve a better IVF outcome; and that indicator may be the cDNA copies of the LH/hCG receptor. Group A patients (n = 58 were administered hCG and Group B rLH (n = 56 in addition to rFSH in the first days of ovarian stimulation. The number of follicles and oocytes and, most importantly, implantation and pregnancy rates were shown to be statistically significantly higher in the hCG group. This study has also determined, for the first time to our best knowledge, m-RNA for LH/hCG receptors in the lymphocytes of peripheral blood 40 h before ovum pick-up. cDNA levels of the hCG receptor after ovarian stimulation were significantly higher among women receiving hCG compared to those receiving LH. In addition, higher levels were encountered among women with pregnancy compared to those without, although this was not statistically significant due to the small number of pregnancies. It seems that hCG permits a highly effective and more stable occupancy of rLH/hCG receptors and gives more follicles and more oocytes. The determination of cDNA copies could be, in the future, a marker during ovulation induction protocols and of course a predictor for the outcome of ART in the special subgroup of patients with previous failures.

  4. Presence of a consensus DNA motif at nearby DNA sequence of the mutation susceptible CG nucleotides.

    Science.gov (United States)

    Chowdhury, Kaushik; Kumar, Suresh; Sharma, Tanu; Sharma, Ankit; Bhagat, Meenakshi; Kamai, Asangla; Ford, Bridget M; Asthana, Shailendra; Mandal, Chandi C

    2018-01-10

    Complexity in tissues affected by cancer arises from somatic mutations and epigenetic modifications in the genome. The mutation susceptible hotspots present within the genome indicate a non-random nature and/or a position specific selection of mutation. An association exists between the occurrence of mutations and epigenetic DNA methylation. This study is primarily aimed at determining mutation status, and identifying a signature for predicting mutation prone zones of tumor suppressor (TS) genes. Nearby sequences from the top five positions having a higher mutation frequency in each gene of 42 TS genes were selected from a cosmic database and were considered as mutation prone zones. The conserved motifs present in the mutation prone DNA fragments were identified. Molecular docking studies were done to determine putative interactions between the identified conserved motifs and enzyme methyltransferase DNMT1. Collective analysis of 42 TS genes found GC as the most commonly replaced and AT as the most commonly formed residues after mutation. Analysis of the top 5 mutated positions of each gene (210 DNA segments for 42 TS genes) identified that CG nucleotides of the amino acid codons (e.g., Arginine) are most susceptible to mutation, and found a consensus DNA "T/AGC/GAGGA/TG" sequence present in these mutation prone DNA segments. Similar to TS genes, analysis of 54 oncogenes not only found CG nucleotides of the amino acid Arg as the most susceptible to mutation, but also identified the presence of similar consensus DNA motifs in the mutation prone DNA fragments (270 DNA segments for 54 oncogenes) of oncogenes. Docking studies depicted that, upon binding of DNMT1 methylates to this consensus DNA motif (C residues of CpG islands), mutation was likely to occur. Thus, this study proposes that DNMT1 mediated methylation in chromosomal DNA may decrease if a foreign DNA segment containing this consensus sequence along with CG nucleotides is exogenously introduced to dividing

  5. Flash flood disasters analysis and evaluation: a case study of Yiyang County in China

    Science.gov (United States)

    Li, Haichen; Zhang, Xiaolei; Li, Qing; Qin, Tao; Lei, Xiaohui

    2018-03-01

    Global climate change leads to the more extreme precipitation and more flash flood disasters, which is a serious threat to the mountain inhabitants. To prevent flash flood disasters, China started flash flood disaster control planning and other projects from 2006. Among those measures, non-engineering measures are effective and economical. This paper introduced the framework of flash flood disaster analysis and evaluation in China, followed by a case study of Yiyang County.

  6. Steroids in porcine follicular fluid: analysis by HPLC, capillary CG and capillary CG/MS after purification on SEP-PAK C18 and ion exchange chromatography.

    Science.gov (United States)

    Khalil, M W; Lawson, V

    1983-04-01

    Steroids in porcine follicular fluid have been concentrated by reverse phase chromatography in SEP-PAK C18 and purified further on the cation exchanger SP-Sephadex C-25. Fractionation into unconjugated neutral and phenolic steroids, glucuronides and sulfates was carried out on triethylaminohydroxypropyl Sephadex LH-20 (TEAP-LH-20). The unconjugated neutral fraction was analysed by high pressure liquid chromatography (HPLC) on a C18 radial cartridge 5 mm I.D.; 10 mu, or on a C18 5 mu RESOLVE column, and by capillary gas chromatography (GC) on a 12 M OV-1 cross linked fused silica column. Testosterone, progesterone and androstenedione were the major steroids detected by HPLC monitored at 254 nm, although 17- hydroxy-, 20 alpha-dihydro- and 20 beta-dihydroprogesterone were also present. Pregnenolone, pregnanediol, dehydroepiandrosterone, 17-hydroxypregnenolone and androsterone were detected by capillary CG as their 0-methyloxime trimethylsilyether derivatives. Further confirmation of structure was provided by complete mass spectral data or by selective ion monitoring (SIM).

  7. AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner

    International Nuclear Information System (INIS)

    Liu, Xin; Zhu, Yanming; Zhai, Hong; Cai, Hua; Ji, Wei; Luo, Xiao; Li, Jing; Bai, Xi

    2012-01-01

    Highlights: ► AtPP2CG1 positively regulates salt tolerance in ABA-dependent manner. ► AtPP2CG1 up-regulates the expression of marker genes in different pathways. ► AtPP2CG1 expresses in the vascular system and trichomes of Arabidopsis. -- Abstract: AtPP2CG1 (Arabidopsis thaliana protein phosphatase 2C G Group 1) was predicted as an abiotic stress candidate gene by bioinformatic analysis in our previous study. The gene encodes a putative protein phosphatase 2C that belongs to Group G of PP2C. There is no report of Group G genes involved in abiotic stress so far. Real-time RT-PCR analysis showed that AtPP2CG1 expression was induced by salt, drought, and abscisic acid (ABA) treatment. The expression levels of AtPP2CG1 in the ABA synthesis-deficient mutant abi2–3 were much lower than that in WT plants under salt stress suggesting that the expression of AtPP2CG1 acts in an ABA-dependent manner. Over-expression of AtPP2CG1 led to enhanced salt tolerance, whereas its loss of function caused decreased salt tolerance. These results indicate that AtPP2CG1 positively regulates salt stress in an ABA-dependent manner. Under salt treatment, AtPP2CG1 up-regulated the expression levels of stress-responsive genes, including RD29A, RD29B, DREB2A and KIN1. GUS activity was detected in roots, leaves, stems, flower, and trichomes of AtPP2CG1 promoter–GUS transgenic plants. AtPP2CG1 protein was localized in nucleus and cytoplasm via AtPP2CG1:eGFP and YFP:AtPP2CG1 fusion approaches.

  8. Viewing MORSE-CG radiation transport with 3-D color graphics

    International Nuclear Information System (INIS)

    Namito, Yoshihito; Jenkins, T.M.; Nelson, W.R.

    1990-01-01

    In this paper we present the coupling of MORSE-CG with the SLAC Unified Graphics System (UGS77) through an add-on package called MORSGRAF which allows for real-time display of neutron and photon tracks in the Monte Carlo simulation. In addition to displaying the myriad of complicated geometries that can be created with the MORSE Combinatorial Geometry program, MORSGRAF permits color tagging of neutrons (green) and photons (red) with the variation of track intensity an indicator of the energy of the particle. Particle types can be switched off and on by means of a mouse-icon system, and the perspective can be changed (i.e., rotated, translated, and zoomed). MORSGRAF also allows one to display the propagation of radiation through shields and mazes on an ordinary graphics terminal, as well as in documents printed on a laser printer. Several examples will be given to demonstrate the various capabilities of MORSGRAF coupled to MORSE-CG. 12 refs., 8 figs

  9. 49 CFR 234.253 - Flashing light units and lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...

  10. Flash floods warning technique based on wireless communication networks data

    Science.gov (United States)

    David, Noam; Alpert, Pinhas; Messer, Hagit

    2010-05-01

    Flash floods can occur throughout or subsequent to rainfall events, particularly in cases where the precipitation is of high-intensity. Unfortunately, each year these floods cause severe property damage and heavy casualties. At present, there are no sufficient real time flash flood warning facilities found to cope with this phenomenon. Here we show the tremendous potential of flash floods advanced warning based on precipitation measurements of commercial microwave links. As was recently shown, wireless communication networks supply high resolution precipitation measurements at ground level while often being situated in flood prone areas, covering large parts of these hazardous regions. We present the flash flood warning potential of the wireless communication system for two different cases when floods occurred at the Judean desert and at the northern Negev in Israel. In both cases, an advanced warning regarding the hazard could have been announced based on this system. • This research was supported by THE ISRAEL SCIENCE FOUNDATION (grant No. 173/08). This work was also supported by a grant from the Yeshaya Horowitz Association, Jerusalem. Additional support was given by the PROCEMA-BMBF project and by the GLOWA-JR BMBF project.

  11. Delays due to gas diffusion in flash boiling nucleation

    International Nuclear Information System (INIS)

    Hanbury, W.T.; McCartney, W.S.

    1976-01-01

    A theoretical model to account for the time delay between decompression and nucleation in flash boiling is presented and analyzed. It shows that gas diffusion can be responsible for delayed nucleation when the critical radius for nucleation and the suspended particle size are of the same order of magnitude

  12. Hot Flashes and Quality of Life among Breast Cancer Patients

    National Research Council Canada - National Science Library

    Jacobs, Linda A

    2005-01-01

    ... (CAM) interventions used by them. Women are assessed for hot flash intensity/frequency, use of medical and CAM interventions, emotional distress, physical and social functioning, and QoL at diagnosis and at 6, 9, 12, 15, and 18 months...

  13. RAND-Based Formulations for Isothermal Multiphase Flash

    DEFF Research Database (Denmark)

    Paterson, Duncan; Michelsen, Michael L.; Stenby, Erling H.

    2018-01-01

    Two algorithms are proposed for isothermal multiphase flash. These are referred to as modified RAND and vol-RAND. The former uses the chemical potentials and molar-phase amounts as the iteration variables, while the latter uses chemical potentials and phase volumes to cosolve a pressure...

  14. Reduced order modeling of flashing two-phase jets

    Energy Technology Data Exchange (ETDEWEB)

    Gurecky, William, E-mail: william.gurecky@utexas.edu; Schneider, Erich, E-mail: eschneider@mail.utexas.edu; Ballew, Davis, E-mail: davisballew@utexas.edu

    2015-12-01

    Highlights: • Accident simulation requires ability to quickly predict two-phase flashing jet's damage potential. • A reduced order modeling methodology informed by experimental or computational data is described. • Zone of influence volumes are calculated for jets of various upstream thermodynamic conditions. - Abstract: In the event of a Loss of Coolant Accident (LOCA) in a pressurized water reactor, the escaping coolant produces a highly energetic flashing jet with the potential to damage surrounding structures. In LOCA analysis, the goal is often to evaluate many break scenarios in a Monte Carlo style simulation to evaluate the resilience of a reactor design. Therefore, in order to quickly predict the damage potential of flashing jets, it is of interest to develop a reduced order model that relates the damage potential of a jet to the pressure and temperature upstream of the break and the distance from the break to a given object upon which the jet is impinging. This work presents framework for producing a Reduced Order Model (ROM) that may be informed by measured data, Computational Fluid Dynamics (CFD) simulations, or a combination of both. The model is constructed by performing regression analysis on the pressure field data, allowing the impingement pressure to be quickly reconstructed for any given upstream thermodynamic condition within the range of input data. The model is applicable to both free and fully impinging two-phase flashing jets.

  15. Bio-oil from Flash Pyrolysis of Agricultural Residues

    DEFF Research Database (Denmark)

    Ibrahim, Norazana

    This thesis describes the production of bio-oils from flash pyrolysis of agricultural residues, using a pyrolysis centrifugal reactor (PCR). By thermal degradation of agricultural residues in the PCR, a liquid oil, char and non-condensable gases are produced. The yield of each fraction...

  16. Flash chemistry: flow chemistry that cannot be done in batch.

    Science.gov (United States)

    Yoshida, Jun-ichi; Takahashi, Yusuke; Nagaki, Aiichiro

    2013-11-04

    Flash chemistry based on high-resolution reaction time control using flow microreactors enables chemical reactions that cannot be done in batch and serves as a powerful tool for laboratory synthesis of organic compounds and for production in chemical and pharmaceutical industries.

  17. Implementation of Power Efficient Flash Analogue-to-Digital Converter

    Directory of Open Access Journals (Sweden)

    Taninki Sai Lakshmi

    2014-01-01

    Full Text Available An efficient low power high speed 5-bit 5-GS/s flash analogue-to-digital converter (ADC is proposed in this paper. The designing of a thermometer code to binary code is one of the exacting issues of low power flash ADC. The embodiment consists of two main blocks, a comparator and a digital encoder. To reduce the metastability and the effect of bubble errors, the thermometer code is converted into the gray code and there after translated to binary code through encoder. The proposed encoder is thus implemented by using differential cascade voltage switch logic (DCVSL to maintain high speed and low power dissipation. The proposed 5-bit flash ADC is designed using Cadence 180 nm CMOS technology with a supply rail voltage typically ±0.85 V. The simulation results include a total power dissipation of 46.69 mW, integral nonlinearity (INL value of −0.30 LSB and differential nonlinearity (DNL value of −0.24 LSB, of the flash ADC.

  18. Update on The Ultra-Fast Flash Observatory (UFFO) Pathfinder

    DEFF Research Database (Denmark)

    Grossan, B.; Brandt, Søren; Budtz-Jørgensen, Carl

    2011-01-01

    The Ultra-Fast Flash Observatory (UFFO) uses an X/gamma and an optical/UV instrument to observe gamma-ray bursts (GRB) starting milliseconds after burst trigger and location. The X/gamma instrument, a standard coded-mask camera, locates the GRB and triggers the system. The optical/UV instrument, ...

  19. The Status of the Ultra Fast Flash Observatory - Pathfinder

    DEFF Research Database (Denmark)

    Nam, J. W.; Ahmad, S.; Ahn, K. B.

    2014-01-01

    The Ultra Fast Flash Observatory (UFFO) is a project to study early optical emissions from Gamma Ray Bursts (GRBs). The primary scientific goal of UFFO is to see if GRBs can be calibrated with their rising times, so that they could be used as new standard candles. In order to minimize delay in op...

  20. Continuous Flash Suppression: Stimulus Fractionation rather than Integration.

    Science.gov (United States)

    Moors, Pieter; Hesselmann, Guido; Wagemans, Johan; van Ee, Raymond

    2017-10-01

    Recent studies using continuous flash suppression suggest that invisible stimuli are processed as integrated, semantic entities. We challenge the viability of this account, given recent findings on the neural basis of interocular suppression and replication failures of high-profile CFS studies. We conclude that CFS reveals stimulus fractionation in visual cortex. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Flash release an alternative for releasing complex MEMS devices

    NARCIS (Netherlands)

    Deladi, S.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    2004-01-01

    A novel time-saving and cost-effective release technique has been developed and is described. The physical nature of the process is explained in combination with experimental observations. The results of the flash release process are compared with those of freeze-drying and supercritical CO2

  2. High-frequency Trading, Algorithmic Finance, and the Flash Crash

    DEFF Research Database (Denmark)

    Borch, Christian

    2016-01-01

    The Flash Crash of 6 May 2010 has an interesting status in discussions of high-frequency trading, i.e. fully automated, superfast computerized trading: it is invoked both as an important illustration of how this field of algorithmic trading operates and, more often, as an example of how fully aut...... about resonance in quantitative finance....

  3. Recovery of Flash Memories for Reliable Mobile Storages

    Directory of Open Access Journals (Sweden)

    Daesung Moon

    2010-01-01

    Full Text Available As the mobile appliance is applied to many ubiquitous services and the importance of the information stored in it is increased, the security issue to protect the information becomes one of the major concerns. However, most previous researches focused only on the communication security, not the storage security. Especially, a flash memory whose operational characteristics are different from those of HDD is used increasingly as a storage device for the mobile appliance because of its resistance to physical shock and lower power requirement. In this paper, we propose a flash memory management scheme targeted for guaranteeing the data integrity of the mobile storage. By maintaining the old data specified during the recovery window, we can recover the old data when the mobile appliance is attacked. Also, to reduce the storage requirement for the recovery, we restrict the number of versions to be copied, called Degree of Integrity (DoI. Especially, we consider both the reclaim efficiency and the wear leveling which is a unique characteristic of the flash memory. Based on the performance evaluation, we confirm that the proposed scheme can be acceptable to many applications as a flash memory management scheme for improving data integrity.

  4. Collecting response times using Amazon Mechanical Turk and Adobe Flash.

    Science.gov (United States)

    Simcox, Travis; Fiez, Julie A

    2014-03-01

    Crowdsourcing systems like Amazon's Mechanical Turk (AMT) allow data to be collected from a large sample of people in a short amount of time. This use has garnered considerable interest from behavioral scientists. So far, most experiments conducted on AMT have focused on survey-type instruments because of difficulties inherent in running many experimental paradigms over the Internet. This study investigated the viability of presenting stimuli and collecting response times using Adobe Flash to run ActionScript 3 code in conjunction with AMT. First, the timing properties of Adobe Flash were investigated using a phototransistor and two desktop computers running under several conditions mimicking those that may be present in research using AMT. This experiment revealed some strengths and weaknesses of the timing capabilities of this method. Next, a flanker task and a lexical decision task implemented in Adobe Flash were administered to participants recruited with AMT. The expected effects in these tasks were replicated. Power analyses were conducted to describe the number of participants needed to replicate these effects. A questionnaire was used to investigate previously undescribed computer use habits of 100 participants on AMT. We conclude that a Flash program in conjunction with AMT can be successfully used for running many experimental paradigms that rely on response times, although experimenters must understand the limitations of the method.

  5. Visual reinforcement audiometry: an Adobe Flash based approach.

    Science.gov (United States)

    Atherton, Steve

    2010-09-01

    Visual Reinforcement Audiometry (VRA) is a key behavioural test for young children. It is central to the diagnosis of hearing-impaired infants (1) . Habituation to the visual reinforcement can give misleading results. Medical Illustration ABM University Health Board has designed a collection of Flash animations to overcome this.

  6. Effects of eCG and progesterone on superovulation and embryo production in wood bison (Bison bison athabascae).

    Science.gov (United States)

    Palomino, J Manuel; Cervantes, Miriam P; Woodbury, Murray R; Mapletoft, Reuben J; Adams, Gregg P

    2017-06-01

    Experiments were done to determine if inclusion of eCG and progesterone in the superstimulation protocol will increase the ovarian response and embryo production in wood bison, and to provide preliminary information regarding the effect of season. In Experiment 1 (anovulatory season), bison (n=26) were synchronized by follicular ablation (Day -1) and given FSH on Days 0 and 2, and assigned to 3 groups: Progesterone (Days 0-4), eCG (Day 3), or progesterone+eCG. On Day 5, bison were given hCG and inseminated 12 and 24h later. Ova/embryos were collected 8days after hCG. In Experiment 2 (ovulatory season), bison (n=24) were synchronized and assigned randomly to two groups in which superstimulation was induced with FSH, either with or without eCG, as in Experiment 1. No differences among groups were found in ovarian response or embryo production in either experiment. The follicular count at wave emergence was positively correlated with the number of large follicles at the end of superstimulation in all groups. A significantly greater number of follicles present at wave emergence in the anovulatory vs. ovulatory season was associated with a greater number of CL at the time of embryo collection, but only half the number of freezable embryos. In conclusion, the number of transferable embryos collected (1-2/bison) was higher than in any previous report, but was not attributable to the inclusion of eCG or progesterone in the superovulatory protocol. The apparent effect of season on oocyte competence, and not superovulatory response, is worthy of further investigation. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Machine protection for FLASH and the European XFEL

    Energy Technology Data Exchange (ETDEWEB)

    Froehlich, Lars

    2009-05-15

    The Free-Electron Laser in Hamburg (FLASH) and the future European X-Ray Free-Electron Laser (XFEL) are sources of brilliant extremeultraviolet and X-ray radiation pulses. Both facilities are based on superconducting linear accelerators (linacs) that can produce and transport electron beams of high average power. With up to 90 kW or up to 600 kW of power, respectively, these beams hold a serious potential to damage accelerator components. This thesis discusses several passive and active machine protection measures needed to ensure safe operation. At FLASH, dark current from the rf gun electron source has activated several accelerator components to unacceptable radiation levels. Its transport through the linac is investigated with detailed tracking simulations using a parallelized and enhanced version of the tracking code Astra; possible remedies are evaluated. Beam losses can lead to the demagnetization of permanent magnet insertion devices. A number of beam loss scenarios typical for FLASH are investigated with shower simulations. A shielding setup is designed and its efficiency is evaluated. For the design parameters of FLASH, it is concluded that the average relative beam loss in the undulators must be controlled to a level of about 10{sup -8}. FLASH is equipped with an active machine protection system (MPS) comprising more than 80 photomultiplier-based beam loss monitors and several subsystems. The maximum response time to beam losses is less than 4 {mu}s. Setup procedures and calibration algorithms for MPS subsystems and components are introduced and operational problems are addressed. Finally, an architecture for a fully programmable machine protection system for the XFEL is presented. Several options for the topology of this system are reviewed, with the result that an availability goal of at least 0.999 for the MPS is achievable with moderate hardware requirements. (orig.)

  8. Machine protection for FLASH and the European XFEL

    International Nuclear Information System (INIS)

    Froehlich, Lars

    2009-05-01

    The Free-Electron Laser in Hamburg (FLASH) and the future European X-Ray Free-Electron Laser (XFEL) are sources of brilliant extremeultraviolet and X-ray radiation pulses. Both facilities are based on superconducting linear accelerators (linacs) that can produce and transport electron beams of high average power. With up to 90 kW or up to 600 kW of power, respectively, these beams hold a serious potential to damage accelerator components. This thesis discusses several passive and active machine protection measures needed to ensure safe operation. At FLASH, dark current from the rf gun electron source has activated several accelerator components to unacceptable radiation levels. Its transport through the linac is investigated with detailed tracking simulations using a parallelized and enhanced version of the tracking code Astra; possible remedies are evaluated. Beam losses can lead to the demagnetization of permanent magnet insertion devices. A number of beam loss scenarios typical for FLASH are investigated with shower simulations. A shielding setup is designed and its efficiency is evaluated. For the design parameters of FLASH, it is concluded that the average relative beam loss in the undulators must be controlled to a level of about 10 -8 . FLASH is equipped with an active machine protection system (MPS) comprising more than 80 photomultiplier-based beam loss monitors and several subsystems. The maximum response time to beam losses is less than 4 μs. Setup procedures and calibration algorithms for MPS subsystems and components are introduced and operational problems are addressed. Finally, an architecture for a fully programmable machine protection system for the XFEL is presented. Several options for the topology of this system are reviewed, with the result that an availability goal of at least 0.999 for the MPS is achievable with moderate hardware requirements. (orig.)

  9. Flashing liquid jets and two-phase droplet dispersion

    International Nuclear Information System (INIS)

    Cleary, Vincent; Bowen, Phil; Witlox, Henk

    2007-01-01

    The large-scale release of a liquid contained at upstream conditions above its local atmospheric boiling point is a scenario often given consideration in process industry risk analysis. Current-hazard quantification software often employs simplistic equilibrium two-phase approaches. Scaled water experiments have been carried out measuring droplet velocity and droplet size distributions for a range of exit orifice aspect ratios (L/d) and conditions representing low to high superheat. 2D Phase-Doppler Anemometry has been utilised to characterise droplet kinematics and spray quality. Droplet size correlations have been developed for non-flashing, the transition between non-flashing and flashing, and fully flashing jets. Using high-speed shadowography, transition between regimes is defined in terms of criteria identified in the external flow structure. An overview companion paper provides a wider overview of the problem and reports implementation of these correlations into consequence models and subsequent validation. The fluid utilised throughout is water, hence droplet correlations are developed in non-dimensional form to allow extrapolation to other fluids through similarity scaling, although verification of model performance for other fluids is required in future studies. Data is reduced via non-dimensionalisation in terms of the Weber number and Jakob number, essentially representing the fluid mechanics and thermodynamics of the system, respectively. A droplet-size distribution correlation has also been developed, conveniently presented as a volume undersize distribution based on the Rosin-Rammler distribution. Separate correlations are provided for sub-cooled mechanical break-up and fully flashing jets. This form of correlation facilitates rapid estimates of likely mass rainout quantities, as well as full distribution information for more rigorous two-phase thermodynamic modelling in the future

  10. On the chlorophill a fluorescence yield in chloroplasts upon excitation with twin turnover flashes (TTF) and high frequency flash trains

    NARCIS (Netherlands)

    Vredenberg, W.J.; Prasil, O.; Durchan, M.

