WorldWideScience

Sample records for por ralstonia solanacearum

  1. Colonização radicular de plantas cultivadas por Ralstonia solanacearum biovares 1, 2 e 3 Root colonization of cultivated plants inoculated with Ralstonia solanacearum biovar 1, 2 and 3

    Directory of Open Access Journals (Sweden)

    José Magno Martins Bringel

    2001-09-01

    Full Text Available A murcha bacteriana causada por Ralstonia solanacearum é considerada a principal doença de origem bacteriana no mundo. Centenas de espécies de plantas pertencentes a mais de 50 famílias botânicas têm sido relatadas como hospedeiras. Foi avaliada, em condições de casa de vegetação, a colonização radicular de alface, arroz, cebolinha, ervilha, pepino e soja, por seis isolados de Ralstonia solanacearum (Rs, biovares 1, 2 e 3. Estirpes dos isolados de Rs com resistência múltipla aos antibióticos estreptomicina, rifampicina e cloranfenicol foram utilizadas. A colonização foi avaliada 45 dias após a inoculação, através do plaqueamento de suspensão de trituração em meio de cultura semi-seletivo. A ervilha comportou-se como hospedeira de todos os isolados mas, apenas um isolado da biovar 3 foi patogênico a esta espécie. A soja apresentou populações elevadas de quatro isolados distribuídos entre as três biovares e o pepino, de apenas dois isolados das biovares 1 e 3. Exceto para o isolado que foi patogênico à ervilha, as plantas não apresentaram sintomas da doença, comportando-se como hospedeiras não suscetível. O arroz apresentou populações muito baixas de todos os isolados. Alface e cebolinha não hospedaram nenhum dos isolados inoculados. Os resultados mostram a capacidade de Rs colonizar e sobreviver em diferentes espécies de plantas como rizobactérias.Bacterial wilt caused by Ralstonia solanacearum is considered the main plant disease of bacterial origin in the world, where hundreds of plant species in more than 50 botanical families are host plants. Root colonization of lettuce (Lactuca sativa, rice (Oryza sativa, spring onion (Allium fistulosum, pea (Pisum sativum, cucumber (Cucumis sativus, and soybean (Glycine max by six isolates of Ralstonia solanacearum (Rs biovars 1, 2 and 3 was evaluated under greenhouse conditions. Bacterial strains resistant to streptomycin, rifampicin and chloranfenicol were used

  2. J-GLOBAL MeSH Dictionary: Ralstonia solanacearum [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Ralstonia solanacearum 名詞 一般 * * * * Ralstonia sol...anacearum ... MeSH D043368 200906091329391991 C LS07 UNKNOWN_2 Ralstonia solanacearum

  3. Isolation and Characterization of Ralstonia solanacearum Causing ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Soil samples were collected from seven states in Nigeria known for high incidence of tomato bacterial ... (Rs) is a soil borne bacterial pathogen and a major limiting ..... crops such as maize could also reduce inoculum density ... bacterial blight wilt. (Pseudomonas solanacearum). Annals Applied Biology 111: 125-133. Denny ...

  4. Magnesium Oxide Nanoparticles: Effective Agricultural Antibacterial Agent Against Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Lin Cai

    2018-04-01

    Full Text Available Magnesium (Mg is an essential mineral element for plants and is nontoxic to organisms. In this study, we took advantage of nanotechnologies to systematically investigate the antibacterial mechanisms of magnesium oxide nanoparticles (MgONPs against the phytopathogen Ralstonia solanacearum (R. solanacearum in vitro and in vivo for the first time. R. solanacearum has contributed to catastrophic bacterial wilt, which has resulted in the world-wide reduction of tobacco production. The results demonstrated that MgONPs possessed statistically significant concentration-dependent antibacterial activity, and the minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC were measured as 200 and 250 μg/mL, respectively. Additional studies, aimed at understanding the toxicity mechanism of MgONPs, indicated that physical injury occurred to the cell membranes, along with decreased motility and biofilm formation ability of R. solanacearum, due to the direct attachment of MgONPs to the surfaces of the bacterial cells, which was observed by scanning electron microscopy (SEM and transmission electron microscopy (TEM. Reactive oxygen species (ROS accumulation could also be an important reason for the antibacterial action, inducing DNA damage. The toxicity assessment assay under greenhouse conditions demonstrated that the MgONPs had exerted a large effect on tobacco bacterial wilt, reducing the bacterial wilt index. Altogether, the results suggest that the development of MgONPs as alternative antibacterial agents will become a new research subject.

  5. Assessing the Pathogenic Ability of Ralstonia pseudosolanacearum (Ralstonia solanacearum Phylotype I from Ornamental Rosa spp. Plants

    Directory of Open Access Journals (Sweden)

    Napoleon N. A. Tjou-Tam-Sin

    2017-11-01

    Full Text Available Ralstonia pseudosolanacearum (Ralstonia solanacearum phylotype I isolates found in stunted, yellowing, and wilted ornamental rose (Rosa spp. were assessed for their pathogenic ability in two rose cultivars (cv. “Armando” and cv. “Red Naomi” and in four solanaceous crops: tomato (Solanum lycopersicum cv. “Money Maker”, tobacco (Nicotiana tabacum cv. “White Burley”, eggplant (Solanum melongena cv. “Black Beauty” and sweet pepper (Capsicum annum cv. “Yolo Wonder”. Significant differences were observed in susceptibility between the two rose cultivars as well as between the two modes of inoculation performed. The cultivar “Armando” was significantly more susceptible than cultivar “Red Naomi,” exhibiting higher disease severity and incidence. Similarly, stem inoculation after wounding was found to be significantly more effective than soil drenching, resulting in higher disease severity. Additionally, a temperature dependency in susceptibility was observed for both cultivars irrespective of the mode of inoculation, however, this was significantly more pronounced upon soil drenching. The solanaceous crops all showed to be susceptible to the R. pseudosolanacearum isolates originated from the Rosa spp. plants. Furthermore, both rose cultivars were able to harbor symptomless infections with other R. pseudosolanacearum and R. solanacearum isolates than those isolated from rose. Our results clearly demonstrated that latent infections in a rose cultivar such as cv. “Red Naomi” do occur even at temperatures as low as 20°C. This latency poses high risks for the entire floricultural industry as latently infected Rosa spp. plants are propagated and distributed over various continents, including areas where climatic conditions are optimal for the pathogen.

  6. Effect of plant essential oils on Ralstonia solanacearum race 4 causing bacterial wilt of edible ginger

    Science.gov (United States)

    Palmarosa (Cymbopogon martini), lemongrass (C. citratus) and eucalyptus (Eucalyptus globulus) oils were investigated for their effects on Ralstonia solanacearum race 4, and their potential use as bio-fumigants for treating pathogen- infested edible ginger (Zingiber officinale R.) fields. Three conce...

  7. Ralstonia solanacearum biovar 1 associated with a new outbreak of potato brown rot in Portugal

    Directory of Open Access Journals (Sweden)

    Leonor Cruz

    2008-10-01

    Full Text Available In May 2007, potato plants exhibiting symptoms possibly of brown rot were collected in some potato fields in the Baixo Mondego region (Center, Portugal, as a part of a nationwide programme to monitor Ralstonia solanacearum. All laboratory procedures laid down in Commission Directive 2006/63/EC, including dilution plating on semi-selective medium SMSA, indirect imunofluorescence (IIF, polymerase chain reaction (PCR using specific primers and bioassays on tomato plants, were strictly followed and the causal agent of the disease was identified as Ralstonia solanacearum. The identity of the pure cultures of the isolated organism was confirmed by PCR, IIF and pathogenicity tests on several other plant species (eggplant, tobacco, pelargonium and eucalyptus. In biovar determination, the failure of the isolates to utilise/oxidise certain carbon sources indicated that the isolates were all biovar 1. This biovar has a broader host range than biovar 2 strains, and affects several crops of economic importance including ornamental plants and forest trees. Comparative analysis of 16S rRNA and endoglucanase (egl gene sequences of these isolates with sequences that have been deposited at the GenBank revealed a similarity higher than 99% for several Ralstonia solanacearum isolates from biovar 1, including isolate DAR 64836 (Accession number DQ011551. This is the first report of Ralstonia solanacearum biovar 1 in Portugal. All control measures specified in the Commission Directive are being implemented.

  8. Evaluation of Resistance to Ralstonia solanacearum in Tomato Genetic Resources at Seedling Stage

    Directory of Open Access Journals (Sweden)

    Sang Gyu Kim

    2016-02-01

    Full Text Available Bacterial wilt of tomatoes caused by Ralstonia solanacearum is a devastating disease that limits the production of tomato in Korea. The best way to control this disease is using genetically resistant tomato plant. The resistance degree to R. solanacearum was evaluated for 285 tomato accessions conserved in the National Agrobiodiversity Center of Rural Development Administration. These accessions of tomato were originated from 23 countries. Disease severity of tomato accessions was investigated from 7 days to 14 days at an interval of 7 days after inoculation of R. solanacearum under greenhouse conditions. A total of 279 accessions of tomato germplasm were susceptible to R. solanacearum, resulting in wilt and death in 70 to 90% of these plants. Two tomato accessions were moderately resistant to R. solanacearum. Only four accessions showed high resistance against R. solanacearum. No distinct symptom of bacterial wilt appeared on the resistant tomato germplasms for up to 14 days after inoculation of R. solanacearum. Microscopy of resistant tomato stems infected with R. solanacearum revealed limited bacterial spread with thickening of pit membrane and gum production. Therefore, these four resistant tomato germplasms could be used in tomato breeding program against bacterial wilt.

  9. Detection of latent infection by Ralstonia solanacearum in potato ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-03

    Jun 3, 2008 ... solanacearum in potato tuber seed certification schemes more so in screening for presence of R. solanacearum in seed ... Bacterial wilt is, after late blight, the most important ... with respect to tuber-borne diseases such as bacterial wilt and those ... The potato crop was preceded by maize. Bacterial wilt ...

  10. Transposon mutagenesis reveals differential pathogenesis of Ralstonia solanacearum on tomato and Arabidopsis.

    Science.gov (United States)

    Lin, Yu-Mei; Chou, I-Chun; Wang, Jaw-Fen; Ho, Fang-I; Chu, Yu-Ju; Huang, Pei-Cheng; Lu, Der-Kang; Shen, Hwei-Ling; Elbaz, Mounira; Huang, Shu-Mei; Cheng, Chiu-Ping

    2008-09-01

    Ralstonia solanacearum causes a deadly wilting disease on a wide range of crops. To elucidate pathogenesis of this bacterium in different host plants, we set out to identify R. solanacearum genes involved in pathogenesis by screening random transposon insertion mutants of a highly virulent strain, Pss190, on tomato and Arabidopsis thaliana. Mutants exhibiting various decreased virulence levels on these two hosts were identified. Sequence analysis showed that most, but not all, of the identified pathogenesis genes are conserved among distinct R. solanacearum strains. A few of the disrupted loci were not reported previously as being involved in R. solanacearum pathogenesis. Notably, a group of mutants exhibited differential pathogenesis on tomato and Arabidopsis. These results were confirmed by characterizing allelic mutants in one other R. solanacearum strain of the same phylotype. The significantly decreased mutants' colonization in Arabidopsis was found to be correlated with differential pathogenesis on these two plants. Differential requirement of virulence genes suggests adaptation of this bacterium in different host environments. Together, this study reveals commonalities and differences of R. solanacearum pathogenesis on single solanaceous and nonsolanaceous hosts, and provides important new insights into interactions between R. solanacearum and different host plants.

  11. Metabolomics of tomato xylem sap during bacterial wilt reveals Ralstonia solanacearum produces abundant putrescine, a metabolite that accelerates wilt disease

    NARCIS (Netherlands)

    Lowe-Power, Tiffany M.; Hendrich, Connor G.; Roepenack-Lahaye, von Edda; Li, Bin; Wu, Dousheng; Mitra, Raka; Dalsing, Beth L.; Ricca, Patrizia; Naidoo, Jacinth; Cook, David; Jancewicz, Amy; Masson, Patrick; Thomma, Bart; Lahaye, Thomas; Michael, Anthony J.; Allen, Caitilyn

    2018-01-01

    Ralstonia solanacearum thrives in plant xylem vessels and causes bacterial wilt disease despite the low nutrient content of xylem sap. We found that R. solanacearum manipulates its host to increase nutrients in tomato xylem sap, enabling it to grow better in sap from infected plants than in sap from

  12. Effects of ecological factors on the survival and physiology of Ralstonia solanacearum biovar 2 in agricultural drainage water

    NARCIS (Netherlands)

    Elsas, van J.D.; Kastelein, P.; Vries, de P.M.; Overbeek, van L.S.

    2001-01-01

    The fate of Ralstonia solanacearum bv. 2, the causative agent of brown rot in potato, in aquatic habitats of temperate climate regions is still poorly understood. In this study, the population dynamics and the physiological response of R. solanacearum bv. 2 were tested in sterile pure water and in

  13. Extracellular DNases of Ralstonia solanacearum modulate biofilms and facilitate bacterial wilt virulence.

    Science.gov (United States)

    Minh Tran, Tuan; MacIntyre, April; Khokhani, Devanshi; Hawes, Martha; Allen, Caitilyn

    2016-11-01

    Ralstonia solanacearum is a soil-borne vascular pathogen that colonizes plant xylem vessels, a flowing, low-nutrient habitat where biofilms could be adaptive. Ralstonia solanacearum forms biofilm in vitro, but it was not known if the pathogen benefits from biofilms during infection. Scanning electron microscopy revealed that during tomato infection, R. solanacearum forms biofilm-like masses in xylem vessels. These aggregates contain bacteria embedded in a matrix including chromatin-like fibres commonly observed in other bacterial biofilms. Chemical and enzymatic assays demonstrated that the bacterium releases extracellular DNA in culture and that DNA is an integral component of the biofilm matrix. An R. solanacearum mutant lacking the pathogen's two extracellular nucleases (exDNases) formed non-spreading colonies and abnormally thick biofilms in vitro. The biofilms formed by the exDNase mutant in planta contained more and thicker fibres. This mutant was also reduced in virulence on tomato plants and did not spread in tomato stems as well as the wild-type strain, suggesting that these exDNases facilitate biofilm maturation and bacterial dispersal. To our knowledge, this is the first demonstration that R. solanacearum forms biofilms in plant xylem vessels, and the first documentation that plant pathogens use DNases to modulate their biofilm structure for systemic spread and virulence. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  14. Seleção de isolados de estreptomicetos para controle de Ralstonia solanacearum em tomateiro Selection of streptomycetes isolates for the control of Ralstonia solanacearum in tomato plants

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Tuão Gava

    2002-10-01

    Full Text Available Em condições tropicais, a murcha-bacteriana, causada por Ralstonia solanacearum, tem provocado danos severos à cultura do tomate (Lycopersicon esculentum Mill., principalmente em condições de temperaturas acima de 25°C, com umidade relativa elevada. Neste contexto, o controle biológico pode representar uma alternativa viável. Este trabalho teve como objetivo selecionar isolados de estreptomicetos para o controle de R. solanacearum em tomateiro. Entre os isolados avaliados verificaram-se diferenças na inibição do patógeno in vitro, tanto em relação à faixa de pH avaliada, quanto ao tempo de observação. Constataram-se, também, variações no estabelecimento dos isolados de estreptomicetos na rizosfera das plântulas e nas mudas preparadas para transplante, e os isolados SP164, SF232, SAc326 e SG384 apresentaram as densidades populacionais mais elevadas. O experimento conduzido em canteiros com solo infestado com R. solanacearum mostrou que as plantas tratadas com o isolado SG384 apresentaram melhor nível de controle, 48 dias após a semeadura, período no qual todas as testemunhas haviam morrido.The bacterial wilt caused by Ralstonia solanacearum causes high damages in tomato (Lycopersicon esculentum Mill. culture, mainly under temperature above 25ºC and high relative humidity. Because conventional methods of control have shown low efficiency, biological control is a promising alternative. This work aimed to select isolates of streptomycetes for R. solanacearum control in tomato. Differences were found among the isolates in the in vitro inhibition of the pathogen either in time or pH range. The streptomycetes isolates grew differently in the rhizosphere of seedlings and plantlets of tomato. The isolates SP164, SF232, SAc326 and SG384 showed the highest population densities. In the experiment conducted in soil infested with R. solanacearum, plants treated with the isolate SG384 presented best control level 48 days after sowing

  15. Genetic mapping of a major dominant gene for resistance to Ralstonia solanacearum in eggplant

    OpenAIRE

    Lebeau, A.; Gouy, M.; Daunay, Marie Christine; Wicker, E.; Chiroleu, F.; Prior, P.; Frary, Anne; Dintinger, J.

    2013-01-01

    Resistance of eggplant against Ralstonia solanacearum phylotype I strains was assessed in a F6 population of recombinant inbred lines (RILs) derived from a intra-specific cross between S. melongena MM738 (susceptible) and AG91-25 (resistant). Resistance traits were determined as disease score, percentage of wilted plants, and stem-based bacterial colonization index, as assessed in greenhouse experiments conducted in Réunion Island, France. The AG91-25 resistance was highly efficient toward st...

  16. Physiological, Biochemical and Genetic Characteristics of Ralstonia solanacearum Strains Isolated from Pepper Plants in Korea

    Directory of Open Access Journals (Sweden)

    Young Kee Lee

    2013-12-01

    Full Text Available Totally sixty three bacteria were isolated from lower stems showing symptoms of bacterial wilt on pepper plants in 14 counties of 7 provinces, Korea. The isolates showed strong pathogenicity on red pepper (cv. Daewang and tomato (cv. Seogwang seedlings. All virulent bacteria were identified as Ralstonia solanacearum based on colony types, physiological and biochemical tests and polymerase chain reaction (PCR. All R. solanacearum isolates from peppers were race 1. The bacterial isolates consisted of biovar 3 (27% and biovar 4 (73%. Based on polymorphic PCR bands generated by repetitive sequence (rep-PCR, the 63 R. solanacearum isolates were divided into 12 groups at 70% similarity level. These results will be used as basic materials for resistant breeding program and efficient control against bacterial wilt disease of pepper.

  17. Chlorine dioxide as a disinfectant for Ralstonia solanacearum control in water, storage and equipment

    Directory of Open Access Journals (Sweden)

    Popović Tatjana

    2016-01-01

    Full Text Available Brown rot or bacterial wilt caused by bacterium Ralstonia solanacearum is the main limiting factor in potato production. Quarantine measures are necessary to avoid spread of disease to disease-free areas. R. solanacearum has been shown to contaminate watercourses from which crop irrigation is then prohibited causing further potential losses in yield and quality. The bacteria also spread via surfaces that diseased seed potatoes come into contact with. This study showed bactericidal activity of chlorine dioxide (CIO2 on R. solanacearum for disinfection of water, surface and equipment. The results showed that CIO2 solution at concentration of 2 ppm at 30 minutes of exposure time had bactericidal effect for disinfection of water. For surface and equipment disinfection, concentration of 50 ppm showed total efficacy at 30 min and 5 sec exposure time, respectively. Results suggest that use of CIO2 as a disinfectant has a potential for control of brown rot pathogen in water, storage and equipment.