    2007-01-01

    Chlorophyll fluorescence is routinely taken as a quantifiable measure of the redox state of the primary quinone acceptor QA of PSII. The variable fluorescence in thylakoids increases in a single turnover flash (STF) from its low dark level F o towards a maximum F mSTF when QA becomes reduced. We

  11. Menopausal Hot Flashes and Carotid Intima Media Thickness Among Midlife Women.

    Science.gov (United States)

    Thurston, Rebecca C; Chang, Yuefang; Barinas-Mitchell, Emma; Jennings, J Richard; Landsittel, Doug P; Santoro, Nanette; von Känel, Roland; Matthews, Karen A

    2016-12-01

    There has been a longstanding interest in the role of menopause and its correlates in the development of cardiovascular disease (CVD) in women. Menopausal hot flashes are experienced by most midlife women; emerging data link hot flashes to CVD risk indicators. We tested whether hot flashes, measured via state-of-the-art physiologic methods, were associated with greater subclinical atherosclerosis as assessed by carotid ultrasound. We considered the role of CVD risk factors and estradiol concentrations in these associations. A total of 295 nonsmoking women free of clinical CVD underwent ambulatory physiologic hot flash assessments; a blood draw; and carotid ultrasound measurement of intima media thickness and plaque. Associations between hot flashes and subclinical atherosclerosis were tested in regression models controlling for CVD risk factors and estradiol. More frequent physiologic hot flashes were associated with higher carotid intima media thickness (for each additional hot flash: β [SE]=0.004 [0.001]; P=0.0001; reported hot flash: β [SE]=0.008 [0.002]; P=0.002, multivariable) and plaque (eg, for each additional hot flash, odds ratio [95% confidence interval] plaque index ≥2=1.07 [1.003-1.14]; P=0.04, relative to no plaque, multivariable] among women reporting daily hot flashes; associations were not accounted for by CVD risk factors or by estradiol. Among women reporting hot flashes, hot flashes accounted for more variance in intima media thickness than most CVD risk factors. Among women reporting daily hot flashes, frequent hot flashes may provide information about a woman's vascular status beyond standard CVD risk factors and estradiol. Frequent hot flashes may mark a vulnerable vascular phenotype among midlife women. © 2016 American Heart Association, Inc.

  12. Spatial-temporal characteristics of lightning flash size in a supercell storm

    Science.gov (United States)

    Zhang, Zhixiao; Zheng, Dong; Zhang, Yijun; Lu, Gaopeng

    2017-11-01

    The flash sizes of a supercell storm, in New Mexico on October 5, 2004, are studied using the observations from the New Mexico Lightning Mapping Array and the Albuquerque, New Mexico, Doppler radar (KABX). First, during the temporal evolution of the supercell, the mean flash size is anti-correlated with the flash rate, following a unary power function, with a correlation coefficient of - 0.87. In addition, the mean flash size is linearly correlated with the area of reflectivity > 30 dBZ at 5 km normalized by the flash rate, with a correlation coefficient of 0.88. Second, in the horizontal, flash size increases along the direction from the region near the convection zone to the adjacent forward anvil. The region of minimum flash size usually corresponds to the region of maximum flash initiation and extent density. The horizontal correspondence between the mean flash size and the flash extent density can also be fitted by a unary power function, and the correlation coefficient is > 0.5 in 50% of the radar volume scans. Furthermore, the quality of fit is positively correlated to the convective intensity. Third, in the vertical direction, the height of the maximum flash initiation density is close to the height of maximum flash extent density, but corresponds to the height where the mean flash size is relatively small. In the discussion, the distribution of the small and dense charge regions when and where convection is vigorous in the storm, is deduced to be responsible for the relationship that flash size is temporally and spatially anti-correlated with flash rate and density, and the convective intensity.

  13. Association between resistin promoter -420C>G polymorphisms and producing ability with type 2 diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Kuo-Ting Ho

    2017-11-01

    Full Text Available Elevated resistin levels and the polymorphisms located at gene encoding resistin (RETN are associated with diabetic pathogenesis. However, the correlation between RETN genotypes and T2DM is controversial due to discrepancies among reports. This study aimed at investigating and clarifying the putative association of RETN and T2DM in Taiwanese population. The resistin levels and RETN -420C>G genotypes in 244 control and 305 T2DM subjects were examined. Meanwhile, the association between genetic polymorphism of RETN -420C>G and resistin levels, as well as between RETN -420C>G and subjects’ clinical characteristics was statistically analyzed. The RETN -420C>G genotypes (p = 0.01 and G allele (p = 0.002 were significantly associated with T2DM. In addition, concanavalin A-stimulated peripheral blood mononuclear cells from T2DM subjects had higher resistin-secreting ability (p = 0.044. Nevertheless, no significant association between the subjects’ biochemical data and RETN -420 SNPs was found. Our results indicate that RETN -420C>G SNPs and G allele are significantly associated with T2DM. Investigation of RETN polymorphisms in T2DM patients from various ethnic populations are crucial and will contribute to the understanding of this gene in the diabetic etiology. The present results may contribute to gain knowledge on the complex genetic heterogeneity of type 2 diabetes.

  14. Extending the eigCG algorithm to nonsymmetric Lanczos for linear systems with multiple right-hand sides

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Rehim, A M; Stathopoulos, Andreas; Orginos, Kostas

    2014-08-01

    The technique that was used to build the EigCG algorithm for sparse symmetric linear systems is extended to the nonsymmetric case using the BiCG algorithm. We show that, similarly to the symmetric case, we can build an algorithm that is capable of computing a few smallest magnitude eigenvalues and their corresponding left and right eigenvectors of a nonsymmetric matrix using only a small window of the BiCG residuals while simultaneously solving a linear system with that matrix. For a system with multiple right-hand sides, we give an algorithm that computes incrementally more eigenvalues while solving the first few systems and then uses the computed eigenvectors to deflate BiCGStab for the remaining systems. Our experiments on various test problems, including Lattice QCD, show the remarkable ability of EigBiCG to compute spectral approximations with accuracy comparable to that of the unrestarted, nonsymmetric Lanczos. Furthermore, our incremental EigBiCG followed by appropriately restarted and deflated BiCGStab provides a competitive method for systems with multiple right-hand sides.

  15. Amphiregulin mediates hCG-induced StAR expression and progesterone production in human granulosa cells.

    Science.gov (United States)

    Fang, Lanlan; Yu, Yiping; Zhang, Ruizhe; He, Jingyan; Sun, Ying-Pu

    2016-04-26

    Progesterone plays critical roles in maintaining a successful pregnancy at the early embryonic stage. Human chorionic gonadotropin (hCG) rapidly induces amphiregulin (AREG) expression. However, it remains unknown whether AREG mediates hCG-induced progesterone production. Thus, the objective of this study was to investigate the role of AREG in hCG-induced progesterone production and the underlying molecular mechanism in human granulosa cells; primary cells were used as the experimental model. We demonstrated that the inhibition of EGFR and the knockdown of AREG abolished hCG-induced steroidogenic acute regulatory protein (StAR) expression and progesterone production. Importantly, follicular fluid AREG levels were positively correlated with progesterone levels in the follicular fluid and serum. Treatment with AREG increased StAR expression and progesterone production, and these stimulatory effects were abolished by EGFR inhibition. Moreover, activation of ERK1/2, but not PI3K/Akt, signaling was required for the AREG-induced up-regulation of StAR expression and progesterone production. Our results demonstrate that AREG mediates hCG-induced StAR expression and progesterone production in human granulosa cells, providing novel evidence for the role of AREG in the regulation of steroidogenesis.

  16. Distinct responses of human granulosa lutein cells after hCG or LH stimulation in a spheroidal cell culture system.

    Science.gov (United States)

    Becker, Julia; Walz, Andrea; Daube, Stefanie; Keck, Christoph; Pietrowski, Detlef

    2007-10-01

    The growth and development of the corpus luteum (CL) is regulated by gonadotropic hormones. It is formed by granulosa cells (GCs), theca cells, and endothelial cells, and is the primary source of circulating progesterone. During early pregnancy only human chorionic gonadotropin (hCG) but not luteinizing hormone (LH) extends the life span of the CL, although hCG and LH interact with the same receptor and have similar actions on the CL. In this study a recently by our group established spheroidal GC culture assay served as a model of CL development on which we compared the actions of the gonadotropic hormones LH and hCG. To find out which signal pathways take part in the hormonal regulation of GC we stimulated GC-spheroids with modulators of protein kinases A and C dependent signaling cascades and determined their impact on sprout forming activity in GC. Our results indicate that PKA-dependent signaling pathways play a major role in mediating the hormonal-induced signaling cascades leading to sprouting in GC. Furthermore, this study strongly indicates that the different effects of hCG and LH in the maintenance of the CL may be reasoned in different signal transduction pathways triggered by hCG or LH. (c) 2007 Wiley-Liss, Inc.

  17. An unusual characteristic “flower-like” pattern: flash suppressor burns

    OpenAIRE

    Gurcan, Altun

    2012-01-01

    The case on contact shots from firearms with a flash suppressor is rare. When a rifle fitted with a flash suppressor is fired, the emerging soot-laden gas in the barrel escapes from the slits of the flash suppressor. If the shot is contact or near contact, the flash suppressor will produce a characteristic “flower-like” pattern of seared, blackened zones around the entrance. This paper presents the injury pattern of the flash suppressor in a 29-year-old man who committed suicide with a G3 aut...

  18. An unusual characteristic “flower-like” pattern: flash suppressor burns

    Science.gov (United States)

    Gurcan, Altun

    2012-01-01

    The case on contact shots from firearms with a flash suppressor is rare. When a rifle fitted with a flash suppressor is fired, the emerging soot-laden gas in the barrel escapes from the slits of the flash suppressor. If the shot is contact or near contact, the flash suppressor will produce a characteristic “flower-like” pattern of seared, blackened zones around the entrance. This paper presents the injury pattern of the flash suppressor in a 29-year-old man who committed suicide with a G3 automatic infantry rifle. PMID:23935280

  19. Professional Flash Mobile Development Creating Android and iPhone Applications

    CERN Document Server

    Wagner, Richard

    2010-01-01

    Professional Flash Mobile Development: Creating Android and iPhone ApplicationsEverything Flash developers need to know to create native Android and iPhone appsThis Wrox guide shows Flash developers how to create native applications for Android and iPhone mobile devices using Flash. Packed with practical examples, it shows how to build a variety of apps and integrate them with core mobile services such as Accelerometer, GPS, Photo Library,and more.Offers Flash developers the tools to create apps for the Android and iPhone mobile devicesSho

  20. Flash memory management system and method utilizing multiple block list windows

    Science.gov (United States)

    Chow, James (Inventor); Gender, Thomas K. (Inventor)

    2005-01-01

    The present invention provides a flash memory management system and method with increased performance. The flash memory management system provides the ability to efficiently manage and allocate flash memory use in a way that improves reliability and longevity, while maintaining good performance levels. The flash memory management system includes a free block mechanism, a disk maintenance mechanism, and a bad block detection mechanism. The free block mechanism provides efficient sorting of free blocks to facilitate selecting low use blocks for writing. The disk maintenance mechanism provides for the ability to efficiently clean flash memory blocks during processor idle times. The bad block detection mechanism provides the ability to better detect when a block of flash memory is likely to go bad. The flash status mechanism stores information in fast access memory that describes the content and status of the data in the flash disk. The new bank detection mechanism provides the ability to automatically detect when new banks of flash memory are added to the system. Together, these mechanisms provide a flash memory management system that can improve the operational efficiency of systems that utilize flash memory.

  1. Rhipicephalus (Boophilus microplus: expression and characterization of Bm86-CG in Pichia pastoris Rhipicephalus (Boophilus microplus: expressão e caracterização da Bm86-CG em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Rodrigo Casquero Cunha

    2011-06-01

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (GavacTM and TickGardPLUS that have been developed against cattle ticks. The subcloning was done in the pPIC9 expression vector, for transformation in the yeast Pichia pastoris. This protein was characterized by expression of the recombinant Mut+ strain, which expressed greater quantities of protein. The expressed protein (rBm86-CG was recognized in the Western-blot assay using anti-Gavac, anti-TickGard, anti-larval extract and anti-rBm86-CG polyclonal sera. The serum produced in cattle vaccinated with the antigen CG rBm86 presented high antibody titers and recognized the native protein. The rBm86-GC has potential relevance as an immunogen for vaccine formulation against cattle ticks.O carrapato-do-boi Rhipicephalus (Boophilus microplus é responsável por grandes perdas econômicas. Seu controle é principalmente químico e apresenta limitações quanto ao desenvolvimento de resistência aos princípios ativos. As vacinas podem auxiliar no controle deste parasita diminuindo as aplicações de carrapaticidas. Considerando isso, foi realizada a subclonagem do gene da proteína Bm86-CG, proteína homologa a que atualmente é a base das vacinas desenvolvidas (GavacTM e TickGardPLUS contra o carrapato-do-boi, no vetor de expressão pPIC9, para ser transformado em levedura, Pichia pastoris. Esta proteína foi caracterizada pela expressão da cepa recombinante Mut+ que expressou maior quantidade de proteína. A proteína expressa, rBm86-CG, foi reconhecida no ensaio de Western-blot pelos soros policlonais anti-Gavac, anti-TickGard, anti

  2. PENGEMBANGAN EVALUASI PEMBELAJARAN BERBASIS MULTIMEDIA DENGAN FLASH, PHP, DAN MySQL

    Directory of Open Access Journals (Sweden)

    Hadi Sutopo

    2012-01-01

    Full Text Available Computer-Based Testing (CBT program was launched for years to give test takers the options of taking computerized version of test. The application which generates academic score is developed as a server-side with Adobe Flash. Flash is well known as a powerful and dynamic front-end for the Web. However, Flash is also great interface for server-side applications. PHP can launch server-side script using Flash as a front-end and pass variables back and forth between Flash and the PHP pages. Along with PHP, MySQL can be used to store data and later retrieve it. Using Flash as a front-end, data and variables are passed between the MySQL database, PHP, and Flash to enhance application's functionality in managing databases.

  3. Application of adobe flash media to optimize jigsaw learning model on geometry material

    Science.gov (United States)

    Imam, P.; Imam, S.; Ikrar, P.

    2018-05-01

    This study aims to determine and describe the effectiveness of the application of adobe flash media for jigsaw learning model on geometry material. In this study, the modified jigsaw learning with adobe flash media is called jigsaw-flash model. This research was conducted in Surakarta. The research method used is mix method research with exploratory sequential strategy. The results of this study indicate that students feel more comfortable and interested in studying geometry material taught by jigsaw-flash model. In addition, students taught using the jigsaw-flash model are more active and motivated than the students who were taught using ordinary jigsaw models. This shows that the use of the jigsaw-flash model can increase student participation and motivation. It can be concluded that the adobe flash media can be used as a solution to reduce the level of student abstraction in learning mathematics.

  4. Adobe Flash as a medium for online experimentation: a test of reaction time measurement capabilities.

    Science.gov (United States)

    Reimers, Stian; Stewart, Neil

    2007-08-01

    Adobe Flash can be used to run complex psychological experiments over the Web. We examined the reliability of using Flash to measure reaction times (RTs) using a simple binary-choice task implemented both in Flash and in a Linux-based system known to record RTs with millisecond accuracy. Twenty-four participants were tested in the laboratory using both implementations; they also completed the Flash version on computers of their own choice outside the lab. RTs from the trials run on Flash outside the lab were approximately 20 msec slower than those from trials run on Flash in the lab, which in turn were approximately 10 msec slower than RTs from the trials run on the Linux-based system (baseline condition). RT SDs were similar in all conditions, suggesting that although Flash may overestimate RTs slightly, it does not appear to add significant noise to the data recorded.

  5. Comparison of rapid descriptive sensory methodologies: Free-Choice Profiling, Flash Profile and modified Flash Profile.

    Science.gov (United States)

    Liu, Jing; Bredie, Wender L P; Sherman, Emma; Harbertson, James F; Heymann, Hildegarde

    2018-04-01

    Rapid sensory methods have been developed as alternatives to traditional sensory descriptive analysis methods. Among them, Free-Choice Profiling (FCP) and Flash Profile (FP) are two that have been known for many years. The objectives of this work were to compare the rating-based FCP and ranking-based FP method; to evaluate the impact of adding adjustments to FP approach; to investigate the influence of the number of assessors on the outcome of modified FP. To achieve these aims, a conventional descriptive analysis (DA), FCP, FP and a modified version of FP were carried out. Red wines made by different grape maturity and ethanol concentration were used for sensory testing. This study showed that DA provided a more detailed and accurate information on products through a quantitative measure of the intensity of sensory attributes than FCP and FP. However, the panel hours for conducting DA were higher than that for rapid methods, and FP was even able to separate the samples to a higher degree than DA. When comparing FCP and FP, this study showed that the ranking-based FP provided a clearer separation of samples than rating-based FCP, but the latter was an easier task for most assessors. When restricting assessors on their use of attributes in FP, the sample space became clearer and the ranking task was simplified. The FP protocol with restricted attribute sets seems to be a promising approach for efficient screening of sensory properties in wine. When increasing the number of assessors from 10 to 20 for conducting the modified FP, the outcome tended to be slightly more stable, however, one should consider the degree of panel training when deciding the optimal number of assessors for conducting FP. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. The Drosophila gene CG9918 codes for a pyrokinin-1 receptor

    DEFF Research Database (Denmark)

    Cazzamali, Giuseppe; Torp, Malene; Hauser, Frank

    2005-01-01

    The database from the Drosophila Genome Project contains a gene, CG9918, annotated to code for a G protein-coupled receptor. We cloned the cDNA of this gene and functionally expressed it in Chinese hamster ovary cells. We tested a library of about 25 Drosophila and other insect neuropeptides......, and seven insect biogenic amines on the expressed receptor and found that it was activated by low concentrations of the Drosophila neuropeptide, pyrokinin-1 (TGPSASSGLWFGPRLamide; EC50, 5 x 10(-8) M). The receptor was also activated by other Drosophila neuropeptides, terminating with the sequence PRLamide...... (Hug-gamma, ecdysis-triggering-hormone-1, pyrokinin-2), but in these cases about six to eight times higher concentrations were needed. The receptor was not activated by Drosophila neuropeptides, containing a C-terminal PRIamide sequence (such as ecdysis-triggering-hormone-2), or PRVamide (such as capa...

  7. Successful Pregnancy Outcome in Women with Recurrent IVF Failure and Anti-hCG Autoimmunity: A Report of Three Cases

    Directory of Open Access Journals (Sweden)

    Valeria Muller

    2016-01-01

    Full Text Available We report three cases of effective management of infertility in women with a history of repeated unsuccessful IVF attempts, who have developed antibodies to hCG. A novel approach to conservative treatment of immunologic reproductive failure, suggested for selected patients, included membrane plasmapheresis, combined prednisolone, and intravenous immunoglobulin therapy. No adverse side effects were observed; all cases resulted in pregnancy and subsequent life births. In order to be given an adequate efficient treatment, women with recurrent implantation failure should be suspected for autoimmune factor of infertility and its possible association with anti-hCG autoimmunity.

  8. Mechanistic model for void distribution in flashing flow

    International Nuclear Information System (INIS)

    Riznic, J.; Ishii, M.; Afgan, N.

    1987-01-01

    A problem of discharging of an initially subcooled liquid from a high pressure condition into a low pressure environment is quite important in several industrial systems such as nuclear reactors and chemical reactors. A new model for the flashing process is proposed here based on the wall nucleation theory, bubble growth model and drift-flux bubble transport model. In order to calculate the bubble number density, the bubble number transport equation with a distributed source from the wall nucleation sites is used. The model predictions in terms of the void fraction are compared to Moby Dick and BNL experimental data. It shows that satisfactory agreements could be obtained from the present model without any floating parameter to be adjusted with data. This result indicates that, at least for the experimental conditions considered here, the mechanistic prediction of the flashing phenomenon is possible based on the present wall nucleation based model. 43 refs., 4 figs

  9. Visualizing Library Statistics using Open Flash Chart 2 and Drupal

    Directory of Open Access Journals (Sweden)

    Laura K. Wiegand

    2013-01-01

    Full Text Available Libraries continue to need to demonstrate their value to stakeholders, and while statistics alone do not represent value, they are an important element. We found ourselves, and our stakeholders, uninspired by our infrequently updated bulleted list of statistics on our website and so set out to create a more dynamic and visually appealing look at our statistics. This article outlines how we used our content management system, Drupal, Open Flash Chart and custom programming to convert library statistics into Flash charts, including how to populate the graphs with dynamic data from external sources. The end result is our Library Statistics Dashboard (http://library.uncw.edu/facts_planning/dashboard that visually demonstrates the use, activity and resources in the library via interactive and visually interesting graphs.

  10. Adaptive aperture for Geiger mode avalanche photodiode flash ladar systems

    Science.gov (United States)

    Wang, Liang; Han, Shaokun; Xia, Wenze; Lei, Jieyu

    2018-02-01

    Although the Geiger-mode avalanche photodiode (GM-APD) flash ladar system offers the advantages of high sensitivity and simple construction, its detection performance is influenced not only by the incoming signal-to-noise ratio but also by the absolute number of noise photons. In this paper, we deduce a hyperbolic approximation to estimate the noise-photon number from the false-firing percentage in a GM-APD flash ladar system under dark conditions. By using this hyperbolic approximation function, we introduce a method to adapt the aperture to reduce the number of incoming background-noise photons. Finally, the simulation results show that the adaptive-aperture method decreases the false probability in all cases, increases the detection probability provided that the signal exceeds the noise, and decreases the average ranging error per frame.

  11. Measurement and analysis of coherent synchrotron radiation effects at FLASH

    International Nuclear Information System (INIS)

    Beutner, B.

    2007-12-01

    The vacuum-ultra-violet Free Electron Laser in Hamburg (FLASH) is a linac driven SASE-FEL. High peak currents are produced using magnetic bunch compression chicanes. In these magnetic chicanes, the energy distribution along an electron bunch is changed by eff ects of Coherent Synchrotron Radiation (CSR). Energy changes in dispersive bunch compressor chicanes lead to transverse displacements along the bunch. These CSR induced displacements are studied using a transverse deflecting RF-structure. Experiments and simulations concerning the charge dependence of such transverse displacements are presented and analysed. In these experiments an over-compression scheme is used which reduces the peak current downstream the bunch compressor chicanes. Therefore other self interactions like space charge forces which might complicate the measurements are suppressed. Numerical simulations are used to analyse the beam dynamics under the influence of CSR forces. The results of these numerical simulations are compared with the data obtained in the over-compression experiments at FLASH. (orig.)

  12. Biodiesel Production by Reactive Flash: A Numerical Simulation

    Directory of Open Access Journals (Sweden)

    Alejandro Regalado-Méndez

    2016-01-01

    Full Text Available Reactive flash (RF in biodiesel production has been studied in order to investigate steady-state multiplicities, singularities, and effect of biodiesel quality when the RF system approaches to bubble point. The RF was modeled by an index-2 system of differential algebraic equations, the vapor split (ϕ was computed by modified Rachford-Rice equation and modified Raoult’s law computed bubble point, and the continuation analysis was tracked on MATCONT. Results of this study show the existence of turning points, leading to a unique bubble point manifold, (xBiodiesel,T=(0.46,478.41 K, which is a globally stable flashing operation. Also, the results of the simulation in MATLAB® of the dynamic behavior of the RF show that conversion of triglycerides reaches 97% for a residence time of 5.8 minutes and a methanol to triglyceride molar flow ratio of 5 : 1.

  13. Measurement and analysis of coherent synchrotron radiation effects at FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Beutner, B.

    2007-12-15

    The vacuum-ultra-violet Free Electron Laser in Hamburg (FLASH) is a linac driven SASE-FEL. High peak currents are produced using magnetic bunch compression chicanes. In these magnetic chicanes, the energy distribution along an electron bunch is changed by eff ects of Coherent Synchrotron Radiation (CSR). Energy changes in dispersive bunch compressor chicanes lead to transverse displacements along the bunch. These CSR induced displacements are studied using a transverse deflecting RF-structure. Experiments and simulations concerning the charge dependence of such transverse displacements are presented and analysed. In these experiments an over-compression scheme is used which reduces the peak current downstream the bunch compressor chicanes. Therefore other self interactions like space charge forces which might complicate the measurements are suppressed. Numerical simulations are used to analyse the beam dynamics under the influence of CSR forces. The results of these numerical simulations are compared with the data obtained in the over-compression experiments at FLASH. (orig.)

  14. uFLIP: Understanding the Energy Consumption of Flash Devices

    DEFF Research Database (Denmark)

    Bjørling, Matias; Bonnet, Philippe; Bouganim, Luc

    2010-01-01

    Understanding the energy consumption of flash devices is important for two reasons. First, energy is emerging as a key metric for data management systems. It is thus important to understand how we can reason about the energy consumption of flash devices beyond their approximate aggregate...... consumption (low power consumption in idle mode, average Watt consumption from the data sheets). Second, when measured at a sufficiently fine granularity, the energy consumption of a given device might complement the performance characteristics derived from its response time profile. Indeed, background work...... which is not directly observable with a response time profile appears clearly when energy is used as a metric. In this paper, we discuss the results from the {uFLIP} benchmark applied to four different {SSD} devices using both response time and energy as metric....

  15. Total Lightning Flash Activity Response to Aerosol over China Area

    Directory of Open Access Journals (Sweden)

    Pengguo Zhao

    2017-01-01

    Full Text Available Twelve years of measurements of aerosol optical depth (AOD, cloud fraction, cloud top height, ice cloud optical thickness and lightning flash density from 2001 to 2012 have been analyzed to investigate the effect of aerosols on electrical activity over an area of China. The results show that increasing aerosol loading inspires the convective intensity, and then increases the lightning flash density. The spatial distribution of the correlation between aerosol loading and electrical activity shows a remarkable regional difference over China. The high-correlation regions embody the positive aerosol microphysical effect on the intensity of the electrical activity, while the large-scale processes may play the main role in convection development and producing lightning in low-correlation regions.

  16. Flash flood modeling with the MARINE hydrological distributed model

    Science.gov (United States)

    Estupina-Borrell, V.; Dartus, D.; Ababou, R.