  18. Establishing a diagnostic system for detecting Ralstonia solanacearum and genetic differentiation using RAPD molecular markers

    Directory of Open Access Journals (Sweden)

    Edisson Chavarro Mesa

    2006-01-01

    Full Text Available A polymerase chain reaction-based diagnostic test (PCR has been developed for amplifying a región and obtaining a 292 bp product by using specific 16S rDNA primers for the rapid and precise identification of the causative agent (Ralstonia solanacearum of bacterial withering of potato in asymptomatic tubers. The bacteria was isolated from potato tubers and banana fruit using culturing techniques and immunological and molecular ELISA-NCM and PCR tests, respectively. PCR detected the presence of R. solanacearum on asymptomatic tubers by contrast with ELISA-NCM which did not detect this pathogen. Analysing random amplified polymorphic DNA (RAPD led to differentiating and grouping R. solanacearum by geographical región and bacterial strain, suggesting that differences exist amongst existing collections according to their place of origin, presenting high genetic variability. The results showed that PCR is a sensitive and specific test for detecting R. solanacearum and can therefore be implemented as a method for controlling this pathogen in seed production and certification programmes in áreas free of the disease. The pathogen has been shown to be genetically heterogeneous according to the samples' geographical área thereby hampering control in áreas of Colombia experiencing phytosanitary problems with R. solanacearum in potato crops Key words: bacterial withered, moko, PCR-16S rADN, ELISA-NCM, PCR-RAPD.

  19. Uso de polímeros em formulações para preservação de Pectobacterium atrosepticum e Ralstonia solanacearum Formulation with polymers for the Pectobacterium atrosepticum e Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Andréia Iraci Tumelero

    2008-02-01

    Full Text Available A sobrevivência de Pectobacterium atrosepticum e de Ralstonia solanacearum foi avaliada em veículo à base de goma xantana (GX, um polímero biológico, e de goma xantana acrescida de polivinilpirrolidona (PVP, um polímero sintético. As culturas, após crescimento até 10(11 ufc mL-1 foram injetadas junto a essas formulações e a sobrevivência avaliada em diferentes condições de armazenamento: em temperatura ambiente, em refrigerador (4ºC e em freezer (-20ºC, por 36 meses. A concentração de células viáveis foi realizada através de diluições seriadas. A patogenicidade foi avaliada em plantas hospedeiras e em iscas. Os resultados permitem observar que a concentração de células viáveis decresceu ao longo do tempo, mantendo-se entre 10³ e 10(4 ufc mL-1 ao final de três anos, exceto para a formulação à base de GX e armazenamento à -20°C, que se mostrou ineficiente para ambas as bactérias. Conclui-se, que os polímeros avaliados mostraram-se eficientes em preservar e manter as características bioquímicas e fisiológicas das bactérias Pectobacterium atrosepticum e de Ralstonia solanacearum.The survival of Pectobacterium atrosepticum and Ralstonia solanacearum was evaluated in biopolymer carrier xanthan gum (GX and xanthan gum together with polymer synthetic polyvinylpyrrolidone (PVP. The cultures after growing up to 10(11 ufc mL-1 were injected into the plolymers carriers. The survival of the bacteria was evaluated at room temperature, refrigerator (4ºC and freezer (-20ºC for 36 months. The evaluation of viability of the preserved bacteria was carried through seriate dilutions using drop method. The pathogenicity was observed in plant hosts and through baits. The results allow observing that the concentration of viable cells decreased along the time mainting to 10³ and 10(4 ufc mL-1 for three years with exception, of the formulation to the base of GX and storage the -20°C, that was inefficient for preservation of

  20. Identification and Genetic Characterization of Ralstonia solanacearum Species Complex Isolates from Cucurbita maxima in China

    Directory of Open Access Journals (Sweden)

    Xiaoman She

    2017-10-01

    Full Text Available Ralstonia solanacearum species complex is a devastating phytopathogen with an unusually wide host range, and new host plants are continuously being discovered. In June 2016, a new bacterial wilt on Cucurbita maxima was observed in Guangdong province, China. Initially, in the adult plant stage, several leaves of each plant withered suddenly and drooped; the plant then wilted completely, and the color of their vasculature changed to dark brown, ultimately causing the entire plant to die. Creamy-whitish bacterial masses were observed to ooze from crosscut stems of these diseased plants. To develop control strategies for C. maxima bacterial wilt, the causative pathogenic isolates were identified and characterized. Twenty-four bacterial isolates were obtained from diseased C. maxima plants, and 16S rRNA gene sequencing and pathogenicity analysis results indicated that the pathogen of C. maxima bacterial wilt was Ralstonia solanacearum. The results from DNA-based analysis, host range determination and bacteriological identification confirmed that the 24 isolates belonged to R. solanacearum phylotype I, race 1, and eight of these isolates belonged to biovar 3, while 16 belonged to biovar 4. Based on the results of partial egl gene sequence analysis, the 24 isolates clustered into three egl- sequence type groups, sequevars 17, 45, and 56. Sequevar 56 is a new sequevar which is described for the first time in this paper. An assessment of the resistance of 21 pumpkin cultivars revealed that C. moschata cv. Xiangyu1 is resistant to strain RS378, C. moschata cv. Xiangmi is moderately resistant to strain RS378, and 19 other pumpkin cultivars, including four C. maxima cultivars and 15 C. moschata cultivars, are susceptible to strain RS378. To the best of our knowledge, this is the first report of C. maxima bacterial wilt caused by R. solanacearum race 1 in the world. Our results provide valuable information for the further development of control strategies

  1. Identification and Genetic Characterization of Ralstonia solanacearum Species Complex Isolates from Cucurbita maxima in China.

    Science.gov (United States)

    She, Xiaoman; Yu, Lin; Lan, Guobing; Tang, Yafei; He, Zifu

    2017-01-01

    Ralstonia solanacearum species complex is a devastating phytopathogen with an unusually wide host range, and new host plants are continuously being discovered. In June 2016, a new bacterial wilt on Cucurbita maxima was observed in Guangdong province, China. Initially, in the adult plant stage, several leaves of each plant withered suddenly and drooped; the plant then wilted completely, and the color of their vasculature changed to dark brown, ultimately causing the entire plant to die. Creamy-whitish bacterial masses were observed to ooze from crosscut stems of these diseased plants. To develop control strategies for C. maxima bacterial wilt, the causative pathogenic isolates were identified and characterized. Twenty-four bacterial isolates were obtained from diseased C. maxima plants, and 16S rRNA gene sequencing and pathogenicity analysis results indicated that the pathogen of C. maxima bacterial wilt was Ralstonia solanacearum . The results from DNA-based analysis, host range determination and bacteriological identification confirmed that the 24 isolates belonged to R. solanacearum phylotype I, race 1, and eight of these isolates belonged to biovar 3, while 16 belonged to biovar 4. Based on the results of partial egl gene sequence analysis, the 24 isolates clustered into three egl- sequence type groups, sequevars 17, 45, and 56. Sequevar 56 is a new sequevar which is described for the first time in this paper. An assessment of the resistance of 21 pumpkin cultivars revealed that C. moschata cv. Xiangyu1 is resistant to strain RS378, C. moschata cv. Xiangmi is moderately resistant to strain RS378, and 19 other pumpkin cultivars, including four C. maxima cultivars and 15 C. moschata cultivars, are susceptible to strain RS378. To the best of our knowledge, this is the first report of C. maxima bacterial wilt caused by R. solanacearum race 1 in the world. Our results provide valuable information for the further development of control strategies for C. maxima wilt

  2. Control of Ralstonia Solanacearum The Causal Agent of Brown Rot in Potato Using Essential Oils

    International Nuclear Information System (INIS)

    Salem, E.A.

    2011-01-01

    Five essential oils, namely peppermint (Mentha piperita L.), caraway (Carium carvum L.), fennel (Foeniculum vulgare Mill.), lemongrass (Cymbopogon citratus Staph.) and thyme (Thymus vulgaris), were used separately against Ralstonia solanacearum; the causal agent of brown rot in potato. The most two effective oils (peppermint and thyme) were used in vitro and in vivo after testing their effects on potato tubers buds germination. Peppermint inhibited buds germination but thyme have no effects on buds germination. In vivo, the control of brown rot using thyme oil in glass house experiment reduced the percentage of brown rot infection to 30.6% and reduced the severity of disease from 5 to 3.

  3. Metabolomics of tomato xylem sap during bacterial wilt reveals Ralstonia solanacearum produces abundant putrescine, a metabolite that accelerates wilt disease.

    Science.gov (United States)

    Lowe-Power, Tiffany M; Hendrich, Connor G; von Roepenack-Lahaye, Edda; Li, Bin; Wu, Dousheng; Mitra, Raka; Dalsing, Beth L; Ricca, Patrizia; Naidoo, Jacinth; Cook, David; Jancewicz, Amy; Masson, Patrick; Thomma, Bart; Lahaye, Thomas; Michael, Anthony J; Allen, Caitilyn

    2018-04-01

    Ralstonia solanacearum thrives in plant xylem vessels and causes bacterial wilt disease despite the low nutrient content of xylem sap. We found that R. solanacearum manipulates its host to increase nutrients in tomato xylem sap, enabling it to grow better in sap from infected plants than in sap from healthy plants. Untargeted GC/MS metabolomics identified 22 metabolites enriched in R. solanacearum-infected sap. Eight of these could serve as sole carbon or nitrogen sources for R. solanacearum. Putrescine, a polyamine that is not a sole carbon or nitrogen source for R. solanacearum, was enriched 76-fold to 37 µM in R. solanacearum-infected sap. R. solanacearum synthesized putrescine via a SpeC ornithine decarboxylase. A ΔspeC mutant required ≥ 15 µM exogenous putrescine to grow and could not grow alone in xylem even when plants were treated with putrescine. However, co-inoculation with wildtype rescued ΔspeC growth, indicating R. solanacearum produced and exported putrescine to xylem sap. Intriguingly, treating plants with putrescine before inoculation accelerated wilt symptom development and R. solanacearum growth and systemic spread. Xylem putrescine concentration was unchanged in putrescine-treated plants, so the exogenous putrescine likely accelerated disease indirectly by affecting host physiology. These results indicate that putrescine is a pathogen-produced virulence metabolite. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