    2006-11-01

    Flash floods are characterized by their violence and the rapidity of their occurrence. Because these events are rare and unpredictable, but also fast and intense, their anticipation with sufficient lead time for warning and broadcasting is a primary subject of research. Because of the heterogeneities of the rain and of the behavior of the surface, spatially distributed hydrological models can lead to a better understanding of the processes and so on they can contribute to a better forecasting of flash flood. Our main goal here is to develop an operational and robust methodology for flash flood forecasting. This methodology should provide relevant data (information) about flood evolution on short time scales, and should be applicable even in locations where direct observations are sparse (e.g. absence of historical and modern rainfalls and streamflows in small mountainous watersheds). The flash flood forecast is obtained by the physically based, space-time distributed hydrological model "MARINE'' (Model of Anticipation of Runoff and INondations for Extreme events). This model is presented and tested in this paper for a real flash flood event. The model consists in two steps, or two components: the first component is a "basin'' flood module which generates flood runoff in the upstream part of the watershed, and the second component is the "stream network'' module, which propagates the flood in the main river and its subsidiaries. The basin flash flood generation model is a rainfall-runoff model that can integrate remotely sensed data. Surface hydraulics equations are solved with enough simplifying hypotheses to allow real time exploitation. The minimum data required by the model are: (i) the Digital Elevation Model, used to calculate slopes that generate runoff, it can be issued from satellite imagery (SPOT) or from French Geographical Institute (IGN); (ii) the rainfall data from meteorological radar, observed or anticipated by the French Meteorological Service (M

  17. CG200745, an HDAC inhibitor, induces anti-tumour effects in cholangiocarcinoma cell lines via miRNAs targeting the Hippo pathway

    OpenAIRE

    Jung, Dawoon E.; Park, Soo Been; Kim, Kahee; Kim, Chanyang; Song, Si Young

    2017-01-01

    Cholangiocarcinoma is a devastating malignancy with fatal complications that exhibits low response and resistance to chemotherapy. Here, we evaluated the anticancer effects of CG200745, a novel histone deacetylase inhibitor, either alone or in combination with standard chemotherapy drugs in cholangiocarcinoma cells. CG200745 dose-dependently reduced the viability of cholangiocarcinoma cells in vitro and decreased tumour volume and weight in a xenograft model. Administering CG200745 along with...

  18. Fermi GBM Observations of Terrestrial Gamma-Ray Flashes

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Briggs, M. S.; Connaughton, V.; Fishman, G. J.; Bhat, P. N.; Paciesas, W. S.; Preece, R.; Kippen, R. M.; vonKienlin, A.; Dwyer, J. R.; hide

    2010-01-01

    This slide presentation explores the relationship between Terrestrial Gamma-Ray Flashes (TGF) and lightning. Using data from the World-Wide Lightning Location Network (WWLLN), and the gamma ray observations from Fermi's Gamma-ray Burst Monitor (GBM), the study reviews any causal relationship between TGFs and lightning. The conclusion of the study is that the TGF and lightning are simultaneous with out a causal relationship.

  19. Cuinse2 Thin Film For Solar Cell By Flash Evaporation

    OpenAIRE

    A.H. Soepardjo

    2009-01-01

    Deposition of thin films for material solar cell CuInSe2 are relatively simple. In this research mainly focused on the use of flash evaporation method, and the material created can then be characterized by optical and electrical properties. The optical characterization is done by X-ray Diffraction (XRD), Energy Dispersive Spectroscopy (EDS), and transmission and reflection by UV-VIS spectrophotometry. Electrical characterization is done by utilizing the Hall effect equipment. From these chara...

  20. Flash flood swift water rescues, Texas, 2005–2014

    Directory of Open Access Journals (Sweden)

    Vaidehi Shah

    2017-01-01

    Full Text Available Although rainfall patterns are complex and difficult to predict, climate models suggest precipitation in Texas will occur less frequently and with greater intensity in the future. In combination with rapid population growth and development, extreme rainfall events are likely to lead to flash floods and necessitate swift water rescues. Swift water rescues are used to retrieve person(s from swift water flowing at a rate of 1 knot or greater. Data were obtained from the Texas Fire Marshal’s Office and analyzed to describe spatial and temporal characteristics of rescues. Between 2005 and 2014, 3256 swift water rescues were reported from 136 of 254 (54% counties. Over half (54.6%, n = 1777 occurred in counties known as Flash Flood Alley, which includes Texas’ largest and fastest growing cities. Less than 1.0% (n = 18 were reported from 49 counties designated as completely rural, or with an urban population less than 2500. Increases in swift water rescues were seen between March and September and during major weather events such as tropical storms. Because county-level data was utilized and demographic data was missing in all but 2% (n = 47 of the incidents, our ability to identify populations at risk or target interventions in the future using this data is limited. Despite the frequency of flash flood events and swift water rescues in Texas, knowledge gaps persist that should be addressed through the conduct of interdisciplinary research by epidemiologists and climatologists and by disseminating evidence-based health education and safety programs, particularly in rapidly growing counties that make up Texas’ Flash Flood Alley.

  1. On the Mechanism of Microwave Flash Sintering of Ceramics

    Directory of Open Access Journals (Sweden)

    Yury V. Bykov

    2016-08-01

    Full Text Available The results of a study of ultra-rapid (flash sintering of oxide ceramic materials under microwave heating with high absorbed power per unit volume of material (10–500 W/cm3 are presented. Ceramic samples of various compositions—Al2O3; Y2O3; MgAl2O4; and Yb(LaO2O3—were sintered using a 24 GHz gyrotron system to a density above 0.98–0.99 of the theoretical value in 0.5–5 min without isothermal hold. An analysis of the experimental data (microwave power; heating and cooling rates along with microstructure characterization provided an insight into the mechanism of flash sintering. Flash sintering occurs when the processing conditions—including the temperature of the sample; the properties of thermal insulation; and the intensity of microwave radiation—facilitate the development of thermal runaway due to an Arrhenius-type dependency of the material’s effective conductivity on temperature. The proper control over the thermal runaway effect is provided by fast regulation of the microwave power. The elevated concentration of defects and impurities in the boundary regions of the grains leads to localized preferential absorption of microwave radiation and results in grain boundary softening/pre-melting. The rapid densification of the granular medium with a reduced viscosity of the grain boundary phase occurs via rotation and sliding of the grains which accommodate their shape due to fast diffusion mass transport through the (quasi-liquid phase. The same mechanism based on a thermal runaway under volumetric heating can be relevant for the effect of flash sintering of various oxide ceramics under a dc/ac voltage applied to the sample.

  2. Terrestrial gamma ray flash production by active lightning leader channels

    OpenAIRE

    İnan, Umran Savaş; Carlson, B. E.; Lehtinen, N. G.

    2017-01-01

    The production of terrestrial gamma ray flashes (TGFs) requires a seed energetic electron source and a strong electric field. Lightning leaders naturally provide seed electrons by cold runaway and strong electric fields by charge accumulation on the channel. We model possible TGF production in such fields by simulating the charges and currents on the channel. The resulting electric fields then drive simulations of runaway relativistic electron avalanche and photon emission. Photon spectra and...

  3. Terrestrial gamma ray flash production by lightning current pulses

    OpenAIRE

    İnan, Umran Savaş; Carlson, B. E.; Lehtinen, N. G.

    2017-01-01

    Terrestrial gamma ray flashes (TGFs) are brief bursts of gamma rays observed by satellites, typically in coincidence with detectable lightning. We incorporate TGF observations and the key physics behind current TGF production theories with lightning physics to produce constraints on TGF production mechanisms. The combined constraints naturally suggest a mechanism for TGF production by current pulses in lightning leader channels. The mechanism involves local field enhancements due to charge re...

  4. Characterization of carbon nanolayers flash evaporated on PET and PTFE

    Czech Academy of Sciences Publication Activity Database

    Švorčík, V.; Hubička, T.; Slepička, P.; Siegel, J.; Kolská, Z.; Bláhová, O.; Macková, Anna; Hnatowicz, Vladimír

    2009-01-01

    Roč. 47, č. 7 (2009), s. 1770-1778 ISSN 0008-6223 R&D Projects: GA MŠk(CZ) LC06041; GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : carbon nano-layers * flash evaporation * PET Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.504, year: 2009

  5. Lessons learned from Khartoum flash flood impacts: An integrated assessment.

    Science.gov (United States)

    Mahmood, Mohamad Ibrahim; Elagib, Nadir Ahmed; Horn, Finlay; Saad, Suhair A G

    2017-12-01

    This study aims at enabling the compilation of key lessons for decision makers and urban planners in rapidly urbanizing cities regarding the identification of representative, chief causal natural and human factors for the increased level of flash flood risk. To achieve this, the impacts of flash flood events of 2013 and 2014 in the capital of Sudan, Khartoum, were assessed using seven integrated approaches, i.e. rainfall data analysis, document analysis of affected people and houses, observational fieldwork in the worst flood affected areas, people's perception of causes and mitigation measures through household interviews, reported drinking water quality, reported water-related diseases and social risk assessment. Several lessons have been developed as follows. Urban planners must recognize the devastating risks of building within natural pathways of ephemeral watercourses. They must also ensure effective drainage infrastructures and physio-geographical investigations prior to developing urban areas. The existing urban drainage systems become ineffective due to blockage by urban waste. Building of unauthorized drainage and embankment structures by locals often cause greater flood problems than normal. The urban runoff is especially problematic for residential areas built within low-lying areas having naturally low infiltration capacity, as surface water can rapidly collect within hollows and depressions, or beside elevated roads that preclude the free flow of floodwater. Weak housing and infrastructure quality are especially vulnerable to flash flooding and even to rainfall directly. Establishment of services infrastructure is imperative for flash flood disaster risk reduction. Water supply should be from lower aquifers to avoid contaminant groundwater. Regular monitoring of water quality and archiving of its indicators help identify water-related diseases and sources of water contamination in the event of environmental disasters such as floods. Though the

  6. Flash-x-radiography for fuel motion studies

    International Nuclear Information System (INIS)

    Choate, L.M.; Halbleib, J.A. Sr.; Posey, L.D.

    1976-01-01

    The paper is primarily intended to be a status report on recent activities in the Flash X-ray Radiography/Cinematography area. Studies in the area of source definition as well as associated experimental limitations are discussed. The implications of machine current upon precision uncertainty in measurements of changes in areal density are presented. The radiographic techniques presently being evaluated are discussed. Performance estimates representative of this type of diagnostic tool are presented. Comparison with other results is made

  7. Turbulent spots and scalar flashes in pipe transition

    Science.gov (United States)

    Adrian, Ronald; Wu, Xiaohua; Moin, Parviz

    2017-11-01

    Recent study (Wu et al., PNAS, 1509451112, 2015) demonstrated the feasibility and accuracy of direct computation of the Osborne Reynolds' pipe transition experiment without the unphysical axially periodic boundary condition. Here we use this approach to address three questions: (1) What are the dynamics of turbulent spot generation in pipe transition? (2) How is the succession of scalar flashes, as observed and sketched by Osborne Reynolds, created? (3) What happens to the succession of flashes further downstream? In this study, the inlet disturbance is of radial-mode type imposed through a narrow, three-degree numerical wedge; and the simulation Reynolds number is 6500. Numerical dye is introduced at the inlet plane locally very close to the pipe axis, similar to the needle injection by O. Reynolds. Inception of infant turbulent spots occurs when normal, forward inclined hairpin packets form near the walls from the debris of the inlet perturbations. However, the young and mature turbulent spots consist almost exclusively of reverse, backward leaning hairpin vortices. Scalar flashes appear successively downstream and persist well into the fully-developed turbulent region. Their creation mechanism is addressed. RJA gratefully acknowledges support of the National Science Foundation with NSF Award CBET-0933848.

  8. The SWARF high energy flash X-ray facility

    International Nuclear Information System (INIS)

    Gilbert, J.F.; Dove, E.W.D.

    1976-06-01

    A description is presented of the SWARF flash radiography facility at AWRE Foulness, which is stated to be the most powerful flash x-ray system available, in the U.K. The machine consists essentially of a Marx generator, a coaxial Blumlein system and an x-ray tube. The voltage output from the Marx generator (about 2.5 MV from an 80 kV input) is applied to a large re-entrant Blumlein pulse-forming line. Near maximum voltage, an adjustable oil switch short-circuits one end of the Blumlein generator and so applies a square voltage pulse of 65 ns duration to the x-ray tube. The x-rays are produced from a tantalum target which forms the anode of a vacuum field emission diode. The facility consists of two field machines positioned so that radiographs can be obtained from different angles. The description is given under the following heads: modus operandi; constructional details; oil installation; electrical details; commissioning, calibration and electrical data; flash radiography in explosives research; operational control of facility, film packs; radiographic results; further developments; overall performance. (U.K.)

  9. Spray structure as generated under homogeneous flash boiling nucleation regime

    International Nuclear Information System (INIS)

    Levy, M.; Levy, Y.; Sher, E.

    2014-01-01

    We show the effect of the initial pressure and temperature on the spatial distribution of droplets size and their velocity profile inside a spray cloud that is generated by a flash boiling mechanism under homogeneous nucleation regime. We used TSI's Phase Doppler Particle Analyzer (PDPA) to characterize the spray. We conclude that the homogeneous nucleation process is strongly affected by the initial liquid temperature while the initial pressure has only a minor effect. The spray shape is not affected by temperature or pressure under homogeneous nucleation regime. We noted that the only visible effect is in the spray opacity. Finally, homogeneous nucleation may be easily achieved by using a simple atomizer construction, and thus is potentially suitable for fuel injection systems in combustors and engines. - Highlights: • We study the characteristics of a spray that is generated by a flash boiling process. • In this study, the flash boiling process occurs under homogeneous nucleation regime. • We used Phase Doppler Particle Analyzer (PDPA) to characterize the spray. • The SMD has been found to be strongly affected by the initial liquid temperature. • Homogeneous nucleation may be easily achieved by using a simple atomizer unit

  10. Detection and spectral measurements of coherent synchrotron radiation at FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Behrens, Christopher

    2010-02-15

    The operation of high-gain free-electron laser (FEL) underlies tremendous demands on high quality electron beams with high peak currents. At the Free-Electron-Laser in Hamburg (FLASH), two magnetic bunch compressors are used to compress the electron bunches longitudinally. In the bunch compressor magnets, these short electron bunches generate coherent synchrotron radiation (CSR). This CSR contains information on the longitudinal bunch profile, which is relevant for driving an FEL. In order to investigate coherent synchrotron radiation at the second bunch compressor BC3 at FLASH, a new setup behind the last dipole was installed. For the detection of coherent synchrotron radiation, which is emitted in the infrared regime, pyroelectric detectors were used. These pyroelectric detectors have been calibrated at the free-electron laser FELIX in the wavelength range from 5 {mu}m to 110 {mu}m. For characterisation of the emitted radiation, a transverse scanning device was used to measure the transverse intensity distribution. Various transmission filters were used to obtain additional information about the spectral content. In order to get spectral information with high resolution over a wide wavelength range, a rotating mirror spectrometer using reflective blazed gratings was installed. Using this spectrometer, the first spectral measurements of coherent synchrotron radiation at FLASH in a wavelength range from 10 {mu}m to 160 {mu}m were done. (orig.)

  11. Out-of-phase flashing induced instabilities in CIRCUS facility

    Energy Technology Data Exchange (ETDEWEB)

    Christian Pablo Marcel; Van der Hagen, T.H.J.J. [Interfaculty Reactor Institute, Delft University of Technology, Mekelweg 15, 2629 JB Delft (Netherlands)

    2005-07-01

    Full text of publication follows: Flashing-induced instabilities are very important during the startup phase of natural-circulation boiling water reactors. To study this type of instability an axial fully scaled facility named CIRCUS was constructed. Experiments at low power and low pressure (typical startup conditions) are carried out on this steam/water natural circulation loop with two parallel risers. A detailed measurement of the void-fraction profile is possible by using needle-probes and the use of glass tubes for the riser and core sections allow to use optical techniques for velocity measurements. The flashing and the mechanism of flashing-induced instabilities are analyzed paying special attention on the strong coupling effect between the two riser channels. It is clear from the experiments that the out-of-phase instability is much more susceptible to occur than the in-phase instability in a system with two parallel risers. The instability region is found as soon as the operational boundary between single-phase and two-phase operation is crossed. The relation between the period of the oscillations and the fluid transient time is also investigated. The stability map constructed using this experimental data is also discussed. (authors)

  12. Detection and spectral measurements of coherent synchrotron radiation at FLASH

    International Nuclear Information System (INIS)

    Behrens, Christopher

    2010-02-01

    The operation of high-gain free-electron laser (FEL) underlies tremendous demands on high quality electron beams with high peak currents. At the Free-Electron-Laser in Hamburg (FLASH), two magnetic bunch compressors are used to compress the electron bunches longitudinally. In the bunch compressor magnets, these short electron bunches generate coherent synchrotron radiation (CSR). This CSR contains information on the longitudinal bunch profile, which is relevant for driving an FEL. In order to investigate coherent synchrotron radiation at the second bunch compressor BC3 at FLASH, a new setup behind the last dipole was installed. For the detection of coherent synchrotron radiation, which is emitted in the infrared regime, pyroelectric detectors were used. These pyroelectric detectors have been calibrated at the free-electron laser FELIX in the wavelength range from 5 μm to 110 μm. For characterisation of the emitted radiation, a transverse scanning device was used to measure the transverse intensity distribution. Various transmission filters were used to obtain additional information about the spectral content. In order to get spectral information with high resolution over a wide wavelength range, a rotating mirror spectrometer using reflective blazed gratings was installed. Using this spectrometer, the first spectral measurements of coherent synchrotron radiation at FLASH in a wavelength range from 10 μm to 160 μm were done. (orig.)

  13. MR study of intracranial disease with three-dimensional FLASH

    International Nuclear Information System (INIS)

    Runge, V.M.; Wood, M.L.; Kaufman, D.M.; Nelson, K.L.; Traill, M.R.; Wolpert, S.M.

    1987-01-01

    A three-dimensional FLASH technique was used to study 36 patients with intracranial disease at 1 T (Siemens Magnetom). This included 15 cases of intracranial neoplastic disease, four with the application of intravenous Gd-DTPA. Contiguous thin sections (1-2 mm thick) were acquired of the entire intracranial contents using one acquisition (scan time of 5-15 minutes). A MIPRON (KONTRON Instruments) image processing work station was used for rapid image display and 3D reconstruction. 3D FLASH was found to be superior to spin-echo imaging at 1 T for the detection of hemorrhage. 3D acquisition also provided superior localization of neoplastic disease. The T1 contrast achieved was comparable to spin-echo technique with a repetition time/echo time of .6/17. The advantages in terms of lesion localization and thin-section imaging with high spatial resolution of the entire brain may lead to use of 3D FLASH in place of conventional spin-echo imaging

  14. Energetic and exergetic Improvement of geothermal single flash cycle

    Directory of Open Access Journals (Sweden)

    Navid Nazari

    2016-08-01

    Full Text Available This paper presents a detailed analysis of a new method for improving energetic and exergetic efficiencies of single flash cycle. The thermodynamic process of the new method consists of extracting a fraction of hot wellhead geothermal brine for the purpose of superheating saturated steam entering the turbine. Computer programming scripts were developed and optimized based on mathematical proposed models for the different components of the systems. The operating parameters such as separator temperature, geofluid wellhead enthalpy and geothermal source temperature are varied to investigate their effects on both net power output and turbine exhaust quality of the systems. Also, full exergy assessment was performed for the new design. The results of separator temperature optimization revealed that specific net power output of the new design can be boosted up to 8% and turbine exhaust quality can be diminished up to 50% as compared to common single flash cycle. In addition, for wells with higher discharge enthalpy, superheating process improve specific net power output even up to 10%. Finally, it was observed that the overall system exergy efficiency was approximately raised 3%. Article History: Received January 5th 2016; Received in revised form June 25th 2016; Accepted July 3rd 2016; Available online How to Cite This Article: Nazari, N. and Porkhial, S. (2016. Energetic and Exergetic Improvement of Geothermal Single Flash Cycle. Int. Journal of Renewable Energy Development, 5(2,129-138. http://dx.doi.org/10.14710/ijred.5.2.129-138 

  15. The Association Between LH Serum Levels at the time of hCG Injection and Clinical Pregnancy during IVF

    Directory of Open Access Journals (Sweden)

    Budi Wiweko

    2015-12-01

    Full Text Available Some studies showed that recombinant follicle stimulating hormone (r-FSH administration without LH supplementation has a good success rate on in vitro fertilization (IVF. However, LH role in IVF has been controversial. This study was conducted to evaluate the association between serum LH levels at the time of hCG injection and clinical pregnancy during IVF. This retrospective study included 136 patients underwent long protocol IVF from January 2005 to December 2009 in Yasmin Clinic, Cipto Mangunkusumo Hospital, Jakarta. The controlled ovarian hyper-stimulation protocol used in this study was gonadotropin-releasing hormone (GnRH agonist and r-FSH.  Serum LH level was measured on the day of hCG administration and the outcome evaluated was the clinical pregnancy following IVF cycles. There were 32 IVF cycles resulted in pregnancy out of 136 cycles (23.5%. There was significant difference between serum LH levels on the day of hCG administration and clinical pregnancy outcome (p=0.036. LH serum level cut-off value of ≥1.050 IU/l was the best value to predict pregnancy outcome with 62.5% sensitivity, 59.4% specificity, 83.3% positive predictive value, and 32.76% negative predictive value. It was concluded that there was an association between serum LH levels at the time of hCG injection and clinical pregnancy during IVF. Keywords: IVF cycles, LH levels serum, hCG administration   Hubungan Kadar LH saat Penyuntikan hCG dengan Kejadian Kehamilan pada Fertilisasi In vitro Abstrak Pemberian follicles stimulating hormone rekombinan (r-FSH tanpa suplementasi LH memiliki tingkat keberhasilan fertilisasi in vitro (FIV yang baik namun, peran LH pada FIV masih kontroversial. Tujuan penelitian ini adalah untuk mengevaluasi hubungan antara kadar serum LH pada hari penyuntikan hCG dengan kehamilan klinis selama FIV. Penelitian retrospektif ini melibatkan 136 perempuan yang menjalani FIV siklus pertama dengan protokol panjang mulai bulan Januari 2005 sampai

  16. Gun muzzle flash detection using a CMOS single photon avalanche diode

    Science.gov (United States)

    Merhav, Tomer; Savuskan, Vitali; Nemirovsky, Yael

    2013-10-01

    Si based sensors, in particular CMOS Image sensors, have revolutionized low cost imaging systems but to date have hardly been considered as possible candidates for gun muzzle flash detection, due to performance limitations, and low SNR in the visible spectrum. In this study, a CMOS Single Photon Avalanche Diode (SPAD) module is used to record and sample muzzle flash events in the visible spectrum, from representative weapons, common on the modern battlefield. SPADs possess two crucial properties for muzzle flash imaging - Namely, very high photon detection sensitivity, coupled with a unique ability to convert the optical signal to a digital signal at the source pixel, thus practically eliminating readout noise. This enables high sampling frequencies in the kilohertz range without SNR degradation, in contrast to regular CMOS image sensors. To date, the SPAD has not been utilized for flash detection in an uncontrolled environment, such as gun muzzle flash detection. Gun propellant manufacturers use alkali salts to suppress secondary flashes ignited during the muzzle flash event. Common alkali salts are compounds based on Potassium or Sodium, with spectral emission lines around 769nm and 589nm, respectively. A narrow band filter around the Potassium emission doublet is used in this study to favor the muzzle flash signal over solar radiation. This research will demonstrate the SPAD's ability to accurately sample and reconstruct the temporal behavior of the muzzle flash in the visible wavelength under the specified imaging conditions. The reconstructed signal is clearly distinguishable from background clutter, through exploitation of flash temporal characteristics.

  17. Acupuncture as Treatment of Hot Flashes and the Possible Role of Calcitonin Gene-Related Peptide

    Directory of Open Access Journals (Sweden)

    Anna-Clara E. Spetz Holm

    2012-01-01

    Full Text Available The mechanisms behind hot flashes in menopausal women are not fully understood. The flashes in women are probably preceded by and actually initiated by a sudden downward shift in the set point for the core body temperature in the thermoregulatory center that is affected by sex steroids, β-endorphins, and other central neurotransmitters. Treatments that influence these factors may be expected to reduce hot flashes. Since therapy with sex steroids for hot flashes has appeared to cause a number of side effects and risks and women with hot flashes and breast cancer as well as men with prostate cancer and hot flashes are prevented from sex steroid therapy there is a great need for alternative therapies. Acupuncture affecting the opioid system has been suggested as an alternative treatment option for hot flashes in menopausal women and castrated men. The heat loss during hot flashes may be mediated by the potent vasodilator and sweat gland activator calcitonin gene-related peptide (CGRP the concentration of which increases in plasma during flashes in menopausal women and, according to one study, in castrated men with flushes. There is also evidence for connections between the opioid system and the release of CGRP. In this paper we discuss acupuncture as a treatment alternative for hot flashes and the role of CGRP in this context.

  18. Flash pyrolysis, a process for utilizing contaminated wood; Flash-Pyrolyse - eine Moeglichkeit der stofflichen Verwertung von kontaminiertem Holz

    Energy Technology Data Exchange (ETDEWEB)

    Meier, D.; Wehlte, S.; Faix, O. [Bundesforschungsanstalt fuer Forst- und Holzwirtschaft, Hamburg (Germany). Inst. fuer Holzchemie und Chemische Technologie des Holzes

    1996-12-31

    Flash pyrolysis of wood treated with common pesticides poses no technical probelms. Product yields, with a maximum oil yield at 475 C, are similar to those of untreated wood. Most of the heavy metals are retained by the coal while a small part aheres to the coal layer of the sand bed. The resulting pyrolysis oil contains neither chromium nor copper. (orig) [Deutsch] Die Flash-Pyrolyse der mit den gaengigsten Schutzmitteln behandelten Hoelzer bereitet verfahrenstechnisch keine Probleme. Auch die Produktausbeuten, mit einem oelmaximum bei 475 C, aehneln denen von naturbelassenem Holz. Der groesste Teil der Schwermetalle wurde an die Kohle gebunden, ein geringer Teil blieb auf der Kohleschicht des Sandes haften. Im Hauptprodukt Pyrolyseoel konnten weder Chrom noch Kupfer nachgewiesen werden. (orig)

  19. Flash pyrolysis, a process for utilizing contaminated wood; Flash-Pyrolyse - eine Moeglichkeit der stofflichen Verwertung von kontaminiertem Holz

    Energy Technology Data Exchange (ETDEWEB)

    Meier, D; Wehlte, S; Faix, O [Bundesforschungsanstalt fuer Forst- und Holzwirtschaft, Hamburg (Germany). Inst. fuer Holzchemie und Chemische Technologie des Holzes

    1997-12-31

    Flash pyrolysis of wood treated with common pesticides poses no technical probelms. Product yields, with a maximum oil yield at 475 C, are similar to those of untreated wood. Most of the heavy metals are retained by the coal while a small part aheres to the coal layer of the sand bed. The resulting pyrolysis oil contains neither chromium nor copper. (orig) [Deutsch] Die Flash-Pyrolyse der mit den gaengigsten Schutzmitteln behandelten Hoelzer bereitet verfahrenstechnisch keine Probleme. Auch die Produktausbeuten, mit einem oelmaximum bei 475 C, aehneln denen von naturbelassenem Holz. Der groesste Teil der Schwermetalle wurde an die Kohle gebunden, ein geringer Teil blieb auf der Kohleschicht des Sandes haften. Im Hauptprodukt Pyrolyseoel konnten weder Chrom noch Kupfer nachgewiesen werden. (orig)

  20. Cardiac autonomic function and hot flashes among perimenopausal and postmenopausal women.

    Science.gov (United States)

    Gibson, Carolyn J; Mendes, Wendy Berry; Schembri, Michael; Grady, Deborah; Huang, Alison J

    2017-07-01

    Abnormalities in autonomic function are posited to play a pathophysiologic role in menopausal hot flashes. We examined relationships between resting cardiac autonomic activity and hot flashes in perimenopausal and postmenopausal women. Autonomic function was assessed at baseline and 12 weeks among perimenopausal and postmenopausal women (n = 121, mean age 53 years) in a randomized trial of slow-paced respiration for hot flashes. Pre-ejection period (PEP), a marker of sympathetic activation, was measured with impedance cardiography. Respiratory sinus arrhythmia (RSA), a marker of parasympathetic activation, was measured with electrocardiography. Participants self-reported hot flash frequency and severity in 7-day symptom diaries. Analysis of covariance models were used to relate autonomic function and hot flash frequency and severity at baseline, and to relate changes in autonomic function to changes in hot flash frequency and severity over 12 weeks, adjusting for age, body mass index, and intervention assignment. PEP was not associated with hot flash frequency or severity at baseline or over 12 weeks (P > 0.05 for all). In contrast, there was a trend toward greater frequency of moderate-to-severe hot flashes with higher RSA at baseline (β = 0.43, P = 0.06), and a positive association between change in RSA and change in frequency of moderate-to-severe hot flashes over 12 weeks (β = 0.63, P = 0.04). Among perimenopausal and postmenopausal women with hot flashes, variations in hot flash frequency and severity were not explained by variations in resting sympathetic activation. Greater parasympathetic activation was associated with more frequent moderate-to-severe hot flashes, which may reflect increased sensitivity to perceiving hot flashes.

  1. Ten tandem repeats of β-hCG 109-118 enhance immunogenicity and anti-tumor effects of β-hCG C-terminal peptide carried by mycobacterial heat-shock protein HSP65

    International Nuclear Information System (INIS)

    Zhang Yankai; Yan Rong; He Yi; Liu Wentao; Cao Rongyue; Yan Ming; Li Taiming; Liu Jingjing; Wu Jie

    2006-01-01

    The β-subunit of human chorionic gonadotropin (β-hCG) is secreted by many kinds of tumors and it has been used as an ideal target antigen to develop vaccines against tumors. In view of the low immunogenicity of this self-peptide,we designed a method based on isocaudamer technique to repeat tandemly the 10-residue sequence X of β-hCG (109-118), then 10 tandemly repeated copies of the 10-residue sequence combined with β-hCG C-terminal 37 peptides were fused to mycobacterial heat-shock protein 65 to construct a fusion protein HSP65-X10-βhCGCTP37 as an immunogen. In this study, we examined the effect of the tandem repeats of this 10-residue sequence in eliciting an immune by comparing the immunogenicity and anti-tumor effects of the two immunogens, HSP65-X10-βhCGCTP37 and HSP65-βhCGCTP37 (without the 10 tandem repeats). Immunization of mice with the fusion protein HSP65-X10-βhCGCTP37 elicited much higher levels of specific anti-β-hCG antibodies and more effectively inhibited the growth of Lewis lung carcinoma (LLC) in vivo than with HSP65-βhCGCTP37, which should suggest that HSP65-X10-βhCGCTP37 may be an effective protein vaccine for the treatment of β-hCG-dependent tumors and multiple tandem repeats of a certain epitope are an efficient method to overcome the low immunogenicity of self-peptide antigens

  2. The HELLP syndrome : Its association with unexplained elevation of MSAFP and MShCG in the second trimester

    NARCIS (Netherlands)

    Morssink, LP; Heringa, MP; Beekhuis, [No Value; DeWolf, BTHM; Mantingh, A

    In this study, we examined the relationship between concentrations of maternal serum alpha-fetoprotein (MSAFP) and maternal serum human chorionic gonadotropin (MShCG) in the second trimester and the 'haemolysis, elevated liver enzymes, low platelet count' (HELLP) syndrome. The concentrations of both

  3. Development of 'SKYSHINE-CG' code. A line-beam method code equipped with combinatorial geometry routine

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Takahiro; Ochiai, Katsuharu [Plant and System Planning Department, Toshiba Corporation, Yokohama, Kanagawa (Japan); Uematsu, Mikio; Hayashida, Yoshihisa [Department of Nuclear Engineering, Toshiba Engineering Corporation, Yokohama, Kanagawa (Japan)

    2000-03-01

    A boiling water reactor (BWR) plant has a single loop coolant system, in which main steam generated in the reactor core proceeds directly into turbines. Consequently, radioactive {sup 16}N (6.2 MeV photon emitter) contained in the steam contributes to gamma-ray skyshine dose in the vicinity of the BWR plant. The skyshine dose analysis is generally performed with the line-beam method code SKYSHINE, in which calculational geometry consists of a rectangular turbine building and a set of isotropic point sources corresponding to an actual distribution of {sup 16}N sources. For the purpose of upgrading calculational accuracy, the SKYSHINE-CG code has been developed by incorporating the combinatorial geometry (CG) routine into the SKYSHINE code, so that shielding effect of in-building equipment can be properly considered using a three-dimensional model composed of boxes, cylinders, spheres, etc. Skyshine dose rate around a 500 MWe BWR plant was calculated with both SKYSHINE and SKYSHINE-CG codes, and the calculated results were compared with measured data obtained with a NaI(Tl) scintillation detector. The C/E values for SKYSHINE-CG calculation were scattered around 4.0, whereas the ones for SKYSHINE calculation were as large as 6.0. Calculational error was found to be reduced by adopting three-dimensional model based on the combinatorial geometry method. (author)

  4. Study on the relationship between the levels of serum cholylglycine (CG) and blood lipids in pregnant women

    International Nuclear Information System (INIS)

    You Jianfei; Lv Shiming; Wang Qiong; Zhu Yuning

    2005-01-01

    Objective: To investigate the prevalence of intrahepatic cholestasis during pregnancy and the relationship between levels of serum CG and blood lipids. Methods: Serum CG, blood lipid and liver function profile were examined in 2040 women with pregnancy during the second or third trimester. Among these pregnant women, 57 were diagnosed as with intrahepatic cholestasis. Blood lipids (TG, cholesterol, HDL, LDL) and ALP levels in 50 of the 57 pregnant women were studied and compared with those in 50 otherwise normal pregnant women as controls. Results: Serum CG levels were above normal range in 372 of the 2040 pregnant women (18.5%). Fifty seven of these 372 pregnant women were confirmed to be with intrahepatic cholestasis (2.8% of the 2040 pregnancies). The TG, cholesterol, LDL contents and ALP levels in the pregnant women with intrahepatic cholestasis were significantly higher (P 0.05) than those in controls. Conclusion: Intrahepatic cholestasis developed in a substantial proportion of pregnant women (2.8% in this study) and should be carefully monitored due to possible damage to the fetus. Serum CG was shown to be an early and sensitive marker for the diagnosis of intrahepatic cholestasis. Changes of blood lipid and ALP levels were related to disease status. (authors)

  5. Transcobalamin 776C-->G polymorphism is associated with peripheral neuropathy in elderly with high folate intake

    Science.gov (United States)

    Background: The 776C-->G polymorphism of the vitamin B-12 transport protein transcobalamin gene (TCN2) (rs1801198; Pro259Arg) is associated with a lower holotranscobalamin concentration in plasma. This effect may reduce the availability of vitamin B-12 to tissues even when vitamin B-12 intake is ade...

  6. Structural Characterization of Heme Environmental Mutants of CgHmuT that Shuttles Heme Molecules to Heme Transporters

    Directory of Open Access Journals (Sweden)

    Norifumi Muraki

    2016-05-01

    Full Text Available Corynebacteria contain a heme uptake system encoded in hmuTUV genes, in which HmuT protein acts as a heme binding protein to transport heme to the cognate transporter HmuUV. The crystal structure of HmuT from Corynebacterium glutamicum (CgHmuT reveals that heme is accommodated in the central cleft with His141 and Tyr240 as the axial ligands and that Tyr240 forms a hydrogen bond with Arg242. In this work, the crystal structures of H141A, Y240A, and R242A mutants were determined to understand the role of these residues for the heme binding of CgHmuT. Overall and heme environmental structures of these mutants were similar to those of the wild type, suggesting that there is little conformational change in the heme-binding cleft during heme transport reaction with binding and the dissociation of heme. A loss of one axial ligand or the hydrogen bonding interaction with Tyr240 resulted in an increase in the redox potential of the heme for CgHmuT to be reduced by dithionite, though the wild type was not reduced under physiological conditions. These results suggest that the heme environmental structure stabilizes the ferric heme binding in CgHmuT, which will be responsible for efficient heme uptake under aerobic conditions where Corynebacteria grow.

  7. A study of the Herbig-Haro object HH 120 and the associated cometary globule CG 30

    International Nuclear Information System (INIS)

    Pettersson, B.

    1984-01-01

    Infrared and spectroscopic observations are presented of a new Herbig-Haro object, here named HH 120, in the cometary globule CG 30. The emission line spectrum indicates a very low degree of excitation of the same order as that found for HH 47, HH 7, and HH 11. From several spectra a radial velocity of -42 km -1 +-12 km s -1 is deduced and the electron temperature, Tsub(e), and electron number density, Nsub(e), are found to be 9100 K+-400 K and 1700 cm -3 +-600 cm -3 , respectively. A prominent continuum is shown to be composed of a collisionally enhanced two-photon continuum and a reflected late-type stellar component, probably originating in the hidden source of energy. Infrared scans of CG 30 revealed five sources, two of which are very close to HH 120. It is argued that one of them, CG 30-IRS4, is the source of energy producing HH 120 and an associated reflection nebula. The bolometric luminosity of CG 30-IRS4 is estimated to be at least 0.9 Lsub(sun), its mass 1.1 Msub(sun) and its radius 1.6 Rsub(sun). (orig.)

  8. An Integrated 0-1 Hour First-Flash Lightning Nowcasting, Lightning Amount and Lightning Jump Warning Capability

    Science.gov (United States)

    Mecikalski, John; Jewett, Chris; Carey, Larry; Zavodsky, Brad; Stano, Geoffrey

    2015-01-01

    Lightning one of the most dangerous weather-related phenomena, especially as many jobs and activities occur outdoors, presenting risk from a lightning strike. Cloud-to-ground (CG) lightning represents a considerable safety threat to people at airfields, marinas, and outdoor facilities-from airfield personnel, to people attending outdoor stadium events, on beaches and golf courses, to mariners, as well as emergency personnel. Holle et al. (2005) show that 90% of lightning deaths occurred outdoors, while 10% occurred indoors despite the perception of safety when inside buildings. Curran et al. (2000) found that nearly half of fatalities due to weather were related to convective weather in the 1992-1994 timeframe, with lightning causing a large component of the fatalities, in addition to tornadoes and flash flooding. Related to the aviation industry, CG lightning represents a considerable hazard to baggage-handlers, aircraft refuelers, food caterers, and emergency personnel, who all become exposed to the risk of being struck within short time periods while convective storm clouds develop. Airport safety protocols require that ramp operations be modified or discontinued when lightning is in the vicinity (typically 16 km), which becomes very costly and disruptive to flight operations. Therefore, much focus has been paid to nowcasting the first-time initiation and extent of lightning, both of CG and of any lightning (e.g, in-cloud, cloud-to-cloud). For this project three lightning nowcasting methodologies will be combined: (1) a GOESbased 0-1 hour lightning initiation (LI) product (Harris et al. 2010; Iskenderian et al. 2012), (2) a High Resolution Rapid Refresh (HRRR) lightning probability and forecasted lightning flash density product, such that a quantitative amount of lightning (QL) can be assigned to a location of expected LI, and (3) an algorithm that relates Pseudo-GLM data (Stano et al. 2012, 2014) to the so-called "lightning jump" (LJ) methodology (Shultz et al

  9. TMV-Cg Coat Protein stabilizes DELLA proteins and in turn negatively modulates salicylic acid-mediated defense pathway during Arabidopsis thaliana viral infection.

    Science.gov (United States)

    Rodriguez, Maria Cecilia; Conti, Gabriela; Zavallo, Diego; Manacorda, Carlos Augusto; Asurmendi, Sebastian

    2014-08-03

    Plant viral infections disturb defense regulatory networks during tissue invasion. Emerging evidence demonstrates that a significant proportion of these alterations are mediated by hormone imbalances. Although the DELLA proteins have been reported to be central players in hormone cross-talk, their role in the modulation of hormone signaling during virus infections remains unknown. This work revealed that TMV-Cg coat protein (CgCP) suppresses the salicylic acid (SA) signaling pathway without altering defense hormone SA or jasmonic acid (JA) levels in Arabidopsis thaliana. Furthermore, it was observed that the expression of CgCP reduces plant growth and delays the timing of floral transition. Quantitative RT-qPCR analysis of DELLA target genes showed that CgCP alters relative expression of several target genes, indicating that the DELLA proteins mediate transcriptional changes produced by CgCP expression. Analyses by fluorescence confocal microscopy showed that CgCP stabilizes DELLA proteins accumulation in the presence of gibberellic acid (GA) and that the DELLA proteins are also stabilized during TMV-Cg virus infections. Moreover, DELLA proteins negatively modulated defense transcript profiles during TMV-Cg infection. As a result, TMV-Cg accumulation was significantly reduced in the quadruple-DELLA mutant Arabidopsis plants compared to wild type plants. Taken together, these results demonstrate that CgCP negatively regulates the salicylic acid-mediated defense pathway by stabilizing the DELLA proteins during Arabidopsis thaliana viral infection, suggesting that CgCP alters the stability of DELLAs as a mechanism of negative modulation of antiviral defense responses.

  10. Predictive value of modeled AUC(AFP-hCG), a dynamic kinetic parameter characterizing serum tumor marker decline in patients with nonseminomatous germ cell tumor.

    Science.gov (United States)

    You, Benoit; Fronton, Ludivine; Boyle, Helen; Droz, Jean-Pierre; Girard, Pascal; Tranchand, Brigitte; Ribba, Benjamin; Tod, Michel; Chabaud, Sylvie; Coquelin, Henri; Fléchon, Aude

    2010-08-01

    The early decline profile of alpha-fetoprotein (AFP) and human chorionic gonadotropin (hCG) in patients with nonseminomatous germ cell tumors (NSGCT) treated with chemotherapy may be related to the risk of relapse. We assessed the predictive values of areas under the curve of hCG (AUC(hCG)) and AFP (AUC(AFP)) of modeled concentration-time equations on progression-free survival (PFS). Single-center retrospective analysis of hCG and AFP time-points from 65 patients with IGCCCG intermediate-poor risk NSGCT treated with 4 cycles of bleomycin-etoposide-cisplatin (BEP). To determine AUC(hCG) and AUC(AFP) for D0-D42, AUCs for D0-D7 were calculated using the trapezoid rule and AUCs for D7-D42 were calculated using the mathematic integrals of equations modeled with NONMEM. Combining AUC(AFP) and AUC(hCG) enabled us to define 2 predictive groups: namely, patients with favorable and unfavorable AUC(AFP-hCG). Survival analyses and ROC curves assessed the predictive values of AUC(AFP-hCG) groups regarding progression-free survival (PFS) and compared them with those of half-life (HL) and time-to-normalization (TTN). Mono-exponential models best fit the patterns of marker decreases. Patients with a favorable AUC(AFP-hCG) had a significantly better PFS (100% vs 71.5%, P = .014). ROC curves confirmed the encouraging predictive accuracy of AUC(AFP-hCG) against HL or TTN regarding progression risk (ROC AUCs = 79.6 vs 71.9 and 70.2 respectively). Because of the large number of patients with missing data, multivariate analysis could not be performed. AUC(AFP-hCG) is a dynamic parameter characterizing tumor marker decline in patients with NSGCT during BEP treatment. Its value as a promising predictive factor should be validated. Copyright 2010 Elsevier Inc. All rights reserved.

  11. Regulation of the angiopoietin-2 gene by hCG in ovarian cancer cell line OVCAR-3.

    Science.gov (United States)

    Pietrowski, D; Wiehle, P; Sator, M; Just, A; Keck, C

    2010-05-01

    Angiogenesis is a crucial step in growing tissues including many tumors. It is regulated by pro- and antiangiogenic factors including the family of angiopoietins and their corresponding receptors. In previous work we have shown that in human ovarian cells the expression of angiopoietin 2 (ANG2) is regulated by human chorionic gonadotropin (hCG). To better understand the mechanisms of hCG-dependent regulation of the ANG2-gene we have now investigated upstream regulatory active elements of the ANG2-promoter in the ovarian carcinoma cell line OVCAR-3. We cloned several ANG2-promoter-fragments of different lengths into a luciferase reporter-gene-vector and analyzed the corresponding ANG2 expression before and after hCG stimulation. We identified regions of the ANG2-promoter between 1 048 bp and 613 bp upstream of the transcriptional start site where hCG-dependent pathways promote a significant downregulation of gene expression. By sequence analysis of this area we found several potential binding sites for transcription factors that are involved in regulation of ANG2-expression, vascular development and ovarian function. These encompass the forkhead family transcription factors FOXC2 and FOXO1 as well as the CCAAT/enhancer binding protein family (C/EBP). In conclusion, we have demonstrated that the regulation of ANG2-expression in ovarian cancer cells is hCG-dependent and we suggest that forkhead transcription factor and C/EBP-dependent pathways are involved in the regulation of ANG2-expression in ovarian cancer cells. Georg Thieme Verlag KG Stuttgart-New York.

  12. The Adjoint Method for Gradient-based Dynamic Optimization of UV Flash Processes

    DEFF Research Database (Denmark)

    Ritschel, Tobias Kasper Skovborg; Capolei, Andrea; Jørgensen, John Bagterp

    2017-01-01

    This paper presents a novel single-shooting algorithm for gradient-based solution of optimal control problems with vapor-liquid equilibrium constraints. Dynamic optimization of UV flash processes is relevant in nonlinear model predictive control of distillation columns, certain two-phase flow pro......-component flash process which demonstrate the importance of the optimization solver, the compiler, and the linear algebra software for the efficiency of dynamic optimization of UV flash processes....

  13. Metabolic activity in the insular cortex and hypothalamus predicts hot flashes: an FDG-PET study.

    Science.gov (United States)

    Joffe, Hadine; Deckersbach, Thilo; Lin, Nancy U; Makris, Nikos; Skaar, Todd C; Rauch, Scott L; Dougherty, Darin D; Hall, Janet E

    2012-09-01

    Hot flashes are a common side effect of adjuvant endocrine therapies (AET; leuprolide, tamoxifen, aromatase inhibitors) that reduce quality of life and treatment adherence in breast cancer patients. Because hot flashes affect only some women, preexisting neurobiological traits might predispose to their development. Previous studies have implicated the insula during the perception of hot flashes and the hypothalamus in thermoregulatory dysfunction. The aim of the study was to understand whether neurobiological factors predict hot flashes. [18F]-Fluorodeoxyglucose (FDG) positron emission tomography (PET) brain scans coregistered with structural magnetic resonance imaging were used to determine whether metabolic activity in the insula and hypothalamic thermoregulatory and estrogen-feedback regions measured before and in response to AET predict hot flashes. Findings were correlated with CYP2D6 genotype because of CYP2D6 polymorphism associations with tamoxifen-induced hot flashes. We measured regional cerebral metabolic rate of glucose uptake (rCMRglu) in the insula and hypothalamus on FDG-PET. Of 18 women without hot flashes who began AET, new-onset hot flashes were reported by 10 (55.6%) and were detected objectively in nine (50%) participants. Prior to the use of all AET, rCMRglu in the insula (P ≤ 0.01) and hypothalamic thermoregulatory (P = 0.045) and estrogen-feedback (P = 0.007) regions was lower in women who reported developing hot flashes. In response to AET, rCMRglu was further reduced in the insula in women developing hot flashes (P ≤ 0.02). Insular and hypothalamic rCMRglu levels were lower in intermediate than extensive CYP2D6 metabolizers. Trait neurobiological characteristics predict hot flashes. Genetic variability in CYP2D6 may underlie the neurobiological predisposition to hot flashes induced by AET.

  14. Flash-Point prediction for binary partially miscible aqueous-organic mixtures

    OpenAIRE

    Liaw, Horng-Jang; Chen, Chien Tsun; Gerbaud, Vincent

    2008-01-01

    Flash point is the most important variable used to characterize fire and explosion hazard of liquids. Herein, partially miscible mixtures are presented within the context of liquid-liquid extraction processes and heterogeneous distillation processes. This paper describes development of a model for predicting the flash point of binary partially miscible mixtures of aqueous-organic system. To confirm the predictive efficiency of the derived flash points, the model was verified by comparing the ...

  15. On the nature of the galactic 2CG γ-ray sources

    International Nuclear Information System (INIS)

    Buccheri, R.; Morini, M.; Sacco, B.

    1981-01-01

    The identification of two γ-ray sources of the COS-B catalogue with radio pulsars is used as an important hint for the identification of the rest of the population. The relevant distributions of γ-ray pulsars visible at the Sun within the limiting sensitivity of COS-B are derived on the following assumptions: (i) the γ-ray luminosity is a decreasing power law of the pulsar age, as indicated by current models; (ii) the scale height of pulsars at creation is equal to that of the supernova remnants; (iii) the pulsars' birth rate and spatial distribution are those published by Taylor and Manchester (1977). As a preliminary result it is shown that 10 to 20 γ-ray pulsars may be visible from the Earth with distributional parameters not distinguishable from those of the 2CG γ-ray sources. It is suggested therefore that a significant fraction of the unidentified galactic γ-ray sources are pulsars. (author)

  16. Interactions of numerical and temporal stimulus characteristics on the control of response location by brief flashes of light.

    Science.gov (United States)

    Fetterman, J Gregor; Killeen, P Richard

    2011-09-01

    Pigeons pecked on three keys, responses to one of which could be reinforced after 3 flashes of the houselight, to a second key after 6, and to a third key after 12. The flashes were arranged according to variable-interval schedules. Response allocation among the keys was a function of the number of flashes. When flashes were omitted, transitions occurred very late. Increasing flash duration produced a leftward shift in the transitions along a number axis. Increasing reinforcement probability produced a leftward shift, and decreasing reinforcement probability produced a rightward shift. Intermixing different flash rates within sessions separated allocations: Faster flash rates shifted the functions sooner in real time, but later in terms of flash count, and conversely for slower flash rates. A model of control by fading memories of number and time was proposed.

  17. bZIP transcription factor CgAP1 is essential for oxidative stress tolerance and full virulence of the poplar anthracnose fungus Colletotrichum gloeosporioides.

    Science.gov (United States)

    Sun, Yingjiao; Wang, Yonglin; Tian, Chengming

    2016-10-01

    Yeast AP1 transcription factor is a regulator of oxidative stress response. Here, we report the identification and characterization of CgAP1, an ortholog of YAP1 in poplar anthracnose fungus Colletotrichum gloeosporioides. The expression of CgAP1 was highly induced by reactive oxygen species. CgAP1 deletion mutants displayed enhanced sensitivity to oxidative stress compared with the wild-type strain, and their poplar leaf virulence was obviously reduced. However, the mutants exhibited no obvious defects in aerial hyphal growth, conidia production, and appressoria formation. CgAP1::eGFP fusion protein localized to the nucleus after TBH (tert-Butyl hydroperoxide) treatment, suggesting that CgAP1 functions as a redox sensor in C. gloeosporioides. In addition, CgAP1 prevented the accumulation of ROS during early stages of biotrophic growth. CgAP1 also acted as a positive regulator of several ROS-related genes (i.e., Glr1, Hyr1, and Cyt1) involved in the antioxidative response. These results highlight the key regulatory role of CgAP1 transcription factor in oxidative stress response and provide insights into the function of ROS detoxification in virulence of C. gloeosporioides. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Construction of a flash-photolysis apparatus having a short discharge time

    International Nuclear Information System (INIS)

    Devillers, C.