  4. Regulation Involved in Colonization of Intercellular Spaces of Host Plants in Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Yasufumi Hikichi

    2017-06-01

    Full Text Available A soil-borne bacterium Ralstonia solanacearum invading plant roots first colonizes the intercellular spaces of the root, and eventually enters xylem vessels, where it replicates at high levels leading to wilting symptoms. After invasion into intercellular spaces, R. solanacearum strain OE1-1 attaches to host cells and expression of the hrp genes encoding components of the type III secretion system (T3SS. OE1-1 then constructs T3SS and secrets effectors into host cells, inducing expression of the host gene encoding phosphatidic acid phosphatase. This leads to suppressing plant innate immunity. Then, OE1-1 grows on host cells, inducing quorum sensing (QS. The QS contributes to regulation of OE1-1 colonization of intercellular spaces including mushroom-type biofilm formation on host cells, leading to its virulence. R. solanacearum strains AW1 and K60 produce methyl 3-hydroxypalmitate (3-OH PAME as a QS signal. The methyltransferase PhcB synthesizes 3-OH PAME. When 3-OH PAME reaches a threshold level, it increases the ability of the histidine kinase PhcS to phosphorylate the response regulator PhcR. This results in elevated levels of functional PhcA, the global virulence regulator. On the other hand, strains OE1-1 and GMI1000 produce methyl 3-hydroxymyristate (3-OH MAME as a QS signal. Among R. solanacearum strains, the deduced PhcB and PhcS amino acid sequences are related to the production of QS signals. R. solanacearum produces aryl-furanone secondary metabolites, ralfuranones, which are extracellularly secreted and required for its virulence, dependent on the QS. Interestingly, ralfuranones affect the QS feedback loop. Taken together, integrated signaling via ralfuranones influences the QS, contributing to pathogen virulence.

  5. Bacterial wilt of potato (Ralstonia solanacearum race 3, biovar 2): disease management, pathogen survival and possible eradication

    NARCIS (Netherlands)

    Messiha, N.A.S.

    2006-01-01

    Potato brown rot, caused by Ralstonia solanacearum race 3 biovar 2 (Phylovar II, sequevar 1), is a serious endemic disease in the Nile Delta of Egypt. It is a quarantine disease in the EU, and export of potatoes from

  6. Simple sequence repeats and compositional bias in the bipartite Ralstonia solanacearum GMI1000 genome

    Directory of Open Access Journals (Sweden)

    Vandamme Peter

    2003-03-01

    Full Text Available Abstract Background Ralstonia solanacearum is an important plant pathogen. The genome of R. solananearum GMI1000 is organised into two replicons (a 3.7-Mb chromosome and a 2.1-Mb megaplasmid and this bipartite genome structure is characteristic for most R. solanacearum strains. To determine whether the megaplasmid was acquired via recent horizontal gene transfer or is part of an ancestral single chromosome, we compared the abundance, distribution and compositon of simple sequence repeats (SSRs between both replicons and also compared the respective compositional biases. Results Our data show that both replicons are very similar in respect to distribution and composition of SSRs and presence of compositional biases. Minor variations in SSR and compositional biases observed may be attributable to minor differences in gene expression and regulation of gene expression or can be attributed to the small sample numbers observed. Conclusions The observed similarities indicate that both replicons have shared a similar evolutionary history and thus suggest that the megaplasmid was not recently acquired from other organisms by lateral gene transfer but is a part of an ancestral R. solanacearum chromosome.

  7. RD19, an Arabidopsis cysteine protease required for RRS1-R-mediated resistance, is relocalized to the nucleus by the Ralstonia solanacearum PopP2 effector

    NARCIS (Netherlands)

    Bernoux, M.; Timmers, T.; Jauneau, A.; Brière, C.; Wit, de P.J.G.M.; Marco, Y.; Deslandes, L.

    2008-01-01

    Bacterial wilt, a disease impacting cultivated crops worldwide, is caused by the pathogenic bacterium Ralstonia solanacearum. PopP2 (for Pseudomonas outer protein P2) is an R. solanacearum type III effector that belongs to the YopJ/AvrRxv protein family and interacts with the Arabidopsis thaliana

  8. A computer program for fast and easy typing of partial endoglucanase gene sequence into phylotypes and sequevars 1&2 (select agents) of Ralstonia solanacearum

    Science.gov (United States)

    The phytopathogen Ralstonia solanacearum is a species complex that contains a subset of strains that are quarantined or select agent pathogens. An unidentified R. solanacearum strain is considered a select agent in the US until proven otherwise, which can be done by phylogenetic analysis of a partia...

  9. Characterization of an antibiotic produced by Bacillus subtilis JW-1 that suppresses Ralstonia solanacearum.

    Science.gov (United States)

    Kwon, Jae Won; Kim, Shin Duk

    2014-01-01

    Bacillus subtilis JW-1 was isolated from rhizosphere soil as a potential biocontrol agent of bacterial wilt caused by Ralstonia solanacearum. Seed treatment followed by a soil drench application with this strain resulted in >80% reduction in bacterial wilt disease compared with that in the untreated control under greenhouse conditions. The antibacterial compound produced by strain JW-1 was purified by bioactivity-guided fractionation. Based on mass spectroscopy and nuclear magnetic resonance spectral data ((1)H, (13)C, (1)H-(1)H correlation spectroscopies, rotating frame nuclear Overhauser effect spectroscopy, and heteronuclear multiple-bond correlation spectroscopy), the structure of this compound was elucidated as a cyclic lipopeptide composed of a heptapeptide (Gln-Leu-Leu-Val-Asp-Leu-Leu) bonded to a β-hydroxy-iso-hexadecanoic acid arranged in a lactone ring system.

  10. Filamentous phages of Ralstonia solanacearum: double-edged swords for pathogenic bacteria.

    Science.gov (United States)

    Yamada, Takashi

    2013-01-01

    Some phages from genus Inovirus use host or bacteriophage-encoded site-specific integrases or recombinases establish a prophage state. During integration or excision, a superinfective form can be produced. The three states (free, prophage, and superinfective) of such phages exert different effects on host bacterial phenotypes. In Ralstonia solanacearum, the causative agent of bacterial wilt disease of crops, the bacterial virulence can be positively or negatively affected by filamentous phages, depending on their state. The presence or absence of a repressor gene in the phage genome may be responsible for the host phenotypic differences (virulent or avirulent) caused by phage infection. This strategy of virulence control may be widespread among filamentous phages that infect pathogenic bacteria of plants.

  11. Ralstonia syzygii, the Blood Disease Bacterium and Some Asian R. solanacearum Strains Form a Single Genomic Species Despite Divergent Lifestyles

    Science.gov (United States)

    Cellier, Gilles; Jacobs, Jonathan M.; Mangenot, Sophie; Barbe, Valérie; Lajus, Aurélie; Vallenet, David; Medigue, Claudine; Fegan, Mark; Allen, Caitilyn; Prior, Philippe

    2011-01-01

    The Ralstonia solanacearum species complex includes R. solanacearum, R. syzygii, and the Blood Disease Bacterium (BDB). All colonize plant xylem vessels and cause wilt diseases, but with significant biological differences. R. solanacearum is a soilborne bacterium that infects the roots of a broad range of plants. R. syzygii causes Sumatra disease of clove trees and is actively transmitted by cercopoid insects. BDB is also pathogenic to a single host, banana, and is transmitted by pollinating insects. Sequencing and DNA-DNA hybridization studies indicated that despite their phenotypic differences, these three plant pathogens are actually very closely related, falling into the Phylotype IV subgroup of the R. solanacearum species complex. To better understand the relationships among these bacteria, we sequenced and annotated the genomes of R. syzygii strain R24 and BDB strain R229. These genomes were compared to strain PSI07, a closely related Phylotype IV tomato isolate of R. solanacearum, and to five additional R. solanacearum genomes. Whole-genome comparisons confirmed previous phylogenetic results: the three phylotype IV strains share more and larger syntenic regions with each other than with other R. solanacearum strains. Furthermore, the genetic distances between strains, assessed by an in-silico equivalent of DNA-DNA hybridization, unambiguously showed that phylotype IV strains of BDB, R. syzygii and R. solanacearum form one genomic species. Based on these comprehensive data we propose a revision of the taxonomy of the R. solanacearum species complex. The BDB and R. syzygii genomes encoded no obvious unique metabolic capacities and contained no evidence of horizontal gene transfer from bacteria occupying similar niches. Genes specific to R. syzygii and BDB were almost all of unknown function or extrachromosomal origin. Thus, the pathogenic life-styles of these organisms are more probably due to ecological adaptation and genomic convergence during vertical

  12. Antagonism of Two Plant-Growth Promoting Bacillus velezensis Isolates Against Ralstonia solanacearum and Fusarium oxysporum.

    Science.gov (United States)

    Cao, Yu; Pi, Hualiang; Chandrangsu, Pete; Li, Yongtao; Wang, Yuqi; Zhou, Han; Xiong, Hanqin; Helmann, John D; Cai, Yanfei

    2018-03-12

    Plant growth promoting rhizobacteria (PGPR) provide an effective and environmentally sustainable method to protect crops against pathogens. The spore-forming Bacilli are attractive PGPR due to their ease of storage and application. Here, we characterized two rhizosphere-associated Bacillus velezensis isolates (Y6 and F7) that possess strong antagonistic activity against Ralstonia solanacearum and Fusarium oxysporum under both laboratory and greenhouse conditions. We identified three lipopeptide (LP) compounds (surfactin, iturin and fengycin) as responsible for the antimicrobial activity of these two strains. We further dissected the contribution of LPs to various biological processes important for rhizosphere colonization. Although either iturin or fengycin is sufficient for antibacterial activity, cell motility and biofilm formation, only iturin plays a primary role in defense against the fungal pathogen F. oxysporum. Additionally, we found that LP production is significantly stimulated during interaction with R. solanacearum. These results demonstrate the different roles of LPs in the biology of B. velezensis and highlight the potential of these two isolates as biocontrol agents against phytopathogens.