    1964-01-01

    Flash photolysis aims at reaching directly the primary mechanisms resulting from the action of light on an absorbent matter. This makes it necessary to produce a flash as short and as bright as possible. Our main effort was directed towards reducing the duration of the flash by decreasing the self-inductance of the discharge circuit. A description of this circuit and study of the characteristics of the apparatus are followed by a short description of the two analytical methods: flash spectrography and absorption spectrophotometry at a given wave-length. (author) [fr

  19. AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xin, E-mail: fangfei6073@126.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Zhu, Yanming, E-mail: ymzhu2001@neau.edu.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Zhai, Hong, E-mail: Zhai.h@neigaehrb.ac.cn [Northeast Institute of Geography and Agroecology, Chinese Academy of Sciences, Harbin 150040 (China); Cai, Hua, E-mail: small-big@sohu.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Ji, Wei, E-mail: iwei_j@hotmail.com [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Luo, Xiao, E-mail: luoxiao2010@yahoo.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China); Li, Jing, E-mail: lijing@neau.edu.cn [Plant Secondary Metabolism Laboratory, Northeast Agricultural University, Harbin 150030 (China); Bai, Xi, E-mail: baixi@neau.edu.cn [Plant Bioengineering Laboratory, Northeast Agricultural University, Harbin 150030 (China)

    2012-06-15

    Highlights: Black-Right-Pointing-Pointer AtPP2CG1 positively regulates salt tolerance in ABA-dependent manner. Black-Right-Pointing-Pointer AtPP2CG1 up-regulates the expression of marker genes in different pathways. Black-Right-Pointing-Pointer AtPP2CG1 expresses in the vascular system and trichomes of Arabidopsis. -- Abstract: AtPP2CG1 (Arabidopsis thaliana protein phosphatase 2C G Group 1) was predicted as an abiotic stress candidate gene by bioinformatic analysis in our previous study. The gene encodes a putative protein phosphatase 2C that belongs to Group G of PP2C. There is no report of Group G genes involved in abiotic stress so far. Real-time RT-PCR analysis showed that AtPP2CG1 expression was induced by salt, drought, and abscisic acid (ABA) treatment. The expression levels of AtPP2CG1 in the ABA synthesis-deficient mutant abi2-3 were much lower than that in WT plants under salt stress suggesting that the expression of AtPP2CG1 acts in an ABA-dependent manner. Over-expression of AtPP2CG1 led to enhanced salt tolerance, whereas its loss of function caused decreased salt tolerance. These results indicate that AtPP2CG1 positively regulates salt stress in an ABA-dependent manner. Under salt treatment, AtPP2CG1 up-regulated the expression levels of stress-responsive genes, including RD29A, RD29B, DREB2A and KIN1. GUS activity was detected in roots, leaves, stems, flower, and trichomes of AtPP2CG1 promoter-GUS transgenic plants. AtPP2CG1 protein was localized in nucleus and cytoplasm via AtPP2CG1:eGFP and YFP:AtPP2CG1 fusion approaches.

  20. Modeling of Pulses in Terrestrial Gamma-ray Flashes

    Science.gov (United States)

    Xu, Wei; Celestin, Sebastien; Pasko, Victor

    2015-04-01

    Terrestrial Gamma-ray Flashes (TGFs) are high-energy photon bursts originating from the Earth's atmosphere that are associated with lightning activities. After their discovery in 1994 by the Burst and Transient Source Experiment (BATSE) detector aboard the Compton Gamma-Ray Observatory [Fishman et al., Science, 264, 1313, 1994], this phenomenon has been further observed by the Reuven Ramaty High Energy Solar Spectroscopic Imager (RHESSI) [Smith et al., Science, 307, 1085, 2005], the Fermi Gamma-ray Space Telescope [Briggs et al., JGR, 115, A07323, 2010] and the Astrorivelatore Gamma a Immagini Leggero (AGILE) satellite [Marisaldi et al., JGR, 115, A00E13, 2010]. Photon spectra corresponding to the mechanism of relativistic runaway electron avalanches (RREAs) usually provide a very good agreement with satellite observations [Dwyer and Smith, GRL, 32, L22804, 2005]. On the other hand, Celestin and Pasko [JGR, 116, A03315, 2011] have shown theoretically that the large flux of thermal runaway electrons generated by streamers during the negative corona flash stage of stepping lightning leaders in intracloud lightning flashes could be responsible for TGFs. Recently, based on analysis of the temporal profiles of 278 TGF events observed by the Fermi Gamma-Ray Burst Monitor, Foley et al. [JGR, 119, 5931, 2014] have suggested that 67% of TGF pulses detected are asymmetric and these asymmetric pulses are consistent with the production mechanism of TGFs by relativistic feedback discharges. In the present work, we employ a Monte Carlo model to study the temporal distribution of photons at low-orbit satellite altitudes during TGF events. Using the pulse fitting method described in [Foley et al., 2014], we further investigate the characteristics of TGF pulses. We mainly focus on the effects of Compton scattering on the symmetry properties and the rise and fall times of TGF pulses.

  1. The relativistic feedback discharge model of terrestrial gamma ray flashes

    Science.gov (United States)

    Dwyer, Joseph R.

    2012-02-01

    As thunderclouds charge, the large-scale fields may approach the relativistic feedback threshold, above which the production of relativistic runaway electron avalanches becomes self-sustaining through the generation of backward propagating runaway positrons and backscattered X-rays. Positive intracloud (IC) lightning may force the large-scale electric fields inside thunderclouds above the relativistic feedback threshold, causing the number of runaway electrons, and the resulting X-ray and gamma ray emission, to grow exponentially, producing very large fluxes of energetic radiation. As the flux of runaway electrons increases, ionization eventually causes the electric field to discharge, bringing the field below the relativistic feedback threshold again and reducing the flux of runaway electrons. These processes are investigated with a new model that includes the production, propagation, diffusion, and avalanche multiplication of runaway electrons; the production and propagation of X-rays and gamma rays; and the production, propagation, and annihilation of runaway positrons. In this model, referred to as the relativistic feedback discharge model, the large-scale electric fields are calculated self-consistently from the charge motion of the drifting low-energy electrons and ions, produced from the ionization of air by the runaway electrons, including two- and three-body attachment and recombination. Simulation results show that when relativistic feedback is considered, bright gamma ray flashes are a natural consequence of upward +IC lightning propagating in large-scale thundercloud fields. Furthermore, these flashes have the same time structures, including both single and multiple pulses, intensities, angular distributions, current moments, and energy spectra as terrestrial gamma ray flashes, and produce large current moments that should be observable in radio waves.

  2. The imaging performance of flash memory masks characterized with AIMS

    Science.gov (United States)

    van Setten, Eelco; Wismans, Onno; Grim, Kees; Finders, Jo; Dusa, Mircea; Birkner, Robert; Richter, Rigo; Scherübl, Thomas

    2009-04-01

    Flash memory is an important driver of the lithography roadmap, with its dramatic acceleration in dimensional shrink, pushing for ever smaller feature sizes. The introduction of hyper-NA immersion lithography has brought the 45nm node and below within reach for memory makers using single exposure. At these feature sizes mask topology and the material properties of the film stack on the mask play an important role on imaging performance. Furthermore, the break up of the array pitch regularity in the NAND-type flash memory cell by two thick wordlines and a central space, leads to feature-center placement (overlay) errors, that are inherent to the design. An integral optimization approach is needed to mitigate these effects and to control both the CD and placement errors tightly. In this paper we will show that aerial image measurements at mask-level are useful for characterizing the gate layer of a NAND-Flash design before exposure. The aerial image measurements are performed with the AIMSTM 45-193i. and compared to CD measurements on the wafer obtained with an XT:1900Gi hyper-NA immersion system. An excellent correlation is demonstrated for feature-center placement errors and CD variations across the mask (see Figure 1) for several features in the gate layer down to 40nm half pitch. This shows the potential to use aerial image measurements at mask-level in combination with correction techniques on the photomask, like the CDC200 tool in combination with exposure tool correction techniques, such as DoseMapperTM, to improve both across field and across wafer CD uniformity of critical layers.

  3. The development of a flash flood severity index

    Science.gov (United States)

    Schroeder, Amanda J.; Gourley, Jonathan J.; Hardy, Jill; Henderson, Jen J.; Parhi, Pradipta; Rahmani, Vahid; Reed, Kimberly A.; Schumacher, Russ S.; Smith, Brianne K.; Taraldsen, Matthew J.

    2016-10-01

    Flash flooding is a high impact weather event that requires clear communication regarding severity and potential hazards among forecasters, researchers, emergency managers, and the general public. Current standards used to communicate these characteristics include return periods and the United States (U.S.) National Weather Service (NWS) 4-tiered river flooding severity scale. Return periods are largely misunderstood, and the NWS scale is limited to flooding on gauged streams and rivers, often leaving out heavily populated urban corridors. To address these shortcomings, a student-led group of interdisciplinary researchers came together in a collaborative effort to develop an impact-based Flash Flood Severity Index (FFSI). The index was proposed as a damage-based, post-event assessment tool, and preliminary work toward the creation of this index has been completed and presented here. Numerous case studies were analyzed to develop the preliminary outline for the FFSI, and three examples of such cases are included in this paper. The scale includes five impact-based categories ranging from Category 1 very minor flooding to Category 5 catastrophic flooding. Along with the numerous case studies used to develop the initial outline of the scale, empirical data in the form of semi-structured interviews were conducted with multiple NWS forecasters across the country and their responses were analyzed to gain more perspective on the complicated nature of flash flood definitions and which tools were found to be most useful. The feedback from these interviews suggests the potential for acceptance of such an index if it can account for specific challenges.

  4. Integrated flash flood vulnerability assessment: Insights from East Attica, Greece

    Science.gov (United States)

    Karagiorgos, Konstantinos; Thaler, Thomas; Heiser, Micha; Hübl, Johannes; Fuchs, Sven

    2016-10-01

    In the framework of flood risk assessment, vulnerability is a key concept to assess the susceptibility of elements at risk. Besides the increasing amount of studies on flash floods available, in-depth information on vulnerability in Mediterranean countries was missing so far. Moreover, current approaches in vulnerability research are driven by a divide between social scientists who tend to view vulnerability as representing a set of socio-economic factors, and natural scientists who view vulnerability in terms of the degree of loss to an element at risk. Further, vulnerability studies in response to flash flood processes are rarely answered in the literature. In order to close this gap, this paper implemented an integrated vulnerability approach focusing on residential buildings exposed to flash floods in Greece. In general, both physical and social vulnerability was comparable low, which is interpreted as a result from (a) specific building regulations in Greece as well as general design principles leading to less structural susceptibility of elements at risk exposed, and (b) relatively low economic losses leading to less social vulnerability of citizens exposed. The population show high risk awareness and coping capacity to response to natural hazards event and in the same time the impact of the events are quite low, because of the already high use of local protection measures. The low vulnerability score for East Attica can be attributed especially to the low physical vulnerability and the moderate socio-economic well-being of the area. The consequence is to focus risk management strategies mainly in the reduction of the social vulnerability. By analysing both physical and social vulnerability an attempt was made to bridge the gap between scholars from sciences and humanities, and to integrate the results of the analysis into the broader vulnerability context.

  5. Temperature distribution study in flash-annealed amorphous ribbons

    International Nuclear Information System (INIS)

    Moron, C.; Garcia, A.; Carracedo, M.T.

    2003-01-01

    Negative magnetrostrictive amorphous ribbons have been locally current annealed with currents from 1 to 8 A and annealing times from 14 ms to 200 s. In order to obtain information about the sample temperature during flash or current annealing, a study of the temperature dispersion during annealing in amorphous ribbons was made. The local temperature variation was obtained by measuring the local intensity of the infrared emission of the sample with a CCD liquid nitrogen cooled camera. A distribution of local temperature has been found in spite of the small dimension of the sample

  6. Homogeneous nonequilibrium critical flashing flow with a cavity flooding model

    International Nuclear Information System (INIS)

    Lee, S.Y.; Schrock, V.E.

    1989-01-01

    The primary purpose of the work presented here is to describe the model for pressure undershoot at incipient flashing in the critical flow of straight channels (Fanno-type flow) for subcooled or saturated stagnation conditions on a more physical basis. In previous models, a modification of the pressure undershoot prediction of Alamgir and Lienhard was used. Their method assumed nucleation occurs on the bounding walls as a result of molecular fluctuations. Without modification it overpredicts the pressure undershoot. In the present work the authors develop a mechanistic model for nucleation from wall cavities. This physical concept is more consistent with experimental data

  7. Development and Evaluation of MOOSES games in Flash/Macromedia

    OpenAIRE

    Ekse, Magnus Førland

    2010-01-01

    Video games are very popular today and the electronic entertainment industry is in many areas equal to the more mature entertainment industries like film and music in terms of usage and revenues. The MOOSES (Multiplayer On One Screen Entertainment System) allows players to play on one big screen together with the use of their mobile phone as a game controller. The framework was designed for easy development of multiplayer games in Java and C++.Flash is a very popular technology on the Interne...

  8. Accuracy of a Flash Glucose Monitoring System in Diabetic Dogs

    OpenAIRE

    Corradini, S.; Pilosio, B.; Dondi, F.; Linari, G.; Testa, S.; Brugnoli, F.; Gianella, P.; Pietra, M.; Fracassi, F.

    2016-01-01

    Background A novel flash glucose monitoring system (FGMS) (FreeStyle Libre, Abbott, UK) was recently developed for humans. It continuously measures the interstitial glucose (IG) concentrations for 14 days. Objectives To assess the clinical and analytical accuracy of the FGMS in diabetic dogs. Animals Ten client?owned diabetic dogs on insulin treatment. Methods Prospective and observational study. The FGMS was placed on the neck for up to 14 days. During the 1st?2nd, 6?7th, and 13?14th days fr...

  9. Frequency upshift via flash ionization phenomena using semiconductor plasma

    Directory of Open Access Journals (Sweden)

    Nishida A.

    2013-11-01

    Full Text Available We have demonstrated frequency upshift in the terahertz region by flash ionization. The magnitude of upshift frequency is tuned by the laser intensity. A proof of principle experiment has been performed with a plasma creation time scale much shorter than the period of the electromagnetic wave and a plasma length longer than its wavelength. Frequency upshifted from 0.35 to 3.5 THz by irradiating a ZnSe crystal with a ultra-short laser pulse has been observed.

  10. PecS regulates the urate-responsive expression of type 1 fimbriae in Klebsiella pneumoniae CG43.

    Science.gov (United States)

    Wang, Zhe-Chong; Liu, Chia-Jui; Huang, Ying-Jung; Wang, Yu-Seng; Peng, Hwei-Ling

    2015-12-01

    In the Klebsiella pneumoniae CG43 genome, the divergently transcribed genes coding for PecS, the MarR-type transcription factor, and PecM, the drug metabolite transporter, are located between the type 1 and type 3 fimbrial gene clusters. The intergenic sequence pecO between pecS and pecM contains three putative PecS binding sites and a CpxR box. Electrophoretic mobility shift assay revealed that the recombinant PecS and CpxR could specifically bind to the pecO sequence, and the specific interaction of PecS and pecO could be attenuated by urate. The expression of pecS and pecM was negatively regulated by CpxAR and PecS, and was inducible by exogenous urate in the absence of cpxAR. Compared with CG43S3ΔcpxAR, the derived mutants CG43S3ΔcpxARΔpecS and CG43S3ΔcpxARΔpecSΔpecM exerted similar levels of sensitivity to H2O2 or paraquat, but higher levels of mannose-sensitive yeast agglutination activity and FimA production. The promoter activity and transcript levels of fimA in CG43S3ΔcpxAR were also increased by deleting pecS. However, no binding activity between PecS and the fimA promoter could be observed. Nevertheless, PecS deletion could reduce the expression of the global regulator HNS and release the negative effect of HNS on FimA expression. In CG43S3ΔcpxAR, the expression of FimA as well as PecS was inducible by urate, whilst urate-induced FimA expression was inhibited by the deletion of pecS. Taken together, we propose that K. pneumoniae PecS indirectly and negatively regulates the expression of type 1 fimbriae, and the regulation is urate-inducible in the absence of CpxAR.

  11. RURAL FLASH-FLOOD BEHAVIOR IN GOUYAVE WATERSHED, GRENADA, CARIBBEAN ISLAND

    Directory of Open Access Journals (Sweden)

    Rahmat Aris Pratomo

    2016-10-01

    Full Text Available Flash-flood is considered as one of the most common natural disasters in Grenada, a tropical small state island in Caribbean Island. Grenada has several areas which are susceptible to flooding. One of them is Gouyave town which is located in the north-west of Grenada. Its land-use types are highly dominated by green areas, especially in the upper-part of the region. The built-up areas can only be found in the lower-part of Gouyave watershed, near the coastal area. However, there were many land conversions from natural land-use types into built-up areas in the upper-part region. They affected the decrease of water infiltration and the increase of potential run-off, making these areas susceptible to flash-flood. In addition, it is also influenced by the phenomenon of climate change. Changes in extreme temperature increase higher potential of hurricanes or wind-storm, directly related to the potential escalation of flash-flood. To develop effective mitigation strategies, understanding the behavior of flash-flood is required. The purpose of this paper was to observe the behavior of flash-flood in Gouyave watershed in various return periods using OpenLISEM software. It was used to develop and analyse the flash-flood characteristics. The result showed that the climatic condition (rainfall intensity and land-use are influential to the flash-flood event. Flash-flood occurs in 35 and 100 years return period. Flash-flood inundates Gouyave’s area in long duration, with below 1 m flood depth. The flood propagation time is slow. This condition is also influenced by the narrower and longer of Gouyave basin shape. To develop flash-flood reduction strategies, the overall understanding of flash-flood behavior is important. If the mitigation strategy is adapted to their behavior, the implementation will be more optimum.

  12. Multi-Sensory Approach to Search for Young Stellar Objects in CG4

    Science.gov (United States)

    Hoette, Vivian L.; Rebull, L. M.; McCarron, K.; Johnson, C. H.; Gartner, C.; VanDerMolen, J.; Gamble, L.; Matche, L.; McCartney, A.; Doering, M.; Crump, R.; Laorr, A.; Mork, K.; Steinbergs, E.; Wigley, E.; Caruso, S.; Killingstad, N.; McCanna, T.

    2011-01-01

    Individuals with disabilities - specifically individuals who are deaf or hard of hearing (DHH) and/or blind and visually-impaired (BVI) - have traditionally been underrepresented in the fields of Science, Technology, Engineering, and Math (STEM). The low incidence rate of these populations, coupled with geographic isolation, creates limited opportunities for students to work with and receive mentoring by professionals who not only have specialty knowledge in disability areas but also work in STEM fields. Yerkes Observatory scientists, along with educators from the Wisconsin School for the Deaf, the Wisconsin Center for the Blind and Visually Impaired, Breck School, and Oak Park and River Forest High School, are engaged in active research with a Spitzer Science Center (SSC) scientist. Our ultimate goals are threefold; to engage DHH and BVI students with equal success as their sighted and hearing peers, to share our techniques to make astronomy more accessible to DHH and BVI youth, and to generate a life-long interest which will lead our students to STEM careers. This poster tracks our work with an SSC scientist during the spring, summer, and fall of 2010. The group coauthored another AAS poster on finding Young Stellar Objects (YSO) in the CG4 Nebula in Puppis. During the project, the students, scientists and teachers developed a number of techniques for learning the necessary science as well as doing the required data acquisition and analysis. Collaborations were formed between students with disabilities and their non-disabled peers to create multi-media projects. Ultimately, the projects created for our work with NITARP will be disseminated through our professional connections in order to ignite a passion for astronomy in all students - with and without disabilities. This research was made possible through the NASA/IPAC Teacher Archive Research Project (NITARP) and was funded by NASA Astrophysics Data Program and Archive Outreach funds.

  13. NDDP multi-stage flash desalination process simulator design

    International Nuclear Information System (INIS)

    Chatterjee, M.; Sashi Kumar, G.N.; Mahendra, A.K.; Sanyal, A.; Gouthaman, G.

    2006-05-01

    A majority of large-scale desalination plants all over the world employ multi-stage flash (MSF) distillation process. Many of these MSF desalination plants have been set up near to nuclear power plants (generally called as nuclear desalination plants) to effectively utilize the low-grade steam from the power plants as the source of energy. A computer program called MSFSIM has been developed to simulate the MSF desalination plant operation both for steady state and various transients including start up. This code predicts the effect of number of stages, flashing temperature, velocity of brine flowing through the tubes of brine heater and evaporators, temperature of the condensing thin film etc. on the plant performance ratio. Such a code can be used for the design of a new plant and to predict its operating and startup characteristics. The code has been extensively validated with available start up data from the pilot MSF desalination plant of 425-m3/day capacity at Trombay, Mumbai. A MSF desalination plant of 4500-m3/day capacity is under construction by BARC at Kalpakkam, which will utilize the steam from Madras Atomic Power Station (MAPS). In this present work extensive parametric study of the 4500-m3/day capacity desalination plant at Kalpakkam has been done using the code MSFSIM for optimizing the operating parameters in order to maximize the performance ratio for stable plant operation. The aim of the work is prediction of plant performance under different operating conditions. (author)

  14. Flash characteristics of plasma induced by hypervelocity impact

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Kai [State Key Laboratory of Explosion Science and Technology, Beijing Institute of Technology, Beijing 100081 (China); Beijing Automotive Technology Center, Beijing 100021 (China); Long, Renrong, E-mail: longrenrong@bit.edu.cn, E-mail: qmzhang@bit.edu.cn; Zhang, Qingming, E-mail: longrenrong@bit.edu.cn, E-mail: qmzhang@bit.edu.cn; Xue, Yijiang; Ju, Yuanyuan [State Key Laboratory of Explosion Science and Technology, Beijing Institute of Technology, Beijing 100081 (China)

    2016-08-15

    Using a two-stage light gas gun, a series of hypervelocity impact experiments was conducted in which 6.4-mm-diameter spherical 2024-aluminum projectiles impact 23-mm-thick targets made of the same material at velocities of 5.0, 5.6, and 6.3 km/s. Both an optical pyrometer composed of six photomultiplier tubes and a spectrograph were used to measure the flash of the plasma during hypervelocity impact. Experimental results show that, at a projectile velocity of 6.3 km/s, the strong flash lasted about 10 μs and reached a temperature of 4300 K. Based on the known emission lines of AL I, spectral methods can provide the plasma electron temperature. An electron-temperature comparison between experiment and theoretical calculation indicates that single ionization and secondary ionization are the two main ionizing modes at velocities 5.0–6.3 km/s.

  15. Devolatilization characteristics of biomass at flash heating rate

    Energy Technology Data Exchange (ETDEWEB)

    Xiu Shuangning; Li Zhihe; Li Baoming; Yi Weiming; Bai Xueyuan [China Agricultural University, Beijing (China). College of Water Conservancy and Civil Engineering

    2006-03-15

    The devolatilization characteristics of biomass (wheat straw, coconut shell, rice husk and cotton stalk) during flash pyrolysis has been investigated on a plasma heated laminar entrained flow reactor (PHLEFR) with average heating rates of 10{sup 4} K/s. These experiments were conducted with steady temperatures between 750 and 900 K, and the particle residence time varied from about 0.115 to 0.240 s. The ash tracer method was introduced to calculate the yield of volatile products at a set temperature and the residence time. This experimental study showed that the yield of volatile products depends both on the final pyrolysis temperature and the residence time. From the results, a comparative analysis was done for the biomasses, and a one-step global model was used to simulate the flash pyrolytic process and predict the yield of volatile products during pyrolysis. The corresponding kinetic parameters of the biomasses were also analyzed and determined. These results were essential for designing a suitable pyrolysis reactor. 24 refs., 5 figs., 5 tabs.

  16. A deafening flash! Visual interference of auditory signal detection.

    Science.gov (United States)

    Fassnidge, Christopher; Cecconi Marcotti, Claudia; Freeman, Elliot

    2017-03-01

    In some people, visual stimulation evokes auditory sensations. How prevalent and how perceptually real is this? 22% of our neurotypical adult participants responded 'Yes' when asked whether they heard faint sounds accompanying flash stimuli, and showed significantly better ability to discriminate visual 'Morse-code' sequences. This benefit might arise from an ability to recode visual signals as sounds, thus taking advantage of superior temporal acuity of audition. In support of this, those who showed better visual relative to auditory sequence discrimination also had poorer auditory detection in the presence of uninformative visual flashes, though this was independent of awareness of visually-evoked sounds. Thus a visually-evoked auditory representation may occur subliminally and disrupt detection of real auditory signals. The frequent natural correlation between visual and auditory stimuli might explain the surprising prevalence of this phenomenon. Overall, our results suggest that learned correspondences between strongly correlated modalities may provide a precursor for some synaesthetic abilities. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. The mutagenic potential of high flash aromatic naphtha.