  13. Recent Trends in Control Methods for Bacterial Wilt Diseases Caused by Ralstonia solanacearum

    Science.gov (United States)

    Yuliar; Nion, Yanetri Asi; Toyota, Koki

    2015-01-01

    Previous studies have described the development of control methods against bacterial wilt diseases caused by Ralstonia solanacearum. This review focused on recent advances in control measures, such as biological, physical, chemical, cultural, and integral measures, as well as biocontrol efficacy and suppression mechanisms. Biological control agents (BCAs) have been dominated by bacteria (90%) and fungi (10%). Avirulent strains of R. solanacearum, Pseudomonas spp., Bacillus spp., and Streptomyces spp. are well-known BCAs. New or uncommon BCAs have also been identified such as Acinetobacter sp., Burkholderia sp., and Paenibacillus sp. Inoculation methods for BCAs affect biocontrol efficacy, such as pouring or drenching soil, dipping of roots, and seed coatings. The amendment of different organic matter, such as plant residue, animal waste, and simple organic compounds, have frequently been reported to suppress bacterial wilt diseases. The combined application of BCAs and their substrates was shown to more effectively suppress bacterial wilt in the tomato. Suppression mechanisms are typically attributed to the antibacterial metabolites produced by BCAs or those present in natural products; however, the number of studies related to host resistance to the pathogen is increasing. Enhanced/modified soil microbial communities are also indirectly involved in disease suppression. New promising types of control measures include biological soil disinfection using substrates that release volatile compounds. This review described recent advances in different control measures. We focused on the importance of integrated pest management (IPM) for bacterial wilt diseases. PMID:25762345

  14. Phytobiocidal management of bacterial wilt of tomato caused by Ralstonia solanacearum (Smith) Yabuuchi

    Energy Technology Data Exchange (ETDEWEB)

    Din, N.; Ahmad, M.; Siddique, M.; Ali, A.; Naz, I.; Ullah, N.; Ahmad, F.

    2016-11-01

    Phytobiocides are a good alternative to chemicals in managing bacterial diseases including bacterial wilt of tomato caused by Ralstonia solanacearum. In the present research study, finely ground dried powders of seven widely available medicinal plants/weeds species viz., Peganum harmala (esfand or wild rue), Calotropis procera (sodom apple), Melia azedarach (white cedar), Allium sativum (garlic), Adhatoda vasica (malabar nut), Tagetes patula (marigold) and Nerium oleander (oleander) were assessed for their anti-microbial activity, both in-vitro (10% w/v) and in-vivo (10, 20, 30, and 40 g/kg of potted soil) against R. solanacearum. Aqueous extracts (prepared as 10% w/v, soaking for 48-72 h and filtering) of C. procera, A. vasica, and T. patula inhibited the in-vitro growth of the bacterial pathogen over 60% of that produced by the standard antibiotic streptomycin. A. sativum, N. oleander and P. harmala aqueous extracts were less effective while M. azedarach showed no effect against R. solanacearum. The higher dose (40 g/kg of soil) of C. procera, A. vasica and T. patula decreased disease severity quite effectively and increased yield and plant growth characters as much as the standard antibiotic did. No phytotoxicity of medicinal plants powder was observed on tomato plants. Alkaloids, flavonoids, tannins, saponins and terpenoids were detected in the aqueous extracts of T. patula and A. vasica whereas C. procera was found to have only alkaloids, flavonoids, tannins and saponins. Our data suggest that dried powders of T. patula, C. procera and A. vasica (40 g/kg of soil) could be used as an effective component in the integrated disease management programs against bacterial wilt of tomato. (Author)

  15. Monitoring of phytopathogenic Ralstonia solanacearum cells using green fluorescent protein-expressing plasmid derived from bacteriophage phiRSS1.

    Science.gov (United States)

    Kawasaki, Takeru; Satsuma, Hideki; Fujie, Makoto; Usami, Shoji; Yamada, Takashi

    2007-12-01

    A green fluorescent protein (GFP)-expressing plasmid was constructed from a filamentous bacteriophage phiRSS1 that infects the phytopathogen Ralstonia solanacearum. This plasmid designated as pRSS12 (4.7 kbp in size) consists of an approximately 2248 bp region of the phiRSS1 RF DNA, including ORF1-ORF3 and the intergenic region (IG), and a Km cassette in addition to the GFP gene. It was easily introduced by electroporation and stably maintained even without selective pressure in strains of R. solanacearum of different races and biovars. Strong green fluorescence emitted from pRSS12-transformed bacterial cells was easily monitored in tomato tissues (stem, petiole, and root) after infection as well as from soil samples. These results suggest that pRSS12 can serve as an easy-to-use GFP-tagging tool for any given strain of R. solanacearum in cytological as well as field studies.

  16. [Identification, colonization and disease prevention capacity of an antagonistic bacterium against Ralstonia Solanacearum].

    Science.gov (United States)

    Li, Zhikun; Zhu, Honghui

    2010-03-01

    To isolate a bacterial strain YPP-9, dominantly colonizing the rhizosphere of tomato using root exudate medium. In this study, we investigated the antagnism and disease-controling effect against Ralstonia solanacearum, evaluated the ability to colonize the rhizosphere of tomato, and further analyzed the phylogeny of YPP-9. To evaluate the antagnism against R. solanacearum and the biocontrol on tomato bacterial wilt by YPP-9 respectively employing plate culture method and pot experiment in green house. We analyzed the rhizosphere colonization of YPP-9 by PCR-denaturing gradient gel electrophoresis, and also identified the taxonomic position of YPP-9 using morphological and chemotaxonomic characteristics together with 16S rRNA gene phylogenetic analysis. YPP-9 suppressed the growth of R. solanacearum (strains SSF-4) in vitro with the inhibition zone of 5 mm. The disease-control efficiency against tomato bacterial wilt in pot was 63.4%. YPP-9 also colonized the rhizosphere of tomato well. The colonies were cream in colour after 24 h culture. Cells were gram-positive, rods (1.8 -4.1 microm x 0.9 - 1.1 microm) and formed endospores. Endospores were mainly ellipsoidal to cylindrical and lied in subterminal, and occasionally paracentral, positions in no swollen sporangia. No crystal protein. The pH range for YPP-9 growth was 5.5 - 8.5 with the optimum at pH 6.0, and the temperature for YPP-9 growth was 20 to 45 degrees with the optimum at 30 degrees. The results of BIOLOG GP2 showed that YPP-9 was Bacillus. Phylogenetic analysis of the 16S rRNA gene sequence revealed that YPP-9 was the most closely related to Bacillus fumarioli, with the sequence similarity of 97.7%. The sequence number was FJ231500. The DNA G + C content was 41.9%. The major menaquinone was MK-7. The dominant fatty acids in cell wall were C14 : 0 iso, C15 : 0 iso, C16 : 0 iso and C16 : 1omega 7c alcohol, with the contents of 28.27%, 19.59%, 12.93% and 10.88%, respectively. Bacterium YPP-9 strongly

  17. Comparative Transcriptome Analysis Reveals Cool Virulence Factors of Ralstonia solanacearum Race 3 Biovar 2.

    Science.gov (United States)

    Meng, Fanhong; Babujee, Lavanya; Jacobs, Jonathan M; Allen, Caitilyn

    2015-01-01

    While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2) subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.

  18. Comparative Transcriptome Analysis Reveals Cool Virulence Factors of Ralstonia solanacearum Race 3 Biovar 2.

    Directory of Open Access Journals (Sweden)

    Fanhong Meng

    Full Text Available While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2 subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.

  19. Reducción de poblaciones de Ralstonia solanacearum raza 2 (Smith en plátano (Musa AAB Simmonds con aplicación de extractos de Trichoderma sp. (Alexopoulus y Mims y bacterias antagonistas

    Directory of Open Access Journals (Sweden)

    Germán Ceballos

    2014-01-01

    Full Text Available El moko, enfermedad causada por Ralstonia solanacearum raza 2, afecta la producción de plátano (Musa AAB Simmonds en Colombia, ocasionando pérdidas hasta de 100%. In vitro, se evaluó el efecto de filtrados crudos de cepas de Trichoderma sp. y dos productos comerciales como posibles reductores de poblaciones de R. solanacearum. Para cada cepa de Trichoderma spp., se empleó filtrado (40% en solución acuosa y para R. solanacearum se utilizó una dilución de 10-4 por caja de petri, en un diseño completamente al azar con tres repeticiones para determinar el número de unidades formadoras de colonia de R. solanacearum. En invernadero, se aplicaron suspensiones de T. harzianum (Agroguard®, T. viride 14PDA3A y Ecoterra® en plantas de plátano Dominico Hartón y 30 días después se inoculó R. solanacearum en un diseño de bloques completos al azar con cuatro repeticiones. La severidad del ataque de R. solanacearum se evaluó utilizando una escala de síntomas foliares de 0 a 6. In vitro, los extractos crudos de dos cepas y dos productos comerciales de Trichoderma spp. inhibieron el 100% de R. solanacearum. Los tratamientos con T. viride y Ecoterra® mostraron bajos niveles de control de R. solanacearum en plantas (0.63 y 1.88, respectivamente.