    Science.gov (United States)

    Schreiner, C A; Edwards, D A; McKee, R H; Swanson, M; Wong, Z A; Schmitt, S; Beatty, P

    1989-06-01

    Catalytic reforming is a refining process that converts naphthenes to aromatics by dehydrogenation to make higher octane gasoline blending components. A portion of this wide boiling range hydrocarbon stream can be separated by distillation and used for other purposes. One such application is a mixture of predominantly 9-carbon aromatic molecules (C9 aromatics, primarily isomers of ethyltoluene and trimethylbenzene), which is removed and used as a solvent--high-flash aromatic naphtha. A program was initiated to assess the toxicological properties of high-flash aromatic naphtha since there may be human exposure through inhalation or external body contact. The current study was conducted partly to assess the potential for mutagenic activity and also to assist in an assessment of carcinogenic potential. The specific tests utilized included the Salmonella/mammalian microsome mutagenicity assay, the hypoxanthine-guanine phosphoribosyl transferase (HGPRT) forward mutation assay in CHO cells, in vitro chromosome aberration and sister chromatid exchange (SCE) assays in CHO cells, and an in vivo chromosome aberration assay in rat bone marrow.

  18. Flash vaporization during earthquakes evidenced by gold deposits

    Science.gov (United States)

    Weatherley, Dion K.; Henley, Richard W.

    2013-04-01

    Much of the world's known gold has been derived from arrays of quartz veins. The veins formed during periods of mountain building that occurred as long as 3 billion years ago, and were deposited by very large volumes of water that flowed along deep, seismically active faults. The veins formed under fluctuating pressures during earthquakes, but the magnitude of the pressure fluctuations and their influence on mineral deposition is not known. Here we use a simple thermo-mechanical piston model to calculate the drop in fluid pressure experienced by a fluid-filled fault cavity during an earthquake. The geometry of the model is constrained using measurements of typical fault jogs, such as those preserved in the Revenge gold deposit in Western Australia, and other gold deposits around the world. We find that cavity expansion generates extreme reductions in pressure that cause the fluid that is trapped in the jog to expand to a very low-density vapour. Such flash vaporization of the fluid results in the rapid co-deposition of silica with a range of trace elements to form gold-enriched quartz veins. Flash vaporization continues as more fluid flows towards the newly expanded cavity, until the pressure in the cavity eventually recovers to ambient conditions. Multiple earthquakes progressively build economic-grade gold deposits.

  19. Development of BNL Heat Transfer Facility 1: flashing experiments

    International Nuclear Information System (INIS)

    Leonhardt, W.J.; Klein, J.H.; Zimmer, G.A.; Abuaf, N.; Jones, O.C. Jr.

    1979-01-01

    A major area of interest to reactor safety technology is the prediction of actual vapor generation rates under conditions of thermal nonequilibrium as would be encountered during a loss-of-coolant accident (LOCA) in a light water reactor. In support of the development of advanced codes dealing with LOCA induced flashing, analytical models of the nonequilibrium vapor generation processes of interest have been formulated, and an experimental facility has been constructed to provide data to verify these models. This facility is known as BNL Heat Transfer Facility. The experimental facility consists of a flow loop, test section and the data acquisition and analysis system. The main portion of the flow loop is constructed from three inch nominal (7.6 cm) stainless steel pipe. High purity water is circulated through the loop using a centrifugal pump rated 1500 l/min at 600 kPa. Very close and stable control of all loop parameters is required since flashing is sensitive to very small changes in such parameters as flow rate, subcooling, and pressure

  20. Pengembangan Program Macromedia Flash 8 untuk Pembelajaran Fisika di SMA

    Directory of Open Access Journals (Sweden)

    Wiji Susilowati

    2007-12-01

    Full Text Available Tujuan penelitian adalah membuat dan mengevaluasi media pembelajaran fisika SMA menggunakan program Macromedia Flash 8. Subjek coba pada penelitian ini berjumlah 40 orang yang terdiri dari 10 siswa untuk uji coba instrumen penelitian, 10 siswa untuk ujicoba kelompok kecdl, dan 20 siswa untuk uji coba lapangan. Pengumpulan data dilakukan dengan mengguna­kan kuesioner dan tes fisika (pre-test dan post-test. Evaluasi terhadap program ditinjau dari aspek pembelajaran dan aspek media. Kritik dan saran digunakan untuk memperbaiki program. Hasil penelitian menunjukkan bahwa program Macromedia Flash 8 untuk pembelajaran fisika di SMA: (1 dirancang sesuai dengan prinsip-prinsip desain pembelajaran, (2 terbukti mampu menaikkan skor rerata tes fisika siswa sebesar 55,42%, (3 memiliki efisiensi waktu yang tinggi, (4 ditinjau dari aspek media Hinilai cukup bagus/menarik (dinilai/dikategorikan sedang oleh siswa, (5 ditinjau dari aspek pembelajaran secara keseluruhan program ini dinilai tinggi/jelas dimengerti oleh siswa, (6 ditinjau dari aspek media dinilai menarik (bagus/kategori tinggi oleh guru fisika, dan (7 ditinjau dari aspek pembelajaran juga dinilai menarik (bagus/kategori tinggi oleh guru fisika. Kata kunci: media pembelajaran fisika diSMA.

  1. FLASH: A finite element computer code for variably saturated flow

    International Nuclear Information System (INIS)

    Baca, R.G.; Magnuson, S.O.

    1992-05-01

    A numerical model was developed for use in performance assessment studies at the INEL. The numerical model, referred to as the FLASH computer code, is designed to simulate two-dimensional fluid flow in fractured-porous media. The code is specifically designed to model variably saturated flow in an arid site vadose zone and saturated flow in an unconfined aquifer. In addition, the code also has the capability to simulate heat conduction in the vadose zone. This report presents the following: description of the conceptual frame-work and mathematical theory; derivations of the finite element techniques and algorithms; computational examples that illustrate the capability of the code; and input instructions for the general use of the code. The FLASH computer code is aimed at providing environmental scientists at the INEL with a predictive tool for the subsurface water pathway. This numerical model is expected to be widely used in performance assessments for: (1) the Remedial Investigation/Feasibility Study process and (2) compliance studies required by the US Department of Energy Order 5820.2A

  2. Investigation of flashing de-aeration with and without recirculation

    International Nuclear Information System (INIS)

    Kjellstroem, B.; Toecksberg, B.

    1977-06-01

    A series of experiments with flashing de-areation has been carried out at the institute of Thermal Energytechnology of the Royal Institute of Technology in Stockholm. The results of the experiments with flashing de-areation without recirculation of the condensate show very low contents of dissolved oxygen in the de-aerated water. The results indicate that the de-aeration process is independent of the pressure. De-aeration efficiencies over 99 percent were measured. The continued experiments with recirculation of the condensate show a considerably deteriorated de-aeration performance together with a marked pressure dependency. A simple theoretical model has been formulated which explains these results. Comparisons between the experimental data and calculations with this model indicate that a conservative estimation of the oxygen content of the outgoing water can be obtained if the oxygen content of the recirculated condensate is calculated for the partial pressure of noncondensible gases equal to the total pressure in the condensor. It seems also possible to estimate a lower limit for the oxygen content of the outgoing water. The range of oxygen content between those limits is about a factor of 10 for the conditions investigated. Further studies of the uptake of oxygen during condensation seem necessary if a more accurate prediction is desired

  3. Nuclear fusion and carbon flashes on neutron stars

    Science.gov (United States)

    Taam, R. E.; Picklum, R. E.

    1978-01-01

    This paper reports on detailed calculations of the thermal evolution of the carbon-burning shells in the envelopes of accreting neutron stars for mass-accretion rates of 1 hundred-billionth to 2 billionths of a solar mass per yr and neutron-star masses of 0.56 and 1.41 solar masses. The work of Hansen and Van Horn (1975) is extended to higher densities, and a more detailed treatment of nuclear processing in the hydrogen- and helium-burning regions is included. Results of steady-state calculations are presented, and results of time-dependent computations are examined for accretion rates of 3 ten-billionths and 1 billionth of solar mass per yr. It is found that two evolutionary sequences lead to carbon flashes and that the carbon abundance at the base of the helium shell is a strong function of accretion rate. Upper limits are placed on the accretion rates at which carbon flashes will be important.

  4. Optimal proximity correction: application for flash memory design

    Science.gov (United States)

    Chen, Y. O.; Huang, D. L.; Sung, K. T.; Chiang, J. J.; Yu, M.; Teng, F.; Chu, Lung; Rey, Juan C.; Bernard, Douglas A.; Li, Jiangwei; Li, Junling; Moroz, V.; Boksha, Victor V.

    1998-06-01

    Proximity Correction is the technology for which the most of IC manufacturers are committed already. The final intended result of correction is affected by many factors other than the optical characteristics of the mask-stepper system, such as photoresist exposure, post-exposure bake and development parameters, etch selectivity and anisotropy, and underlying topography. The most advanced industry and research groups already reported immediate need to consider wafer topography as one of the major components during a Proximity Correction procedure. In the present work we are discussing the corners rounding effect (which eventually cause electrical leakage) observed for the elements of Poly2 layer for a Flash Memory Design. It was found that the rounding originated by three- dimensional effects due to variation of photoresist thickness resulting from the non-planar substrate. Our major goal was to understand the reasons and correct corner rounding. As a result of this work highly effective layout correction methodology was demonstrated and manufacturable Depth Of Focus was achieved. Another purpose of the work was to demonstrate complete integration flow for a Flash Memory Design based on photolithography; deposition/etch; ion implantation/oxidation/diffusion; and device simulators.

  5. Practice of the Education for the Principle of Otto Cycle by the E-Learning CG-Content

    Science.gov (United States)

    Sato, Tomoaki; Nagaoka, Keizo; Oguchi, Kosei

    A CG-animation content which supports the learning of the Otto cycle was developed. This content has a piston assembly and the diagrams of PV, VS, TP and TS. The each diagram has a pointer which moves along the line of the graph and they are synchronized with the movement of the piston. The learners can operate this content directly on the e-learning system. While watching the movements of the piston assembly, the learners can confirm the state of the engine about temperature, pressure, volume, and entropy by the synchronized pointer on the diagrams. This content was used for the class of the machining practice exercise. The learning effect of the content was examined by the score of the short test. As the result of this examination, the CG-animation content was effective in the learning of the Otto cycle.

  6. A Bayesian Network approach for flash flood risk assessment

    Science.gov (United States)

    Boutkhamouine, Brahim; Roux, Hélène; Pérès, François

    2017-04-01

    Climate change is contributing to the increase of natural disasters such as extreme weather events. Sometimes, these events lead to sudden flash floods causing devastating effects on life and property. Most recently, many regions of the French Mediterranean perimeter have endured such catastrophic flood events; Var (October 2015), Ardèche (November 2014), Nîmes (October 2014), Hérault, Gard and Languedoc (September 2014), and Pyrenees mountains (Jun 2013). Altogether, it resulted in dozens of victims and property damages amounting to millions of euros. With this heavy loss in mind, development of hydrological forecasting and warning systems is becoming an essential element in regional and national strategies. Flash flood forecasting but also monitoring is a difficult task because small ungauged catchments ( 10 km2) are often the most destructive ones as for the extreme flash flood event of September 2002 in the Cévennes region (France) (Ruin et al., 2008). The problem of measurement/prediction uncertainty is particularly crucial when attempting to develop operational flash-flood forecasting methods. Taking into account the uncertainty related to the model structure itself, to the model parametrization or to the model forcing (spatio-temporal rainfall, initial conditions) is crucial in hydrological modelling. Quantifying these uncertainties is of primary importance for risk assessment and decision making. Although significant improvements have been made in computational power and distributed hydrologic modelling, the issue dealing with integration of uncertainties into flood forecasting remains up-to-date and challenging. In order to develop a framework which could handle these uncertainties and explain their propagation through the model, we propose to explore the potential of graphical models (GMs) and, more precisely, Bayesian Networks (BNs). These networks are Directed Acyclic Graphs (DAGs) in which knowledge of a certain phenomenon is represented by

  7. A Conceptual Flash Flood Early Warning System for Africa, Based on Terrestrial Microwave Links and Flash Flood Guidance

    Directory of Open Access Journals (Sweden)

    Joost C. B. Hoedjes

    2014-04-01

    Full Text Available A conceptual flash flood early warning system for developing countries is described. The system uses rainfall intensity data from terrestrial microwave communication links and the geostationary Meteosat Second Generation satellite, i.e., two systems that are already in place and operational. Flash flood early warnings are based on a combination of the Flash Flood Guidance method and a hydrological model. The system will be maintained and operated through a public-private partnership, which includes a mobile telephone operator, a national meteorological service and an emergency relief service. The mobile telephone operator acts as both the supplier of raw input data and the disseminator of early warnings. The early warning system could significantly reduce the number of fatalities due to flash floods, improve the efficiency of disaster risk reduction efforts and play an important role in strengthening the resilience to climate change of developing countries in Africa. This paper describes the system that is currently being developed for Kenya.

  8. Use of reduced doses of eCG applied by different routes in the TAI program in Santa Ines sheep

    Directory of Open Access Journals (Sweden)

    Karla Dias Antunes-Melo

    2015-06-01

    Full Text Available The aims of this study were to improve the cost-benefit ratio of the application of artificial insemination in fixed time (TAI by the transcervical route in sheep, to test the dosage reduction and the use of the vulvar submucosa (VSM route as an alternative for the application of equine chorionic gonadotropin (eCG on the efficiency of the synchronization protocol and fertility to artificial insemination (AI and to measure the level of cortisol in ewes as a result the application of this biotechnique. Blood samples were collected before AI, immediately after AI and seven days after AI. Six groups of twenty animals were used, and each group received doses of 200, 300 and 400 IU of eCG by the intramuscular route (IM and VSM. Estrus was detected, and 48 hours later, the inseminations were performed by the transcervical route. Among the 120 treated ewes, 87.5% came in estrus. The percentage of the intrauterine deposition of semen was 88.3%. The pregnancy rate ranged from 20 to 70% between treatments, with an average of 46.66%. The VSM route was viable for the application of eCG in doses of 300 and 400 IU. The reduction in the eCG dose to 200 IU by the IM route reduces costs while maintaining the efficiency of estrus synchronization protocols and TAI with frozen semen in Santa Ines ewes. The average levels of cortisol were significant, at 1.15, 2.86 and 0.52 ?g/dL according to the three collections, being higher after the animal was off the easel at the end of AI. The procedures for performing the transcervical AI technique indicate that stress in the animals produces satisfactory fertility results and a low cost in multiparous ewes of the Santa Ines breed.

  9. Production of bio-oils from wood by flash pyrolysis; Herstellung von Bio-Oelen aus Holz in einer Flash-Pyrolyseanlage

    Energy Technology Data Exchange (ETDEWEB)

    Meier, D; Ollesch, T [Bundesforschungsanstalt fuer Forst- und Holzwirtschaft, Hamburg (Germany). Inst. fuer Holzchemie und Chemische Technologie des Holzes; Gerdes, C; Kaminsky, W [Hamburg Univ. (Germany). Inst. fuer Technische und Makromolekulare Chemie (ITMCh)

    1998-09-01

    Flash pyrolysis is a medium-temperature process (around 475 C) in which biomass is heated up rapidly in the absence of oxygen. The pyrolysis products are cooled down rapidly, condensing into a reddish-brown liquid with around half the calorific value of a conventional heating oil. In contrast to conventional charcoal production, flash pyrolysis is a modern process whose process parameters enure high liquid yields. Modern fluidized-bed reactors for flash pyrolysis of biomass tend to have high heating rates and short times of residue. In the `Hamburg process`, fluidized-bed reactors are used successfully for pyrolysis of plastics. A flash pyrolysis plant for biomass treatment was constructed in cooperation with Hamburg University with funds provided by the `Bundesstiftung Umwelt`. This contribution describes the first series of experiments, mass balances and oil analyses using beech wood as material to be pyrolyzed. (orig./SR) [Deutsch] Flash-Pyrolyse ist ein Mitteltemperatur-Prozess (ca. 475 C), in dem Biomasse unter Sauerstoffausschluss sehr schnell erhitzt wird. Die entstehenden Pyrolyseprodukte werden schnell abgekuehlt und kondensieren zu einer roetlich-braunen Fluessigkeit, die etwa die Haelfte des Heizwertes eines konventionellen Heizoeles besitzt. Flash-Pyrolyse ist, im Gegensatz zur konventionellen Holzverkohlung, ein modernes Verfahren, dessen spezielle Verfahrensparameter hohe Fluessigausbeuten ermoeglichen. Hohe Aufheizraten, verbunden mit kurzen Verweilzeiten, werden mit stationaeren Wirbelbettreaktoren erzielt die gegenwaertig vorwiegend fuer die Flash-Pyrolyse von Biomasse eingesetzt werden. Im `Hamburger Verfahren` haben sich Wirbelbettreaktoren im Bereich der Kunststoffpyrolyse bewaehrt. Daher wurde in Zusammenarbeit mit der Universitaet Hamburg und finanzieller Foerderung der Bundesstiftung Umwelt eine Flash-Pyrolyseanlage fuer Biomasse gebaut: In dieser Arbeit werden erste Versuchsreihen, Massenbilanzen und Oelanalysen aus der Pyrolyse von

  10. Flash Study Analysis and the Music Learning Pro-Files Project

    Science.gov (United States)

    Cremata, Radio; Pignato, Joseph; Powell, Bryan; Smith, Gareth Dylan

    2016-01-01

    This paper introduces the Music Learning Profiles Project, and its methodological approach, flash study analysis. Flash study analysis is a method that draws heavily on extant qualitative approaches to education research, to develop broad understandings of music learning in diverse contexts. The Music Learning Profiles Project (MLPP) is an…

  11. A Modern Apparatus for Performing Flash Chromatography: An Experiment for the Organic Laboratory

    Science.gov (United States)

    Naumiec, Gregory R.; Del Padre, Angela N.; Hooper, Matthew M.; Germaine, Alison St.; DeBoef, Brenton

    2013-01-01

    A modern apparatus for performing flash chromatography using commercially available, prepacked silica cartridges has been developed. The key advantage of this system, when compared to traditional flash chromatography, is its use of commercially available silica cartridges, which obviates the need for students to handle silica gel. The apparatus…

  12. Urban flash flood vulnerability : spatial assessment and adaptation : a case study in Istanbul, Turkey

    NARCIS (Netherlands)

    Reyes-Acevedo, Martin Alejandro; Flacke, J.; Brussel, M.J.G.

    2011-01-01

    The Ayamama River basin in Istanbul is a densely populated urban area that is frequently impacted by flash floods causing damage to people and infrastructure. The IPCC expects that under climate change conditions, more intense precipitation will occur, leading to a higher risk of flash floods.

  13. Increasing the computational speed of flash calculations with applications for compositional, transient simulations

    DEFF Research Database (Denmark)

    Rasmussen, Claus P.; Krejbjerg, Kristian; Michelsen, Michael Locht

    2006-01-01

    Approaches are presented for reducing the computation time spent on flash calculations in compositional, transient simulations. In a conventional flash calculation, the majority of the simulation time is spent on stability analysis, even for systems far into the single-phase region. A criterion has...

  14. Flash Floods Simulation using a Physical-Based Hydrological Model at Different Hydroclimatic Regions

    Science.gov (United States)

    Saber, Mohamed; Kamil Yilmaz, Koray

    2016-04-01

    Currently, flash floods are seriously increasing and affecting many regions over the world. Therefore, this study will focus on two case studies; Wadi Abu Subeira, Egypt as arid environment, and Karpuz basin, Turkey as Mediterranean environment. The main objective of this work is to simulate flash floods at both catchments considering the hydrometeorological differences between them which in turn effect their flash flood behaviors. An integrated methodology incorporating Hydrological River Basin Environmental Assessment Model (Hydro-BEAM) and remote sensing observations was devised. Global Satellite Mapping of Precipitation (GSMAP) were compared with the rain gauge network at the target basins to estimate the bias in an effort to further use it effectively in simulation of flash floods. Based on the preliminary results of flash floods simulation on both basins, we found that runoff behaviors of flash floods are different due to the impacts of climatology, hydrological and topographical conditions. Also, the simulated surface runoff hydrographs are reasonably coincide with the simulated ones. Consequently, some mitigation strategies relying on this study could be introduced to help in reducing the flash floods disasters at different climate regions. This comparison of different climatic basins would be a reasonable implication for the potential impact of climate change on the flash floods frequencies and occurrences.

  15. Endometrial Receptivity Profile in Patients with Premature Progesterone Elevation on the Day of hCG Administration

    Directory of Open Access Journals (Sweden)

    Delphine Haouzi

    2014-01-01

    Full Text Available The impact of a premature elevation of serum progesterone level, the day of hCG administration in patients under controlled ovarian stimulation during IVF procedure, on human endometrial receptivity is still debated. In the present study, we investigated the endometrial gene expression profile shifts during the prereceptive and receptive secretory stage in patients with normal and elevated serum progesterone level on the day of hCG administration in fifteen patients under stimulated cycles. Then, specific biomarkers of endometrial receptivity in these two groups of patients were tested. Endometrial biopsies were performed on oocyte retrieval day and on day 3 of embryo transfer, respectively, for each patient. Samples were analysed using DNA microarrays and qRT-PCR. The endometrial gene expression shift from the prereceptive to the receptive stage was altered in patients with high serum progesterone level (>1.5 ng/mL on hCG day, suggesting accelerated endometrial maturation during the periovulation period. This was confirmed by the functional annotation of the differentially expressed genes as it showed downregulation of cell cycle-related genes. Conversely, the profile of endometrial receptivity was comparable in both groups. Premature progesterone rise alters the endometrial gene expression shift between the prereceptive and the receptive stage but does not affect endometrial receptivity.

  16. Epigenetic modulation with HDAC inhibitor CG200745 induces anti-proliferation in non-small cell lung cancer cells.

    Directory of Open Access Journals (Sweden)

    Sung-Min Chun

    Full Text Available Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of histone acetylation, resulting in the inhibition of cell proliferation. ChIP-on-chip analysis with an H4K16ac antibody showed altered H4K16 acetylation on genes critical for cell growth inhibition, although decreased at the transcription start site of a subset of genes. Altered H4K16ac was associated with changes in mRNA expression of the corresponding genes, which were further validated in quantitative RT-PCR and western blotting assays. Our results demonstrated that CG200745 causes NSCLC cell growth inhibition through epigenetic modification of critical genes in cancer cell survival, providing pivotal clues as a promising chemotherapeutics against lung cancer.

  17. Epigenetic modulation with HDAC inhibitor CG200745 induces anti-proliferation in non-small cell lung cancer cells.

    Science.gov (United States)

    Chun, Sung-Min; Lee, Ji-Young; Choi, Jene; Lee, Je-Hwan; Hwang, Jung Jin; Kim, Chung-Soo; Suh, Young-Ah; Jang, Se Jin

    2015-01-01

    Histone modification plays a pivotal role on gene regulation, as regarded as global epigenetic markers, especially in tumor related genes. Hence, chemical approaches targeting histone-modifying enzymes have emerged onto the main stage of anticancer drug discovery. Here, we investigated the therapeutic potentials and mechanistic roles of the recently developed histone deacetylase inhibitor, CG200745, in non-small cell lung cancer cells. Treatment with CG200745 increased the global level of histone acetylation, resulting in the inhibition of cell proliferation. ChIP-on-chip analysis with an H4K16ac antibody showed altered H4K16 acetylation on genes critical for cell growth inhibition, although decreased at the transcription start site of a subset of genes. Altered H4K16ac was associated with changes in mRNA expression of the corresponding genes, which were further validated in quantitative RT-PCR and western blotting assays. Our results demonstrated that CG200745 causes NSCLC cell growth inhibition through epigenetic modification of critical genes in cancer cell survival, providing pivotal clues as a promising chemotherapeutics against lung cancer.

  18. Speeding up the flash calculations in two-phase compositional flow simulations - The application of sparse grids

    KAUST Repository

    Wu, Yuanqing; Kowitz, Christoph; Sun, Shuyu; Salama, Amgad

    2015-01-01

    Flash calculations have become a performance bottleneck in the simulation of compositional flow in subsurface reservoirs. We apply a sparse grid surrogate model to substitute the flash calculation and thus try to remove the bottleneck from

  19. A novel histone deacetylase inhibitor, CG200745, potentiates anticancer effect of docetaxel in prostate cancer via decreasing Mcl-1 and Bcl-XL.

    Science.gov (United States)

    Hwang, Jung Jin; Kim, Yong Sook; Kim, Taelim; Kim, Mi Joung; Jeong, In Gab; Lee, Je-Hwan; Choi, Jene; Jang, Sejin; Ro, Seonggu; Kim, Choung-Soo

    2012-08-01

    We synthesized a novel hydroxamate-based pan-histone deacetylase inhibitor (HDACI), CG200745 {(E)-2-(Naphthalen-1-yloxymethyl)-oct-2-enedioic acid 1-[(3-dimethylamino-propyl)-amide] 8-hydroxyamide]}. Like other inhibitors, for example vorinostat and belinostat, CG200745 has the hydroxamic acid moiety to bind zinc at the bottom of catalytic pocket. Firstly, we analyzed its inhibitory activity against histone deacetylase (HDAC) in hormone-dependent LNCaP cells and hormone-independent DU145 and PC3 cells. CG200745 inhibited deacetylation of histone H3 and tubulin as much as vorinostat and belinostat did. CG200745 also inhibited growth of prostate cancer cells, increased sub-G1 population, and activated caspase-9, -3 and -8 in LNCaP, DU145 and PC3 cells. These results indicate that CG200745 induces apoptosis. Next, we examined the effect of CG200745 on cell death induced by docetaxel in DU145 cells in vitro and in vivo. Compared to mono-treatment with each drug, pre-treatment of DU145 cells with docetaxel followed by CG200745 showed synergistic cytotoxicity, and increased the apoptotic sub-G1 population, caspase activation, and tubulin acetylation. Moreover, the combination treatment decreased Mcl-1 and Bcl-(XL). Docetaxel and CG200745 combination reduced tumor size in the DU145 xenograft model. These preclinical results show that combination treatment with docetaxel and new HDACI, CG200745, potentiated anti-tumor effect in hormone-refractory prostate cancer (HRPC) cells via activation of apoptosis.

  20. Continuous background light significantly increases flashing-light enhancement of photosynthesis and growth of microalgae.

    Science.gov (United States)

    Abu-Ghosh, Said; Fixler, Dror; Dubinsky, Zvy; Iluz, David

    2015-01-01

    Under specific conditions, flashing light enhances the photosynthesis rate in comparison to continuous illumination. Here we show that a combination of flashing light and continuous background light with the same integrated photon dose as continuous or flashing light alone can be used to significantly enhance photosynthesis and increase microalgae growth. To test this hypothesis, the green microalga Dunaliella salina was exposed to three different light regimes: continuous light, flashing light, and concomitant application of both. Algal growth was compared under three different integrated light quantities; low, intermediate, and moderately high. Under the combined light regime, there was a substantial increase in all algal growth parameters, with an enhanced photosynthesis rate, within 3days. Our strategy demonstrates a hitherto undescribed significant increase in photosynthesis and algal growth rates, which is beyond the increase by flashing light alone. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Status of flash radiography in the USA today and future possibilities

    International Nuclear Information System (INIS)

    Bryant, L.E. Jr.

    1978-01-01

    A listing of presently employed flash x-ray generators is given including low-energy, commercially available systems and high-energy very specialized installations in government laboratories. These flash x-ray sources are compared as to radiographic characteristics. Imaging techniques and materials are surveyed and compared as to their advantages and limitations. A variety of applications of flash radiography are cited including explosive, ballistic, diffraction, crash injury, and fuel injection. Probable near term advances in special techniques are mentioned in cine radiography and film image enhancement. Possible future developments are speculated upon such as flash radiographic applications of computerized axial tomography. The recent recognition of flash radiography at professional society conferences is reviewed

  2. Violation of Bloch's Law That Specifies Reciprocity of Intensity and Duration with Brief Light Flashes

    Directory of Open Access Journals (Sweden)

    Ernest Greene

    2013-12-01

    Full Text Available For more than a century researchers have been reporting that the visual impact of a very brief flash is determined by the quantity of photons that the flash delivers. This has been variously described as the Bunsen-Roscoe Law or Bloch's Law, often specified as reciprocity of intensity × duration. Prior research found no evidence for such reciprocity when microsecond-duration flashes from a light-emitting diode array were used to display the major contours of nameable shapes. The present work tested with flash durations ranging up to 100 ms and also found no reciprocity. This departure from classic principles might be due to the specific range of wavelengths of the light-emitting diodes and to a mesopic level of ambient light, which together would preclude activation of rods. The reciprocity of intensity and duration may only be valid with full dark adaptation and very dim flashes that activate rods.

  3. A randomized controlled dose-response pilot study of addition of hCG to recombinant FSH during controlled ovarian stimulation for in vitro fertilization

    DEFF Research Database (Denmark)

    Loft, A; Egeberg, Anne Noes; Smitz, J

    2012-01-01

    Is it possible to define an optimal dose of hCG in combination with rFSH from the first day of stimulation in the GnRH agonist protocol applied to IVF? SUMMARY ANSWER: Supplementation with hCG from the first day of stimulation may increase the number of top-quality embryos per patient. Daily doses...... has been previously reported. We suggest a large clinical trial to be proceeded with a group given 100 IU hCG daily versus a control group. WHAT IS KNOWN AND WHAT THIS PAPER ADDS: Prospective multicentre studies have indicated increased live birth rates and increased number of top-quality embryos when...

  4. Large-scale genomic 2D visualization reveals extensive CG-AT skew correlation in bird genomes

    Directory of Open Access Journals (Sweden)

    Deng Xuemei

    2007-11-01

    Full Text Available Abstract Background Bird genomes have very different compositional structure compared with other warm-blooded animals. The variation in the base skew rules in the vertebrate genomes remains puzzling, but it must relate somehow to large-scale genome evolution. Current research is inclined to relate base skew with mutations and their fixation. Here we wish to explore base skew correlations in bird genomes, to develop methods for displaying and quantifying such correlations at different scales, and to discuss possible explanations for the peculiarities of the bird genomes in skew correlation. Results We have developed a method called Base Skew Double Triangle (BSDT for exhibiting the genome-scale change of AT/CG skew as a two-dimensional square picture, showing base skews at many scales simultaneously in a single image. By this method we found that most chicken chromosomes have high AT/CG skew correlation (symmetry in 2D picture, except for some microchromosomes. No other organisms studied (18 species show such high skew correlations. This visualized high correlation was validated by three kinds of quantitative calculations with overlapping and non-overlapping windows, all indicating that chicken and birds in general have a special genome structure. Similar features were also found in some of the mammal genomes, but clearly much weaker than in chickens. We presume that the skew correlation feature evolved near the time that birds separated from other vertebrate lineages. When we eliminated the repeat sequences from the genomes, the AT and CG skews correlation increased for some mammal genomes, but were still clearly lower than in chickens. Conclusion Our results suggest that BSDT is an expressive visualization method for AT and CG skew and enabled the discovery of the very high skew correlation in bird genomes; this peculiarity is worth further study. Computational analysis indicated that this correlation might be a compositional characteristic

  5. Implikasi Multimedia Interaktif Berbasis Flash Terhadap Motivasi dan Prestasi Belajar Matematika

    Directory of Open Access Journals (Sweden)

    Edi Irawan

    2017-06-01

    Full Text Available [Bahasa]: Penelitian ini bertujuan untuk menguji efektivitas penggunaan multimedia berbasis flash pada mata kuliah statistika ditinjau dari motivasi belajar dan prestasi belajar mahasiswa. Penelitian ini adalah penelitian eksperimen semu dengan desain pretest-posttest nonequivalent group design. Penelitian ini dilaksanakan di STKIP PGRI Pacitan pada tahun 2016. Instrumen yang digunakan adalah tes prestasi belajar dan angket motivasi belajar mahasiswa. Teknik analisis data yang digunakan adalah uji one sample t-test, uji T2 Hotelling’s, dan uji t-Bonferroni. Hasil penelitian menunjukkan bahwa penggunaan multimedia berbasis flash pada mata kuliah statistika lebih efektif daripada pembelajaran menggunakan media powerpoint ditinjau dari motivasi belajar dan prestasi belajar mahasiswa. Prestasi belajar statistika mahasiswa yang menggunakan media flash lebih baik daripada mahasiswa yang menggunakan media powerpoint. Demikian halnya pada aspek motivasi belajar, mahasiswa yang menggunakan flash mengalami peningkatan motivasi yang lebih signifikan daripada mahasiswa yang menggunakan media powerpoint. Kata kunci: Multimedia Flash; Motivasi Belajar; Prestasi Belajar; Statistika [English]: This study aims to test the effectiveness of the use of flash-based multimedia in the course of statistics toward learning motivation and student achievement. This research is a quasi-experimental research with pretest-posttest nonequivalent group design. This research was conducted at STKIP PGRI Pacitan in 2016. The instrument used was the test of student achievement and questionnaire of student's motivation. Data analysis techniques used one sample t-test, T2 Hotelling's test, and t-Bonferroni test. The results showed that the use of flash-based multimedia in the course of statistics is more effective than learning using powerpoint in terms of learning motivation and student achievement. Students’ achievement in statistics using flash media are better than students

  6. Extension of modified RAND to multiphase flash specifications based on state functions other than (T,P)

    DEFF Research Database (Denmark)

    Paterson, Duncan; Michelsen, Michael Locht; Yan, Wei

    2017-01-01

    The recently proposed modified RAND formulation is extended from isothermal multiphase flash to several other state function based flash specifications. The obtained general formulation is applicable to chemical equilibrium although this study is focused on flash with only phase equilibrium. It i...

  7. MEDIA PEMBELAJARAN ANIMASI PENYERBUKAN PADA TUMBUHAN MENGGUNAKAN MACROMEDIA FLASH 8

    Directory of Open Access Journals (Sweden)

    Sasono Wibowo

    2015-07-01

    Full Text Available Proses pembelajaran khususnya  didalam mata pelajaran biologi bagi sebagian siswa dianggap kurang menarik, terutama yang menyangkut tentang siklus kehidupan. Para siswa kurang bisa menangkap apa yang disampaikan oleh guru, karena ilustrasi penyampaian materi kurang bisa memberikan gambaran yang jelas. Untuk itu harus ada media pembelajaran yang bisa membuat siswa tertarik dan dapat memahami dengan mudah. Pembuatan media pembelajaran animasi penyerbukan pada tumbuhan dengan menggunakan Macromedia Flash 8 adalah salah satu cara yang bisa dilakukan. Tujuan dari tulisan ini adalah untuk memungkinkan siswa mudah dan tertarik untuk belajar dan memahami mata pelajaran biologi khususnya tentang siklus penyerbukan  pada tanaman. Program bantu belajar ini dibuat menggunakan model Waterfall metode desain dan system analisis rekayasa perangkat lunak analisis persyaratan, desain, program, pengujian dan pemeliharaan program untuk menambah pengetahuan tentang gambaran bagaimana penyerbukan pada tanaman dilakukan dalam bentuk animasi dan soal latihan. Kata kunci : belajar, penyerbukan, animasi, multimedia.

  8. Warm dense matter and Thomson scattering at FLASH

    International Nuclear Information System (INIS)

    Faeustlin, Roland Rainer

    2010-05-01

    X-ray free electron lasers are powerful tools to investigate moderately to strongly correlated solid density low temperature plasmas, named warm dense matter. These plasmas are of most interest for astrophysics and laser plasma interaction, particularly inertial confinement fusion. This work utilizes the ultrashort soft x-ray pulse duration and high brilliance of the free electron laser in Hamburg, FLASH, to generate warm dense matter and to study its ultrafast processes. The techniques applied are absorption measurement, emission spectroscopy and Thomson scattering. Radiative hydrodynamics and Thomson scattering simulations are used to investigate the impact of temperature and density gradients in the sample and to fit the experimental data. The measurements result in a comprehensive picture of soft x-ray matter interaction related to warm dense matter and yield insight into ultrafast equilibration and relaxation mechanisms, in particular impact ionization and radiative recombination. (orig.)

  9. Operational flash flood forecasting platform based on grid technology

    Science.gov (United States)

    Thierion, V.; Ayral, P.-A.; Angelini, V.; Sauvagnargues-Lesage, S.; Nativi, S.; Payrastre, O.

    2009-04-01

    Flash flood events of south of France such as the 8th and 9th September 2002 in the Grand Delta territory caused important economic and human damages. Further to this catastrophic hydrological situation, a reform of flood warning services have been initiated (set in 2006). Thus, this political reform has transformed the 52 existing flood warning services (SAC) in 22 flood forecasting services (SPC), in assigning them territories more hydrological consistent and new effective hydrological forecasting mission. Furthermore, national central service (SCHAPI) has been created to ease this transformation and support local services in their new objectives. New functioning requirements have been identified: - SPC and SCHAPI carry the responsibility to clearly disseminate to public organisms, civil protection actors and population, crucial hydrologic information to better anticipate potential dramatic flood event, - a new effective hydrological forecasting mission to these flood forecasting services seems essential particularly for the flash floods phenomenon. Thus, models improvement and optimization was one of the most critical requirements. Initially dedicated to support forecaster in their monitoring mission, thanks to measuring stations and rainfall radar images analysis, hydrological models have to become more efficient in their capacity to anticipate hydrological situation. Understanding natural phenomenon occuring during flash floods mainly leads present hydrological research. Rather than trying to explain such complex processes, the presented research try to manage the well-known need of computational power and data storage capacities of these services. Since few years, Grid technology appears as a technological revolution in high performance computing (HPC) allowing large-scale resource sharing, computational power using and supporting collaboration across networks. Nowadays, EGEE (Enabling Grids for E-science in Europe) project represents the most important

  10. Planetary Produced Axionlike Particles and Gamma-Ray Flashes

    International Nuclear Information System (INIS)

    Liolios, Anastasios

    2008-01-01

    Axion-like particles could be created in nuclear disintegrations and deexitations of natural radionuclides present in the interior of the planets. For the Earth and the other planets with a surrounding magnetosphere, axion production could result to gamma and X-ray emission, originating from axion to photon conversion in the planetary magnetic fields. The estimated planetary axion fluxes as well as the related gamma ray fluxes from Earth and the giant planets of our solar system are given along with the axion coupling to ordinary matter. A possible connection with the enigmatic Terrestrial Gamma-ray Flashes (TGFs) discovered in 1994 by CGRO/BATSE and also detected with the RHESSI satellite, is also discussed.

  11. Cuinse2 Thin Film For Solar Cell By Flash Evaporation

    Directory of Open Access Journals (Sweden)

    A.H. Soepardjo

    2009-11-01

    Full Text Available Deposition of thin films for material solar cell CuInSe2 are relatively simple. In this research mainly focused on the use of flash evaporation method, and the material created can then be characterized by optical and electrical properties. The optical characterization is done by X-ray Diffraction (XRD, Energy Dispersive Spectroscopy (EDS, and transmission and reflection by UV-VIS spectrophotometry. Electrical characterization is done by utilizing the Hall effect equipment. From these characterization, the atomic structure, absorption coefficient, energy gap, material type, composition of each elements and the mobility of CuInSe2 can be measured and determined. During process evaporation were carried out at substrate temperatures the range between 20ºC-415ºC.

  12. Simulating Terrestrial Gamma-ray Flashes using SWORD (Invited)

    Science.gov (United States)

    Gwon, C.; Grove, J.; Dwyer, J. R.; Mattson, K.; Polaski, D.; Jackson, L.

    2013-12-01

    We report on simulations of the relativistic feedback discharges involved with the production of terrestrial gamma-ray flashes (TGFs). The simulations were conducted using Geant4 using the SoftWare for the Optimization of Radiation Detectors (SWORD) framework. SWORD provides a graphical interface for setting up simulations in select high-energy radiation transport engines. Using Geant4, we determine avalanche length, the energy spectrum of the electrons and gamma-rays as they leave the field region, and the feedback factor describing the degree to which the production of energetic particles is self-sustaining. We validate our simulations against previous work in order to determine the reliability of our results. This work is funded by the Office of Naval Research.

  13. Flash photoionization of gamma-ray burst environments

    Science.gov (United States)

    Band, David L.; Hartmann, Dieter H.

    1992-01-01

    The H-alpha line emission that a flash-photoionized region emits is calculated. Archival transients, as well as various theoretical predictions, suggest that there may be significant ionizing flux. The limits on the line flux which might be observable indicate that the density must be fairly high for the recombination radiation to be observable. The intense burst radiation is insufficient to melt the dust which will be present in such a dense medium. This dust may attenuate the observable line emission, but does not attenuate the ionizing radiation before it ionizes the neutral medium surrounding the burst source. The dust can also produce a light echo. If there are indeed gamma-ray bursts in dense clouds, then it is possible that the burst was triggered by Bondi-Hoyle accretion from the dense medium, although it is unlikely on statistical grounds that all bursts occur in clouds.

  14. A non-invasive online photoionization spectrometer for FLASH2.

    Science.gov (United States)

    Braune, Markus; Brenner, Günter; Dziarzhytski, Siarhei; Juranić, Pavle; Sorokin, Andrey; Tiedtke, Kai

    2016-01-01

    The stochastic nature of the self-amplified spontaneous emission (SASE) process of free-electron lasers (FELs) effects pulse-to-pulse fluctuations of the radiation properties, such as the photon energy, which are determinative for processes of photon-matter interactions. Hence, SASE FEL sources pose a great challenge for scientific investigations, since experimenters need to obtain precise real-time feedback of these properties for each individual photon bunch for interpretation of the experimental data. Furthermore, any device developed to deliver the according information should not significantly interfere with or degrade the FEL beam. Regarding the spectral properties, a device for online monitoring of FEL wavelengths has been developed for FLASH2, which is based on photoionization of gaseous targets and the measurements of the corresponding electron and ion time-of-flight spectra. This paper presents experimental studies and cross-calibration measurements demonstrating the viability of this online photoionization spectrometer.

  15. PLZT thermal/flash protective goggles: device concepts and constraints

    International Nuclear Information System (INIS)

    Cutchen, J.T.

    1979-01-01

    In 1975 Sandia Laboratories began the design and development of PLZT Goggles for the US Air Force to provide protection from temporary flashblindness and permanent retinal burns caused by the brilliant flash of nuclear explosions. The user requirements, system and physical constraints, and use/storage environments were all considered in arriving at the final design goals. When the program began, there was no industrial capability to manufacture large-aperture PLZT materials or bonded lens assemblies. The technology has been established from a laboratory baseline in a brief period, and operational testing and evaluation by the Air Force has been completed. The goggles, identified as the EEU-2/P,, are now in production

  16. Optical emission from Al target irradiated by FLASH

    International Nuclear Information System (INIS)

    Stránský, M; Rohlena, K

    2014-01-01

    The following text touches on some peculiarities in optical emission spectroscopy results from experiments on the free-electron laser FLASH [1, 2]. Aluminum targets were irradiated with 13.5 nm ∼ 25 fs pulses at intensities of 10 13 and 10 16 W/cm 2 (20 and 1 μm foci). Surprisingly, only neutral atom lines for the case with wider focus and traces of ion lines in the tighter focus case were observed with the optical emission spectroscopy (200–600 nm range), [2]. The motivating idea behind this work is the suggestion in [1] by Zastrau that the optical spectrometer sees only emissions from a cold expanding lower-density (< 10 22 cm −3 ) plasma plume. In this contribution the notion of UV range screening is analyzed in detail.

  17. Visual Discomfort From Flash Afterimages of Riloid Patterns.

    Science.gov (United States)

    O'Hare, Louise

    2017-06-01

    Op-art-based stimuli have been shown to be uncomfortable, possibly due to a combination of fixational eye movements (microsaccades) and excessive cortical responses. Efforts have been made to measure illusory phenomena arising from these stimuli in the absence of microsaccades, but there has been no attempt thus far to decouple the effects of the cortical response from the effect of fixational eye movements. This study uses flash afterimages to stabilise the image on the retina and thus reduce the systematic effect of eye movements, in order to investigate the role of the brain in discomfort from op-art-based stimuli. There was a relationship between spatial frequency and the magnitude of the P300 response, showing a similar pattern to that of discomfort judgements, which suggests that there might be a role of discomfort and excessive neural responses independently from the effects of microsaccades.

  18. Effects of tunnel oxide process on SONOS flash memory characteristics

    International Nuclear Information System (INIS)

    Li, Dong Hua; Park, Il Han; Yun, Jang-Gn; Park, Byung-Gook

    2010-01-01

    In this paper, various process conditions of tunnel oxides are applied in SONOS flash memory to investigate their effects on charge transport during the program/erase operations. We focus the key point of analysis on Fermi-level (E F ) variation at the interface of silicon substrate and tunnel oxide. The Si-O chemical bonding information which describes the interface oxidation states at the Si/SiO 2 is obtained by the core-level X-ray photoelectron spectroscopy (XPS). Moreover, relative E F position is determined by measuring the Si 2p energy shift from XPS spectrums. Experimental results from memory characteristic measurement show that MTO tunnel oxide structure exhibits faster erase speed, and larger memory window during P/E cycle compared to FTO and RTO tunnel oxide structures. Finally, we examine long-term charge retention characteristic and find that the memory windows of all the capacitors remain wider than 2 V after 10 5 s.

  19. Warm dense matter and Thomson scattering at FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Faeustlin, Roland Rainer

    2010-05-15

    X-ray free electron lasers are powerful tools to investigate moderately to strongly correlated solid density low temperature plasmas, named warm dense matter. These plasmas are of most interest for astrophysics and laser plasma interaction, particularly inertial confinement fusion. This work utilizes the ultrashort soft x-ray pulse duration and high brilliance of the free electron laser in Hamburg, FLASH, to generate warm dense matter and to study its ultrafast processes. The techniques applied are absorption measurement, emission spectroscopy and Thomson scattering. Radiative hydrodynamics and Thomson scattering simulations are used to investigate the impact of temperature and density gradients in the sample and to fit the experimental data. The measurements result in a comprehensive picture of soft x-ray matter interaction related to warm dense matter and yield insight into ultrafast equilibration and relaxation mechanisms, in particular impact ionization and radiative recombination. (orig.)

  20. Scattering Correction For Image Reconstruction In Flash Radiography

    International Nuclear Information System (INIS)

    Cao, Liangzhi; Wang, Mengqi; Wu, Hongchun; Liu, Zhouyu; Cheng, Yuxiong; Zhang, Hongbo

    2013-01-01

    Scattered photons cause blurring and distortions in flash radiography, reducing the accuracy of image reconstruction significantly. The effect of the scattered photons is taken into account and an iterative deduction of the scattered photons is proposed to amend the scattering effect for image restoration. In order to deduct the scattering contribution, the flux of scattered photons is estimated as the sum of two components. The single scattered component is calculated accurately together with the uncollided flux along the characteristic ray, while the multiple scattered component is evaluated using correction coefficients pre-obtained from Monte Carlo simulations.The arbitrary geometry pretreatment and ray tracing are carried out based on the customization of AutoCAD. With the above model, an Iterative Procedure for image restORation code, IPOR, is developed. Numerical results demonstrate that the IPOR code is much more accurate than the direct reconstruction solution without scattering correction and it has a very high computational efficiency

  1. The Use of MCNP in Flash Radiographic Applications at AWE

    Science.gov (United States)

    Quillin, S.; Crotch, I.; McAlpin, S.; O'Malley, J.

    AWE performs experiments to investigate the hydrodynamic behavior of explosive metal systems in order to underwrite the UK nuclear deterrent. The experiments involve the manufacture of a device to mock up some aspect of the weapon. Inert simulant materials replace fissile weapon components. The device is then detonated under remote control within specially designed explosive containment buildings called firing chambers. During the experiment a very brief, intense, collimated flash of high energy x-rays are used to take a snapshot of the implosion (see Fig. 1). Prom the resulting image measurements of the dynamic configuration and density distribution of the components in the device are inferred. These are then used to compare with calculations of the hydrodynamic operation of the weapon and understand how the device would perform under various conditions. This type of experiment is known as a core punch experiment.

  2. Scattering Correction For Image Reconstruction In Flash Radiography

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Liangzhi; Wang, Mengqi; Wu, Hongchun; Liu, Zhouyu; Cheng, Yuxiong; Zhang, Hongbo [Xi' an Jiaotong Univ., Xi' an (China)

    2013-08-15

    Scattered photons cause blurring and distortions in flash radiography, reducing the accuracy of image reconstruction significantly. The effect of the scattered photons is taken into account and an iterative deduction of the scattered photons is proposed to amend the scattering effect for image restoration. In order to deduct the scattering contribution, the flux of scattered photons is estimated as the sum of two components. The single scattered component is calculated accurately together with the uncollided flux along the characteristic ray, while the multiple scattered component is evaluated using correction coefficients pre-obtained from Monte Carlo simulations.The arbitrary geometry pretreatment and ray tracing are carried out based on the customization of AutoCAD. With the above model, an Iterative Procedure for image restORation code, IPOR, is developed. Numerical results demonstrate that the IPOR code is much more accurate than the direct reconstruction solution without scattering correction and it has a very high computational efficiency.

  3. Measurements in shock physics: R and D in flash radiography

    International Nuclear Information System (INIS)

    Abraham, I.; Caron, M.; Etchessahar, B.; Le Dain, L.; Negre, J.P.; Partouche-Sebban, D.; Pichoff, N.; Toury, M.

    2010-01-01

    Within the simulation program of Cea-Dam, the radiographs produced by the AIRIX facility (induction Linac for flash radiography and X-ray imaging), provide fundamental experimental data for studying the dynamic behaviour of non nuclear materials under the effects of chemical explosive detonation. In order to improve the precision on the observed phenomena (locations of materials interfaces, development of instabilities, etc.), various research and development works have been performed on the modelling of the radiographic image formation, on the optimization of the radiographic chain and on the algorithms for image processing. This article presents in particular the studies on the various technologies of X-sources, on the new configurations of radiographic chains, and on the new digital imagers. (authors)

  4. The Status of the Ultra Fast Flash Observatory – Pathfinder

    International Nuclear Information System (INIS)

    Nam, J.W.; Ahmad, S.; Ahn, K.B.; Barrillon, P.; Brandt, S.; Budtz-Jrgensen, C.; Castro-Tirado, A.J.; Chang, C.-H.; Chang, C.-Y.; Chang, Y.Y.; Chen, C.R.; Chen, P.; Cho, M.; Choi, H.S.; Choi, Y.J.; Connel, P.; Dagoret-Campagne, S.; Eyles, C.; Grossan, B.; Huang, J.J.

    2014-01-01

    The Ultra Fast Flash Observatory (UFFO) is a project to study early optical emissions from Gamma Ray Bursts (GRBs). The primary scientific goal of UFFO is to see if GRBs can be calibrated with their rising times, so that they could be used as new standard candles. In order to minimize delay in optical follow-up measurements, which is now about 100 sec after trigger from the Swift experiment, we rotate a mirror to redirect light path so that optical measurement can be performed within a second after the trigger. We have developed a pathfinder mission, UFFO-pathfinder to launch on board the Lomonosov satellite in 2012. In this talk, I will present scientific motivations and descriptions of the design and development of UFFO-pathfinder

  5. Efficacy of Escitalopram for Hot Flashes in Healthy Menopausal Women: A Randomized Controlled Trial

    Science.gov (United States)

    Freeman, Ellen W.; Guthrie, Katherine A.; Caan, Bette; Sternfeld, Barbara; Cohen, Lee S.; Joffe, Hadine; Carpenter, Janet S.; Anderson, Garnet L.; Larson, Joseph C.; Ensrud, Kristine E.; Reed, Susan; Newton, Katherine M.; Sherman, Sheryl; Sammel, Mary D.; La Croix, Andrea Z.