  20. Genetic mapping of a major dominant gene for resistance to Ralstonia solanacearum in eggplant.

    Science.gov (United States)

    Lebeau, A; Gouy, M; Daunay, M C; Wicker, E; Chiroleu, F; Prior, P; Frary, A; Dintinger, J

    2013-01-01

    Resistance of eggplant against Ralstonia solanacearum phylotype I strains was assessed in a F(6) population of recombinant inbred lines (RILs) derived from a intra-specific cross between S. melongena MM738 (susceptible) and AG91-25 (resistant). Resistance traits were determined as disease score, percentage of wilted plants, and stem-based bacterial colonization index, as assessed in greenhouse experiments conducted in Réunion Island, France. The AG91-25 resistance was highly efficient toward strains CMR134, PSS366 and GMI1000, but only partial toward the highly virulent strain PSS4. The partial resistance found against PSS4 was overcome under high inoculation pressure, with heritability estimates from 0.28 to 0.53, depending on the traits and season. A genetic map was built with 119 AFLP, SSR and SRAP markers positioned on 18 linkage groups (LG), for a total length of 884 cM, and used for quantitative trait loci (QTL) analysis. A major dominant gene, named ERs1, controlled the resistance to strains CMR134, PSS366, and GMI1000. Against strain PSS4, this gene was not detected, but a significant QTL involved in delay of disease progress was detected on another LG. The possible use of the major resistance gene ERs1 in marker-assisted selection and the prospects offered for academic studies of a possible gene for gene system controlling resistance to bacterial wilt in solanaceous plants are discussed.

  1. Proteome Analysis of Disease Resistance against Ralstonia solanacearum in Potato Cultivar CT206-10

    Directory of Open Access Journals (Sweden)

    Sangryeol Park

    2016-02-01

    Full Text Available Potato is one of the most important crops worldwide. Its commercial cultivars are highly susceptible to many fungal and bacterial diseases. Among these, bacterial wilt caused by Ralstonia solanacearum causes significant yield loss. In the present study, integrated proteomics and genomics approaches were used in order to identify bacterial wilt resistant genes from Rs resistance potato cultivar CT-206-10. 2-DE and MALDI-TOF/TOF-MS analysis identified eight differentially abundant proteins including glycine-rich RNA binding protein (GRP, tomato stress induced-1 (TSI-1 protein, pathogenesis-related (STH-2 protein and pentatricopeptide repeat containing (PPR protein in response to Rs infection. Further, semi-quantitative RT-PCR identified up-regulation in transcript levels of all these genes upon Rs infection. Taken together, our results showed the involvement of the identified proteins in the Rs stress tolerance in potato. In the future, it would be interesting to raise the transgenic plants to further validate their involvement in resistance against Rs in potato.

  2. Draft Genome Sequence of Highly Virulent Race 4/Biovar 3 of Ralstonia solanacearum CaRs_Mep Causing Bacterial Wilt in Zingiberaceae Plants in India.

    Science.gov (United States)

    Kumar, Aundy; Munjal, Vibhuti; Sheoran, Neelam; Prameela, Thekkan Puthiyaveedu; Suseelabhai, Rajamma; Aggarwal, Rashmi; Jain, Rakesh Kumar; Eapen, Santhosh J

    2017-01-05

    The genome of Ralstonia solanacearum CaRs_Mep, a race 4/biovar 3/phylotype I bacterium causing wilt in small cardamom and other Zingiberaceae plants, was sequenced. Analysis of the 5.7-Mb genome sequence will aid in better understanding of the genetic determinants of host range, host jump, survival, pathogenicity, and virulence of race 4 of R. solanacearum. Copyright © 2017 Kumar et al.

  3. Detecção de Ralstonia solanacearum em tubérculos de batata através de PCR qualitativa e quantitativa

    OpenAIRE

    Adriana de Andrade Figueiró

    2008-01-01

    Ralstonia solanacearum é uma bactéria transmitida por tubérculos-semente. As biovares 1 (raça 1) e 2 (raça 3) estão associadas à batata (Solanum tuberosum) e apresentam características epidemiológicas diferentes. A certificação de tubérculos-semente constitui-se num processo essencial para o manejo da murcha bacteriana, mas depende de métodos específicos e sensíveis de detecção deste patógeno. Este trabalho objetivou (i) projetar oligonucleotídeos iniciadores para diferenciação das biovares d...

  4. Evaluación de vermicompostas de origen vegetal para el manejo de ralstonia solanacearum y pectobacterium carotovorum subsp. carotovorum.

    OpenAIRE

    Flores Ocampo, Mitzi

    2016-01-01

    La vermicomposta es un tipo de abono orgánico basado en un proceso de biooxidación y estabilización de desechos orgánicos que involucran interacciones entre lombrices y microorganismos del suelo; su potencial como bioplaguicida contra fitopatógenos ha sido poco estudiado pero depende del tipo de materia orgánica con que se alimente a la lombriz. Pectobacterium carotovorum subsp. carotovorum y Ralstonia solanacearum son bacterias que causan enfermedades en Solanáceas, tanto en c...

  5. A duplex PCR assay for the detection of Ralstonia solanacearum phylotype II strains in Musa spp.

    Directory of Open Access Journals (Sweden)

    Gilles Cellier

    Full Text Available Banana wilt outbreaks that are attributable to Moko disease-causing strains of the pathogen Ralstonia solanacearum (Rs remain a social and economic burden for both multinational corporations and subsistence farmers. All known Moko strains belong to the phylotype II lineage, which has been previously recognized for its broad genetic basis. Moko strains are paraphyletic and are distributed among seven related but distinct phylogenetic clusters (sequevars that are potentially major threats to Musaceae, Solanaceae, and ornamental crops in many countries. Although clustered within the Moko IIB-4 sequevar, strains of the epidemiologically variant IIB-4NPB do not cause wilt on Cavendish or plantain bananas; instead, they establish a latent infection in the vascular tissues of plantains and demonstrate an expanded host range and high aggressiveness toward Solanaceae and Cucurbitaceae. Although most molecular diagnostic methods focus on strains that wilt Solanaceae (particularly potato, no relevant protocol has been described that universally detects strains of the Musaceae-infecting Rs phylotype II. Thus, a duplex PCR assay targeting Moko and IIB-4NPB variant strains was developed, and its performance was assessed using an extensive collection of 111 strains representing the known diversity of Rs Moko-related strains and IIB-4NPB variant strains along with certain related strains and families. The proposed diagnostic protocol demonstrated both high accuracy (inclusivity and exclusivity and high repeatability, detected targets on either pure culture or spiked plant extracts. Although they did not belong to the Moko clusters described at the time of the study, recently discovered banana-infecting strains from Brazil were also detected. According to our comprehensive evaluation, this duplex PCR assay appears suitable for both research and diagnostic laboratories and provides reliable detection of phylotype II Rs strains that infect Musaceae.

  6. Biovar Differentiation and Variation in Virulence of Ralstonia solanacearum Isolates Infecting Solanaceous Vegetables

    Directory of Open Access Journals (Sweden)

    Ram Devi Timila

    2016-12-01

    Full Text Available Bacterial wilt caused by Ralstonia solanacearum E.F. Smith is one of the destructive diseases of solanaceous vegetables specially tomato (Lycopersicon esculentum L. and eggplant (Solanum melongena L.. Experiments were conducted to determine biovar types existing among the strains or isolates of Nepal and variation in virulence in some vegetables belonging to solanaceae family. A total of 39 isolates infecting tomato, eggplant, chilli and potato collected from different parts of Nepal were analyzed for biovar types on the basis of 3 disaccharides and 3 hexose alcohols oxidation test. Experiments were conducted to determine variation in virulence or aggressiveness of some of the isolates under screen house conditions using three host differentials such as Pusa Ruby (susceptible, Bishesh (moderately resistant and Srijana (resistant tomato cultivars. Of the 39 isolates, 23 were biovar III, three biovar II, three biovar IV, and one was biovar I. Nine isolates could not be differentiated into any of the five biovars. For breeding and epidemiological purposes it is very important to analyze the variability of aggressiveness. A total of 5 isolates collected from different places were included in the test. Isolates from Bhaktapur was found the most virulent causing wilt in the variety Bishesh (moderately resistant. Other isolates had the negative impact with zero wilt on the differentials used. Isolates from Jungekhola of Dhading district did not induce wilt even on susceptible variety (Pusa Ruby, but exhibited only senescence reaction. The result indicated that there is some slight variation among the isolates tested. Some effective management tactics might be needed in those locations where highly aggressive or virulent strain of bacterial wilt is prevalent, because resistant variety may not be stable in such locations.

  7. Arabidopsis wat1 (walls are thin1)-mediated resistance to the bacterial vascular pathogen, Ralstonia solanacearum, is accompanied by cross-regulation of salicylic acid and tryptophan metabolism

    NARCIS (Netherlands)

    Denancé, N.; Ranocha, P.; Oria, N.; Barlet, X.; Rivière, M.P.; Yadeta, K.A.; Hoffmann, L.; Perreau, F.; Clément, G.; Maia-Grondard, A.; Berg, van den G.C.M.; Savelli, B.; Fournier, S.; Aubert, Y.; Pelletier, S.; Thomma, B.P.H.J.; Molina, A.; Jouanin, L.; Marco, Y.; Goffner, D.

    2013-01-01

    Inactivation of Arabidopsis WAT1 (Walls Are Thin1), a gene required for secondary cell-wall deposition, conferred broad-spectrum resistance to vascular pathogens, including the bacteria Ralstonia solanacearum and Xanthomonas campestris pv. campestris, and the fungi Verticillium dahliae and

  8. Ralstonia (Pseudomonas) solanacearum race 3 (biovar 2) in surface water and natural weed hosts: First report on stinging nettle (Urtica dioica)

    NARCIS (Netherlands)

    Wenneker, M.; Verdel, M.S.W.; Groeneveld, R.M.W.; Kempenaar, C.; Beuningen, van A.R.; Janse, J.D.

    1999-01-01

    The population dynamics of the brown rot bacterium Ralstonia (Pseudomonas) solanacearum in surface water of two selected water-areas were monitored over a two-year period. In some cases during summer, high bacterial numbers (up to 106 cfu l−1) were observed. In a host plant survey a few plants of

  9. In vitro investigations on host specificity of ralstonia solanacearum among solanaceous crops and its biological control in tomato

    International Nuclear Information System (INIS)

    Hasan, S.; Haq, M. I.; Naz, F.; Tahir, M. I.

    2016-01-01

    Ralstonia solanacearum, the causal organism of bacterial wilt of solanaceous crops is a major limitation on the production of solanaceous crops worldwide. The present studies were carried out to explore the prevalence, severity, virulence and host specificity range of R. solanacearum in chili, tomato, eggplant and potato plants while biocontrol of this pathogen was studied on tomato. The isolation and the initial identification of bacterium were done on TTC and 523 media. Out of 32 isolates, 30 showed positive hypersensitive reaction (HR) with variable response and were confirmed as R. solanacearum by performing biochemical tests i.e. Gram staining, KOH, catalase oxidation, Kovacs oxidation, levan production from sucrose, lipase activity on tween 80 agar, production of fluorescent pigment, and oxidation/fermentation of glucose. Race identification studies showed that all the isolates belonged to Race 3 while biovar confirmation tests revealed that 4, 3 and 23 isolates belonged to biovar 1, biovar 2 and biovar 3, respectively. The isolates belonging to distinct biovar class were tested for their wideness of host range by challenging them to chili, tomato, eggplant and potato plants. It was observed that biovar 3 is the most aggressive and has widest host range as compared to counterparts. Biocontrol studies through antagonistic rhizobacteria resulted four antagonistic isolates; PRB10, PAP5, PAT1 and PTR6 having the highest biocontrol activity with 98.75%, 97.5%, 93.75% and 91.25% respectively. (author)

  10. Rhizophagus irregularis MUCL 41833 transitorily reduces tomato bacterial wilt incidence caused by Ralstonia solanacearum under in vitro conditions.

    Science.gov (United States)

    Chave, Marie; Crozilhac, Patrice; Deberdt, Péninna; Plouznikoff, Katia; Declerck, Stéphane

    2017-10-01

    Bacterial wilt caused by Ralstonia solanacearum is one of the world's most important soil-borne plant diseases. In Martinique, French West Indies, a highly virulent new pathogenic variant of this bacterium (phylotype IIB/4NPB) severely impacts tomato production. Here we report on the effect of R. solanacearum CFBP 6783, classified in phytotype IIB/4NPB, on tomato plantlets grown under strict in vitro culture conditions in the presence or absence of the arbuscular mycorrhizal fungus Rhizophagus irregularis MUCL 41833. A mycelium donor plant (i.e. Crotalaria spectabilis) was used for rapid, uniform mycorrhization of tomato plantlets that were subsequently infected by the bacterium. Bacterial wilt was significantly delayed and the incidence of the disease consequently reduced in the mycorrhizal tomato plantlets. Conversely, R. solanacearum did not affect root colonization by the AMF within the 16 days of the experiment. These results suggested that the mycorrhizal fungus was able to reduce bacterial wilt symptoms, probably by eliciting defence mechanisms in the plant.

  11. Escaping Underground Nets: Extracellular DNases Degrade Plant Extracellular Traps and Contribute to Virulence of the Plant Pathogenic Bacterium Ralstonia solanacearum

    Science.gov (United States)

    Tran, Tuan Minh; MacIntyre, April; Hawes, Martha; Allen, Caitilyn

    2016-01-01

    Plant root border cells have been recently recognized as an important physical defense against soil-borne pathogens. Root border cells produce an extracellular matrix of protein, polysaccharide and DNA that functions like animal neutrophil extracellular traps to immobilize pathogens. Exposing pea root border cells to the root-infecting bacterial wilt pathogen Ralstonia solanacearum triggered release of DNA-containing extracellular traps in a flagellin-dependent manner. These traps rapidly immobilized the pathogen and killed some cells, but most of the entangled bacteria eventually escaped. The R. solanacearum genome encodes two putative extracellular DNases (exDNases) that are expressed during pathogenesis, suggesting that these exDNases contribute to bacterial virulence by enabling the bacterium to degrade and escape root border cell traps. We tested this hypothesis with R. solanacearum deletion mutants lacking one or both of these nucleases, named NucA and NucB. Functional studies with purified proteins revealed that NucA and NucB are non-specific endonucleases and that NucA is membrane-associated and cation-dependent. Single ΔnucA and ΔnucB mutants and the ΔnucA/B double mutant all had reduced virulence on wilt-susceptible tomato plants in a naturalistic soil-soak inoculation assay. The ΔnucA/B mutant was out-competed by the wild-type strain in planta and was less able to stunt root growth or colonize plant stems. Further, the double nuclease mutant could not escape from root border cells in vitro and was defective in attachment to pea roots. Taken together, these results demonstrate that extracellular DNases are novel virulence factors that help R. solanacearum successfully overcome plant defenses to infect plant roots and cause bacterial wilt disease. PMID:27336156

  12. Escaping Underground Nets: Extracellular DNases Degrade Plant Extracellular Traps and Contribute to Virulence of the Plant Pathogenic Bacterium Ralstonia solanacearum.

    Directory of Open Access Journals (Sweden)

    Tuan Minh Tran

    2016-06-01

    Full Text Available Plant root border cells have been recently recognized as an important physical defense against soil-borne pathogens. Root border cells produce an extracellular matrix of protein, polysaccharide and DNA that functions like animal neutrophil extracellular traps to immobilize pathogens. Exposing pea root border cells to the root-infecting bacterial wilt pathogen Ralstonia solanacearum triggered release of DNA-containing extracellular traps in a flagellin-dependent manner. These traps rapidly immobilized the pathogen and killed some cells, but most of the entangled bacteria eventually escaped. The R. solanacearum genome encodes two putative extracellular DNases (exDNases that are expressed during pathogenesis, suggesting that these exDNases contribute to bacterial virulence by enabling the bacterium to degrade and escape root border cell traps. We tested this hypothesis with R. solanacearum deletion mutants lacking one or both of these nucleases, named NucA and NucB. Functional studies with purified proteins revealed that NucA and NucB are non-specific endonucleases and that NucA is membrane-associated and cation-dependent. Single ΔnucA and ΔnucB mutants and the ΔnucA/B double mutant all had reduced virulence on wilt-susceptible tomato plants in a naturalistic soil-soak inoculation assay. The ΔnucA/B mutant was out-competed by the wild-type strain in planta and was less able to stunt root growth or colonize plant stems. Further, the double nuclease mutant could not escape from root border cells in vitro and was defective in attachment to pea roots. Taken together, these results demonstrate that extracellular DNases are novel virulence factors that help R. solanacearum successfully overcome plant defenses to infect plant roots and cause bacterial wilt disease.

  13. Ralstonia solanacearum uses inorganic nitrogen metabolism for virulence, ATP production, and detoxification in the oxygen-limited host xylem environment.

    Science.gov (United States)

    Dalsing, Beth L; Truchon, Alicia N; Gonzalez-Orta, Enid T; Milling, Annett S; Allen, Caitilyn

    2015-03-17

    Genomic data predict that, in addition to oxygen, the bacterial plant pathogen Ralstonia solanacearum can use nitrate (NO3(-)), nitrite (NO2(-)), nitric oxide (NO), and nitrous oxide (N2O) as terminal electron acceptors (TEAs). Genes encoding inorganic nitrogen reduction were highly expressed during tomato bacterial wilt disease, when the pathogen grows in xylem vessels. Direct measurements found that tomato xylem fluid was low in oxygen, especially in plants infected by R. solanacearum. Xylem fluid contained ~25 mM NO3(-), corresponding to R. solanacearum's optimal NO3(-) concentration for anaerobic growth in vitro. We tested the hypothesis that R. solanacearum uses inorganic nitrogen species to respire and grow during pathogenesis by making deletion mutants that each lacked a step in nitrate respiration (ΔnarG), denitrification (ΔaniA, ΔnorB, and ΔnosZ), or NO detoxification (ΔhmpX). The ΔnarG, ΔaniA, and ΔnorB mutants grew poorly on NO3(-) compared to the wild type, and they had reduced adenylate energy charge levels under anaerobiosis. While NarG-dependent NO3(-) respiration directly enhanced growth, AniA-dependent NO2(-) reduction did not. NO2(-) and NO inhibited growth in culture, and their removal depended on denitrification and NO detoxification. Thus, NO3(-) acts as a TEA, but the resulting NO2(-) and NO likely do not. None of the mutants grew as well as the wild type in planta, and strains lacking AniA (NO2(-) reductase) or HmpX (NO detoxification) had reduced virulence on tomato. Thus, R. solanacearum exploits host NO3(-) to respire, grow, and cause disease. Degradation of NO2(-) and NO is also important for successful infection and depends on denitrification and NO detoxification systems. The plant-pathogenic bacterium Ralstonia solanacearum causes bacterial wilt, one of the world's most destructive crop diseases. This pathogen's explosive growth in plant vascular xylem is poorly understood. We used biochemical and genetic approaches to show

  14. [Genetic variability of the bacterium Ralstonia solanacearum (Burkholderiales: Burholderiaceae) in the banana-growing region of Uraba (Colombia)].

    Science.gov (United States)

    Cardozo, Carolina; Rodríguez, Paola; Cotes, José Miguel; Marín, Mauricio

    2010-03-01

    The banana moko disease, caused by the bacterium Ralstonia solanacearum, is one of the most important phytopathological problems of the banana agribusiness in tropical countries. In Uraba and Magdalena (Colombia), the main exporting regions of banana in Colombia, this disease causes a destruction estimated in 16.5 ha/year. The bacterium presents an extremely high level of genetic variation that affects control measures. This is the first study of its variation in Colombia and was done with AFLP molecular markers on a population of 100 isolates from banana plants, soils and "weeds". The high level of genetic diversity, with Nei and Shannon indexes of h=0.32 and I=0.48, respectively, and the AMOVA, showed that this population is subestructured (Fst=0.66): the host is the main factor of differentiation. Even so, previous tests show that all varieties have pathogenicity on Musa.