    2011-01-01

    Context Concerns for the risks of hormone therapy have resulted in its decline and a demand for non-hormonal treatments with demonstrated efficacy for hot flashes. Objective Determine the efficacy and tolerability of 10–20 mg/day escitalopram, a selective serotonin reuptake inhibitor, in alleviating the frequency, severity and bother of menopausal hot flashes. Design, Setting and Patients Randomized, double-blind, placebo-controlled, parallel arm trial for 8 weeks in a sample stratified by race (African American n=95; white n=102) and conducted at 4 MsFlash network sites between July 2009 and June 2010. Of 205 women randomized, 194 (95%) completed week 8 (intervention endpoint), and 183 completed post-treatment follow-up. Main Outcome Measures Primary outcomes were the frequency and severity of hot flashes assessed by prospective daily diaries. Secondary outcomes were hot flash "bother" recorded on daily diaries and clinical improvement (hot flash frequency >=50% decrease from baseline). Results Hot flash frequency was 9.78/day (SD 5.60) at baseline. At week 8, reduction in hot flash frequency was greater in the escitalopram group versus placebo (−4.60, SD 4.28 and −3.20, SD 4.76, respectively, P=0.004). Fifty-five percent of the escitalopram group (versus 36% of the placebo group) reported >=50% decreases in hot flash frequency (P=0.009). Differences in decreases in the severity and bother of hot flashes were significant (P=0.003 and P=0.013, respectively), paralleling the decreases in hot flash frequency. Three weeks after treatment ended, hot flash frequency increased in the escitalopram group to the level of the placebo group, which remained stable in the follow-up interval (P=0.020). Overall discontinuation due to side effects was 4% (7 drug, 2 placebo). Conclusion Escitalopram 10–20 mg/day provides non-hormonal off-label treatment for menopausal hot flashes that is effective and well-tolerated in healthy women. PMID:21245182

  6. Flash flood characterisation of the Haor area of Bangladesh

    Science.gov (United States)

    Bhattacharya, B.; Suman, A.

    2012-04-01

    Haors are large bowl-shaped flood plain depressions located mostly in north-eastern part of Bangladesh covering about 25% of the entire region. During dry season haors are used for agriculture and during rainy season it is used as fisheries. Haors have profound ecological importance. About 8000 migratory wild birds visit the area annually. Some of the haors are declared at Ramsar sites. Haors are frequently affected by the flash floods due to hilly topography and steep slope of the rivers draining the area. These flash floods spill onto low-lying flood plain lands in the region, inundating crops, damaging infrastructure by erosion and often causing loss of lives and properties. Climate change is exacerbating the situation. For appropriate risk mitigation mechanism it is necessary to explore flood characteristics of that region. The area is not at all studied well. Under a current project a numerical 1D2D model based on MIKE Flood is developed to study the flooding characteristics and estimate the climate change impacts on the haor region. Under this study the progression of flood levels at some key haors in relation to the water level data at specified gauges in the region is analysed. As the region is at the border with India so comparing with the gauges at the border with India is carried out. The flooding in the Haor area is associated with the rainfall in the upstream catchment in India (Meghalaya, Barak and Tripura basins in India). The flood propagation in some of the identified haors in relation to meteorological forcing in the three basins in India is analysed as well. Subsequently, a ranking of haors is done based on individual risks. Based on the IPCC recommendation the precipitation scenario in the upstream catchments under climate change is considered. The study provides the fundamental inputs for preparing a flood risk management plan of the region.

  7. Green FLASH: energy efficient real-time control for AO

    Science.gov (United States)

    Gratadour, D.; Dipper, N.; Biasi, R.; Deneux, H.; Bernard, J.; Brule, J.; Dembet, R.; Doucet, N.; Ferreira, F.; Gendron, E.; Laine, M.; Perret, D.; Rousset, G.; Sevin, A.; Bitenc, U.; Geng, D.; Younger, E.; Andrighettoni, M.; Angerer, G.; Patauner, C.; Pescoller, D.; Porta, F.; Dufourcq, G.; Flaischer, A.; Leclere, J.-B.; Nai, A.; Palazzari, P.; Pretet, D.; Rouaud, C.

    2016-07-01

    The main goal of Green Flash is to design and build a prototype for a Real-Time Controller (RTC) targeting the European Extremely Large Telescope (E-ELT) Adaptive Optics (AO) instrumentation. The E-ELT is a 39m diameter telescope to see first light in the early 2020s. To build this critical component of the telescope operations, the astronomical community is facing technical challenges, emerging from the combination of high data transfer bandwidth, low latency and high throughput requirements, similar to the identified critical barriers on the road to Exascale. With Green Flash, we will propose technical solutions, assess these enabling technologies through prototyping and assemble a full scale demonstrator to be validated with a simulator and tested on sky. With this R&D program we aim at feeding the E-ELT AO systems preliminary design studies, led by the selected first-light instruments consortia, with technological validations supporting the designs of their RTC modules. Our strategy is based on a strong interaction between academic and industrial partners. Components specifications and system requirements are derived from the AO application. Industrial partners lead the development of enabling technologies aiming at innovative tailored solutions with potential wide application range. The academic partners provide the missing links in the ecosystem, targeting their application with mainstream solutions. This increases both the value and market opportunities of the developed products. A prototype harboring all the features is used to assess the performance. It also provides the proof of concept for a resilient modular solution to equip a large scale European scientific facility, while containing the development cost by providing opportunities for return on investment.

  8. Flash floods in small Alpine catchments in a changing climate

    Science.gov (United States)

    Breinl, Korbinian; Di Baldassarre, Giuliano

    2017-04-01

    Climate change is expected to increase the frequency and intensity of hazardous meteorological and hydrological events in numerous mountainous areas. The mountain environment is becoming more and more important for urbanization and the tourism-based economy. Here we show new and innovative methodologies for assessing intensity and frequency of flash floods in small Alpine catchments, in South Tyrol (Italy), under climate change. This research is done within the STEEP STREAMS project, whereby we work closely with decision makers in Italian authorities, and the final goal is to provide them with clear guidelines on how to adapt current structural solutions for mitigating hazardous events under future climate conditions. To this end, we develop a coupled framework of weather generation (i.e. extrapolation of observations and trained with climate projections), time series disaggregation and hydrological modelling using the conceptual HBV model. One of the key challenges is the transfer of comparatively coarse RCM projections to small catchments, whose sizes range from only about 10km2 to 100km2. We examine different strategies to downscale the RCM data from e.g. the EURO-CORDEX dataset using our weather generator. The selected projections represent combinations of warmer, milder, drier and wetter conditions. In general, our main focus is to develop an improved understanding of the impact of the multiple sources of uncertainty in this modelling framework, and make these uncertainties tangible. The output of this study (i.e. discharge with a return period and associated uncertainty) will allow hydraulic and sediment transport modelling of flash floods and debris flows.

  9. Measuring the electron bunch timing with femtosecond resolution at FLASH

    International Nuclear Information System (INIS)

    Bock, Marie Kristin

    2013-03-01

    Bunch arrival time monitors (BAMs) are an integral part of the laser-based synchronisation system which is being developed at the Free Electron Laser in Hamburg (FLASH).The operation principle comprises the measurement of the electron bunch arrival time relative to the optical timing reference, which is provided by actively length-stabilised fibre-links of the synchronisation system. The monitors are foreseen to be used as a standard diagnostic tool, not only for FLASH but also for the future European X-Ray Free-Electron Laser (European XFEL). The present bunch arrival time monitors have evolved from proof-of-principle experiments to beneficial diagnostic devices, which are almost permanently available during standard machine operation. This achievement has been a major objective of this thesis. The developments went in parallel to improvements in the reliable and low-maintenance operation of the optical synchronisation system. The key topics of this thesis comprised the characterisation and optimisation of the opto-mechanical front-ends of both, the fibre-links and the BAMs. The extent of applications involving the bunch arrival time information has been enlarged, providing automated measurements for properties of the RF acceleration modules, for instance, the RF on-crest phase determination and the measurement of energy fluctuations. Furthermore, two of the currently installed BAMs are implemented in an active phase and gradient stabilisation of specific modules in order to minimise the arrival time jitter of the electron bunches at the location of the FEL undulators, which is crucial for a high timing resolution of pump-probe experiments.

  10. 450mm wafer patterning with jet and flash imprint lithography

    Science.gov (United States)

    Thompson, Ecron; Hellebrekers, Paul; Hofemann, Paul; LaBrake, Dwayne L.; Resnick, Douglas J.; Sreenivasan, S. V.

    2013-09-01

    The next step in the evolution of wafer size is 450mm. Any transition in sizing is an enormous task that must account for fabrication space, environmental health and safety concerns, wafer standards, metrology capability, individual process module development and device integration. For 450mm, an aggressive goal of 2018 has been set, with pilot line operation as early as 2016. To address these goals, consortiums have been formed to establish the infrastructure necessary to the transition, with a focus on the development of both process and metrology tools. Central to any process module development, which includes deposition, etch and chemical mechanical polishing is the lithography tool. In order to address the need for early learning and advance process module development, Molecular Imprints Inc. has provided the industry with the first advanced lithography platform, the Imprio® 450, capable of patterning a full 450mm wafer. The Imprio 450 was accepted by Intel at the end of 2012 and is now being used to support the 450mm wafer process development demands as part of a multi-year wafer services contract to facilitate the semiconductor industry's transition to lower cost 450mm wafer production. The Imprio 450 uses a Jet and Flash Imprint Lithography (J-FILTM) process that employs drop dispensing of UV curable resists to assist high resolution patterning for subsequent dry etch pattern transfer. The technology is actively being used to develop solutions for markets including NAND Flash memory, patterned media for hard disk drives and displays. This paper reviews the recent performance of the J-FIL technology (including overlay, throughput and defectivity), mask development improvements provided by Dai Nippon Printing, and the application of the technology to a 450mm lithography platform.

  11. Measuring the electron bunch timing with femtosecond resolution at FLASH

    Energy Technology Data Exchange (ETDEWEB)

    Bock, Marie Kristin

    2013-03-15

    Bunch arrival time monitors (BAMs) are an integral part of the laser-based synchronisation system which is being developed at the Free Electron Laser in Hamburg (FLASH).The operation principle comprises the measurement of the electron bunch arrival time relative to the optical timing reference, which is provided by actively length-stabilised fibre-links of the synchronisation system. The monitors are foreseen to be used as a standard diagnostic tool, not only for FLASH but also for the future European X-Ray Free-Electron Laser (European XFEL). The present bunch arrival time monitors have evolved from proof-of-principle experiments to beneficial diagnostic devices, which are almost permanently available during standard machine operation. This achievement has been a major objective of this thesis. The developments went in parallel to improvements in the reliable and low-maintenance operation of the optical synchronisation system. The key topics of this thesis comprised the characterisation and optimisation of the opto-mechanical front-ends of both, the fibre-links and the BAMs. The extent of applications involving the bunch arrival time information has been enlarged, providing automated measurements for properties of the RF acceleration modules, for instance, the RF on-crest phase determination and the measurement of energy fluctuations. Furthermore, two of the currently installed BAMs are implemented in an active phase and gradient stabilisation of specific modules in order to minimise the arrival time jitter of the electron bunches at the location of the FEL undulators, which is crucial for a high timing resolution of pump-probe experiments.

  12. An early warning system for flash floods in Egypt

    Science.gov (United States)

    Cools, J.; Abdelkhalek, A.; El Sammany, M.; Fahmi, A. H.; Bauwens, W.; Huygens, M.

    2009-09-01

    This paper describes the development of the Flash Flood Manager, abbreviated as FlaFloM. The Flash Flood Manager is an early warning system for flash floods which is developed under the EU LIFE project FlaFloM. It is applied to Wadi Watier located in the Sinai peninsula (Egypt) and discharges in the Red Sea at the local economic and tourist hub of Nuweiba city. FlaFloM consists of a chain of four modules: 1) Data gathering module, 2) Forecasting module, 3) Decision support module or DSS and 4) Warning module. Each module processes input data and consequently send the output to the following module. In case of a flash flood emergency, the final outcome of FlaFloM is a flood warning which is sent out to decision-makers. The ‘data gathering module’ collects input data from different sources, validates the input, visualise data and exports it to other modules. Input data is provided ideally as water stage (h), discharge (Q) and rainfall (R) through real-time field measurements and external forecasts. This project, however, as occurs in many arid flash flood prone areas, was confronted with a scarcity of data, and insufficient insight in the characteristics that release a flash flood. Hence, discharge and water stage data were not available. Although rainfall measurements are available through classical off line rain gauges, the sparse rain gauges network couldn’t catch the spatial and temporal characteristics of rainfall events. To overcome this bottleneck, we developed rainfall intensity raster maps (mm/hr) with an hourly time step and raster cell of 1*1km. These maps are derived through downscaling from two sources of global instruments: the weather research and forecasting model (WRF) and satellite estimates from the Tropical Rainfall Measuring Mission (TRMM). The ‘forecast module’ comprises three numerical models that, using data from the gathering module performs simulations on command: a rainfall-runoff model, a river flow model, and a flood model. A

  13. Desempenho reprodutivo de cabras alpinas tratadas com hCG cinco dias após o acasalamento Reproductive performance of alpine goats treated with hCG five days after breeding

    Directory of Open Access Journals (Sweden)

    Jeferson Ferreira da Fonseca

    2005-04-01

    Full Text Available Objetivou-se com este estudo avaliar o efeito da administração de hCG sobre o desempenho reprodutivo de cabras Alpinas durante a estação de acasalamento natural. Trinta e duas fêmeas nulíparas e 124 lactantes, após a identificação de estro e acasalamento, foram aleatoriamente divididas, de acordo com a categoria, em dois tratamentos. Em T1 (n=75 e T2 (n=81, os animais receberam 1 mL de solução salina ou 250 UI de hCG, respectivamente, por via intramuscular cinco dias após o acasalamento. A gestação foi verificada por ultra-sonografia transabdominal (probe de 3,5 MHz nos dias 35 e 70 após o acasalamento, para detecção e confirmação da gestação, respectivamente. As taxas de gestação não diferiram entre T1 (86,7% e T2 (70,6% para nulíparas e T1 (78,3 % e T2 (84,4 % para lactantes. Não houve diferença entre a taxa de parição (75,0 e 75,7%, o período de gestação (150,47 e 150,80 dias e a prolificidade (1,75 e 1,80 fetos entre os animais do T1 e T2, respectivamente. A prolificidade foi superior em cabras lactantes (1,90 que em nulíparas (1,41. A administração de hCG cinco dias após o acasalamento não elevou o desempenho reprodutivo em cabras da raça Alpina.The effect of hCG administration on reproductive performance of Alpine goats during the natural breeding season was evaluated. Thirty-two nulliparous and 124 lactating goats, after estrus identification and breeding, were randomly assigned according to the categories to two treatments. In T1 (n=75 and T2 (n=81 the animals received 1 mL of saline solution or 250 IU of hCG intramuscularly, respectively, five days after breeding. Pregnancy was detected and confirmed on days 35 and 70 after breeding by transabdominal ultrasonography (3.5 MHz probe, respectively. Pregnancy rate did not differ between T1 (86.7 % and T2 (70.6% for nulliparous and T1 (78.3% and T2 (84.4% for lactating does. There were no differences for kidding rate (75.0 and 75.7%, gestation period

  14. Characterization of CgHIFα-Like, a Novel bHLH-PAS Transcription Factor Family Member, and Its Role under Hypoxia Stress in the Pacific Oyster Crassostrea gigas.

    Directory of Open Access Journals (Sweden)

    Ting Wang

    Full Text Available Hypoxia-inducible factor (HIF, a critical member of the basic-helix-loop-helix (bHLH-containing Per-Arnt-Sim (PAS protein family, is a master transcription factor involved in maintaining oxygen homeostasis. In the present study, we isolated and characterized a novel bHLH-PAS family member, CgHIFα-like gene, from the Pacific oyster Crassostrea gigas, and determined its importance during hypoxia stress. The 3020-bp CgHIFα-like cDNA encoded a protein of 888 amino acids. The predicted CgHIFα-like amino acid sequence was conserved in the N-terminal bHLH, PAS, and PAC domains (but not in the C-terminal domain and was most closely related to the HIF family in the bHLH-PAS protein phylogenic tree. Similar to the mammalian HIF-1α, CgHIFα-like could be expressed as four mRNA isoforms containing alternative 5'-untranslated regions and different translation initiation codons. At the mRNA level, these isoforms were expressed in a tissue-specific manner and showed increased transcription to varying degrees under hypoxic conditions. Additionally, the western blot analysis demonstrated that CgHIFα-like was induced by hypoxia. Electrophoretic mobility shift assay indicated that CgHIFα-like could bind to the hypoxia responsive element (HRE, whereas dual-luciferase reporter analysis demonstrated that CgHIFα-like could transactivate the reporter gene containing the HREs. In addition to CgHIFα-like, we identified CgARNT from the C. gigas, analyzed its expression pattern, and confirmed its interaction with CgHIFα-like using a yeast two-hybrid assay. In conclusion, this is the first report on the cloning and characterization of a novel hypoxia transcription factor in mollusks, which could accumulate under hypoxia and regulate hypoxia related gene expression by binding to HRE and dimerizing with CgARNT. As only one member of HIF has been identified in invertebrates to date, our results provide new insights into the unique mechanisms of hypoxia tolerance in

  15. Motorist actions at a crosswalk with an in-pavement flashing light system.

    Science.gov (United States)

    Karkee, Ganesh J; Nambisan, Shashi S; Pulugurtha, Srinivas S

    2010-12-01

    An in-pavement flashing light system is used at crosswalks to alert motorists and pedestrians of possible conflicts and to influence their behavior to enhance safety. The relative behaviors of the drivers and the pedestrians affect safety. An evaluation of motorist behavior at a pedestrian crosswalk with an in-pavement flashing light system is presented in this manuscript. Field observations provide the basis to evaluate motorist behavior at a crosswalk with an in-pavement flashing light system. Outcomes of pedestrian and motorists actions were observed to quantify measures of effectiveness (MOEs) such as yielding behavior of motorists, vehicle speeds, and yielding distance from the crosswalk. A before-and-after study design was used. The before condition was prior to the activation of the in-pavement flashing light system and the after condition was after the activation of the in-pavement flashing light system. The study was conducted on a relatively low-volume roadway located in the Henderson, Nevada. The significance of the differences in the MOEs between the 2 study periods was evaluated using statistical analysis tools such as a one-tailed test for proportions and the Welch-Satterthwaite t-test. The results show that the installation of the in-pavement flashing light system increased the yielding behavior of motorists significantly (P pavement flashing light system is seen to be effective to improve motorists' yielding behavior and the speeds of vehicles were also observed to decrease in the presence of pedestrians.

  16. Evaluating Non-In-Place Update Techniques for Flash-Based Transaction Processing Systems

    Science.gov (United States)

    Wang, Yongkun; Goda, Kazuo; Kitsuregawa, Masaru

    Recently, flash memory is emerging as the storage device. With price sliding fast, the cost per capacity is approaching to that of SATA disk drives. So far flash memory has been widely deployed in consumer electronics even partly in mobile computing environments. For enterprise systems, the deployment has been studied by many researchers and developers. In terms of the access performance characteristics, flash memory is quite different from disk drives. Without the mechanical components, flash memory has very high random read performance, whereas it has a limited random write performance because of the erase-before-write design. The random write performance of flash memory is comparable with or even worse than that of disk drives. Due to such a performance asymmetry, naive deployment to enterprise systems may not exploit the potential performance of flash memory at full blast. This paper studies the effectiveness of using non-in-place-update (NIPU) techniques through the IO path of flash-based transaction processing systems. Our deliberate experiments using both open-source DBMS and commercial DBMS validated the potential benefits; x3.0 to x6.6 performance improvement was confirmed by incorporating non-in-place-update techniques into file system without any modification of applications or storage devices.

  17. A pilot study of magnetic therapy for hot flashes after breast cancer.

    Science.gov (United States)

    Carpenter, Janet S; Wells, Nancy; Lambert, Beth; Watson, Peggy; Slayton, Tami; Chak, Bapsi; Hepworth, Joseph T; Worthington, W Bradley

    2002-04-01

    The purpose of this randomized placebo-controlled crossover pilot study was to evaluate the effectiveness and acceptability of magnetic therapy for hot flashes among breast cancer survivors. Participants completed a 24-hour baseline hot-flash monitoring session, wore the magnetic devices or placebo for 3 days, completed an after-treatment hot-flash monitoring session, experienced a 10-day washout period, and then crossed over to the opposite study arm. Magnetic devices and placebos were placed on 6 acupressure sites corresponding to hot-flash relief. Complete data were available from 11 survivors of breast cancer. Results indicated magnetic therapy was no more effective than placebo in decreasing hot-flash severity, and contrary to expectations, placebo was significantly more effective than magnets in decreasing hot-flash frequency, bother, interference with daily activities, and overall quality of life. Implications for clinical practice and future research include the need to explore alternative interventions aimed at alleviating hot flashes in this population.

  18. Flashing of high-pressure saturated water into the pool water

    International Nuclear Information System (INIS)

    Takamasa, Tomoji; Kondo, Koichi; Aya, Izuo.

    1997-01-01

    This paper presents an experimental study on a saturated high-pressure water discharging into a water pool. The purpose of the experiment is to clarify the phenomena that occur by a blow-down of the water from the pressure vessel into the water-filled containment in the case of a wall-crack accident or a LOCA in a passive safety reactor. The results show that a flashing oscillation (FO) occurs when the water discharges into the pool, under specified experimental conditions. The range of the flashing location oscillates between a point very close to and some distance away from the vent hole. The pressures in the vent tube and water pool constantly fluctuate due to the flashing oscillation. The pressure oscillation and alternating flashing location might be caused by the balancing action between the supply of saturated water, flashing at the control volume and steam condensation on the steam-water interface. The frequencies of FO, or frequencies of pressure oscillation and alternating flashing location, increased as water subcooling increased, and as discharging pressure and vent hole diameter decreased. A linear analysis was conducted using a spherical flashing bubble model in which the motion of bubble is controlled by steam condensation. The effects of these parameters on the period of FO in the experiments can be predicted well by the analysis. (author)

  19. Digital Device Architecture and the Safe Use of Flash Devices in Munitions

    Science.gov (United States)

    Katz, Richard B.; Flowers, David; Bergevin, Keith

    2017-01-01

    Flash technology is being utilized in fuzed munition applications and, based on the development of digital logic devices in the commercial world, usage of flash technology will increase. Digital devices of interest to designers include flash-based microcontrollers and field programmable gate arrays (FPGAs). Almost a decade ago, a study was undertaken to determine if flash-based microcontrollers could be safely used in fuzes and, if so, how should such devices be applied. The results were documented in the Technical Manual for the Use of Logic Devices in Safety Features. This paper will first review the Technical Manual and discuss the rationale behind the suggested architectures for microcontrollers and a brief review of the concern about data retention in flash cells. An architectural feature in the microcontroller under study will be discussed and its use will show how to screen for weak or failed cells during manufacture, storage, or immediately prior to use. As was done for microcontrollers a decade ago, architectures for a flash-based FPGA will be discussed, showing how it can be safely used in fuzes. Additionally, architectures for using non-volatile (including flash-based) storage will be discussed for SRAM-based FPGAs.

  20. Mitochondrial flash as a novel biomarker of mitochondrial respiration in the heart.

    Science.gov (United States)

    Gong, Guohua; Liu, Xiaoyun; Zhang, Huiliang; Sheu, Shey-Shing; Wang, Wang

    2015-10-01

    Mitochondrial respiration through electron transport chain (ETC) activity generates ATP and reactive oxygen species in eukaryotic cells. The modulation of mitochondrial respiration in vivo or under physiological conditions remains elusive largely due to the lack of appropriate approach to monitor ETC activity in a real-time manner. Here, we show that ETC-coupled mitochondrial flash is a novel biomarker for monitoring mitochondrial respiration under pathophysiological conditions in cultured adult cardiac myocyte and perfused beating heart. Through real-time confocal imaging, we follow the frequency of a transient bursting fluorescent signal, named mitochondrial flash, from individual mitochondria within intact cells expressing a mitochondrial matrix-targeted probe, mt-cpYFP (mitochondrial-circularly permuted yellow fluorescent protein). This mt-cpYFP recorded mitochondrial flash has been shown to be composed of a major superoxide signal with a minor alkalization signal within the mitochondrial matrix. Through manipulating physiological substrates for mitochondrial respiration, we find a close coupling between flash frequency and the ETC electron flow, as measured by oxygen consumption rate in cardiac myocyte. Stimulating electron flow under physiological conditions increases flash frequency. On the other hand, partially block or slowdown electron flow by inhibiting the F0F1 ATPase, which represents a pathological condition, transiently increases then decreases flash frequency. Limiting electron entrance at complex I by knocking out Ndufs4, an assembling subunit of complex I, suppresses mitochondrial flash activity. These results suggest that mitochondrial electron flow can be monitored by real-time imaging of mitochondrial flash. The mitochondrial flash frequency could be used as a novel biomarker for mitochondrial respiration under physiological and pathological conditions. Copyright © 2015 the American Physiological Society.