  15. Aplicación de la técnica de PCR en la detección de Ralstonia solanacearum en campos paperos

    Directory of Open Access Journals (Sweden)

    Analía Sanabria

    2013-01-01

    Full Text Available La murchera de la papa causada por Ralstonia solanacearum es una amenaza permanente para el cultivo con consecuencias devastadoras en condiciones predisponentes. La incidencia de esta enfermedad en Uruguay es variable; desde la década de 1970 se registran brotes agudos periódicos difíciles de prevenir y controlar. Se ha detectado a R. solanacearumen todas las regiones de producción, lo que dificulta el mantenimiento de áreas libres de patógeno y la continuidad del cultivo. Dado que no existen agentes químicos efectivos, las estrategias de control apuntan a la prevención, recomendando la rotación de cultivos, la desinfección de herramientas y el uso de semilla certificada libre del patógeno. En este trabajo se optimizó la detección molecular de R. solanacearum en suelo mediante PCR con el objetivo de conocer la persistencia del patógeno en el campo. El método se aplicó al análisis de tres campos con diferentes antecedentes de murchera, y se demostró que el patógeno es capaz de permanecer viable por más de 10 años. También se determinaron las ventajas y limitaciones de esta metodología en su aplicación a muestras complejas. Estos resultados constituyen un importante aporte que genera conocimiento que permitirá a los productores delinear mejores estrategias para el manejo de la enfermedad al momento de planificar los cultivos.

  16. Ralstonia solanacearum – a New Threat to Potato Production in Serbia

    Directory of Open Access Journals (Sweden)

    Svetlana Milijašević-Marčić

    2013-12-01

    Full Text Available A survey of ware potatoes (a total of 1127 samples from localities in Serbia during two consecutive years resulted in detection and identification of R. solanacearum in 17 tuber samples. The monitoring detected the causal agent of bacterial wilt and brown rot of potato in three districts of Vojvodina province. In 2011, the infection by R. solanacearum was confirmed in 7 samples of ware potato tubers (varieties – Saturna, Pirol, Hermes, Panda in West Bačka and South Bačka Districts. In 2012, the infection by R. solanacearum was confirmed in 10 potato tuber samples (Lady Claire, Desiree, Panda, Red Fantasy and Vineta varieties from two districts: South Bačka and Central Banat. Bacterial strains obtained from positive samples were identified as R. solanacearum biovar 2 using PCR/RFLP analysis, pathogenicity test on tomato transplants, and nutritional, enzymatic and biovar determination tests. To our best knowledge, these are the only findings of R. solanacearum infection in ware potatoes in Serbia. R. solanacearum was not detected in tomato or any other host plant tested in this study. Furthermore, the bacterium was not found in any of the water samples tested, including those originating from areas in which the bacterium was found in ware potato samples.

  17. The in planta transcriptome of Ralstonia solanacearum: conserved physiological and virulence strategies during bacterial wilt of tomato.

    Science.gov (United States)

    Jacobs, Jonathan M; Babujee, Lavanya; Meng, Fanhong; Milling, Annett; Allen, Caitilyn

    2012-01-01

    Plant xylem fluid is considered a nutrient-poor environment, but the bacterial wilt pathogen Ralstonia solanacearum is well adapted to it, growing to 10(8) to 10(9) CFU/g tomato stem. To better understand how R. solanacearum succeeds in this habitat, we analyzed the transcriptomes of two phylogenetically distinct R. solanacearum strains that both wilt tomato, strains UW551 (phylotype II) and GMI1000 (phylotype I). We profiled bacterial gene expression at ~6 × 10(8) CFU/ml in culture or in plant xylem during early tomato bacterial wilt pathogenesis. Despite phylogenetic differences, these two strains expressed their 3,477 common orthologous genes in generally similar patterns, with about 12% of their transcriptomes significantly altered in planta versus in rich medium. Several primary metabolic pathways were highly expressed during pathogenesis. These pathways included sucrose uptake and catabolism, and components of these pathways were encoded by genes in the scrABY cluster. A UW551 scrA mutant was significantly reduced in virulence on resistant and susceptible tomato as well as on potato and the epidemiologically important weed host Solanum dulcamara. Functional scrA contributed to pathogen competitive fitness during colonization of tomato xylem, which contained ~300 µM sucrose. scrA expression was induced by sucrose, but to a much greater degree by growth in planta. Unexpectedly, 45% of the genes directly regulated by HrpB, the transcriptional activator of the type 3 secretion system (T3SS), were upregulated in planta at high cell densities. This result modifies a regulatory model based on bacterial behavior in culture, where this key virulence factor is repressed at high cell densities. The active transcription of these genes in wilting plants suggests that T3SS has a biological role throughout the disease cycle. IMPORTANCE Ralstonia solanacearum is a widespread plant pathogen that causes bacterial wilt disease. It inflicts serious crop losses on tropical

  18. The effector AWR5 from the plant pathogen Ralstonia solanacearum is an inhibitor of the TOR signalling pathway.

    Science.gov (United States)

    Popa, Crina; Li, Liang; Gil, Sergio; Tatjer, Laura; Hashii, Keisuke; Tabuchi, Mitsuaki; Coll, Núria S; Ariño, Joaquín; Valls, Marc

    2016-06-03

    Bacterial pathogens possess complex type III effector (T3E) repertoires that are translocated inside the host cells to cause disease. However, only a minor proportion of these effectors have been assigned a function. Here, we show that the T3E AWR5 from the phytopathogen Ralstonia solanacearum is an inhibitor of TOR, a central regulator in eukaryotes that controls the switch between cell growth and stress responses in response to nutrient availability. Heterologous expression of AWR5 in yeast caused growth inhibition and autophagy induction coupled to massive transcriptomic changes, unmistakably reminiscent of TOR inhibition by rapamycin or nitrogen starvation. Detailed genetic analysis of these phenotypes in yeast, including suppression of AWR5-induced toxicity by mutation of CDC55 and TPD3, encoding regulatory subunits of the PP2A phosphatase, indicated that AWR5 might exert its function by directly or indirectly inhibiting the TOR pathway upstream PP2A. We present evidence in planta that this T3E caused a decrease in TOR-regulated plant nitrate reductase activity and also that normal levels of TOR and the Cdc55 homologues in plants are required for R. solanacearum virulence. Our results suggest that the TOR pathway is a bona fide T3E target and further prove that yeast is a useful platform for T3E function characterisation.

  19. TALE-Like Effectors Are an Ancestral Feature of the Ralstonia solanacearum Species Complex and Converge in DNA Targeting Specificity.

    Science.gov (United States)

    Schandry, Niklas; de Lange, Orlando; Prior, Philippe; Lahaye, Thomas

    2016-01-01

    Ralstonia solanacearum, a species complex of bacterial plant pathogens divided into four monophyletic phylotypes, causes plant diseases in tropical climates around the world. Some strains exhibit a broad host range on solanaceous hosts, while others are highly host-specific as for example some banana-pathogenic strains. Previous studies showed that transcription activator-like (TAL) effectors from Ralstonia, termed RipTALs, are capable of activating reporter genes in planta, if these are preceded by a matching effector binding element (EBE). RipTALs target DNA via their central repeat domain (CRD), where one repeat pairs with one DNA-base of the given EBE. The repeat variable diresidue dictates base repeat specificity in a predictable fashion, known as the TALE code. In this work, we analyze RipTALs across all phylotypes of the Ralstonia solanacearum species complex. We find that RipTALs are prevalent in phylotypes I and IV but absent from most phylotype III and II strains (10/12, 8/14, 1/24, and 1/5 strains contained a RipTAL, respectively). RipTALs originating from strains of the same phylotype show high levels of sequence similarity (>98%) in the N-terminal and C-terminal regions, while RipTALs isolated from different phylotypes show 47-91% sequence similarity in those regions, giving rise to four RipTAL classes. We show that, despite sequence divergence, the base preference for guanine, mediated by the N-terminal region, is conserved across RipTALs of all classes. Using the number and order of repeats found in the CRD, we functionally sub-classify RipTALs, introduce a new simple nomenclature, and predict matching EBEs for all seven distinct RipTALs identified. We experimentally study RipTAL EBEs and uncover that some RipTALs are able to target the EBEs of other RipTALs, referred to as cross-reactivity. In particular, RipTALs from strains with a broad host range on solanaceous hosts cross-react on each other's EBEs. Investigation of sequence divergence between

  20. Endophytic Bacteria Suppress Bacterial Wilt of Tomato Caused by Ralstonia solanacearum and Activate Defense-related Metabolites

    Directory of Open Access Journals (Sweden)

    Fahime Safdarpour

    2017-12-01

    Full Text Available Introduction: Phytopathogenic microorganisms affect plant health and burden a major threat to food production and ecosystem stability. Increasing the use of chemical pesticides for plant diseases control causes several negative effects on human and environment health. Furthermore, increasing public awareness about the side effects of them led to a research to find alternatives for these products. One of the alternative methods is bio-control utilizing plant associated antagonistic microorganisms. Materials and methods: In this study, 80 endophytic bacteria were isolated from tomato tissues. Their antagonistic activity screened based on agar diffusion test, against tomato bacterial wilt disease (Ralstonia solanacearum. They were identified based on the morphological, biochemical properties and 16s rRNA sequence analyses. These strains were evaluated in greenhouse and tested for their ability to induce the production of defense-related enzymes in plants e.g. Peroxidase (PO, polyphenoloxidase (PPO and phenolics based on spectrophotometer method. Results: Results showed FS67, FS167 and FS184 strains had maximum inhibition zone forming. They identified as Pseudomonas mossellii, P. fuorescence and P. brassicacearum respectively. FS67 and FS167 strains significantly reduced disease in greenhouse. There was a significant increase in the activity of PO, PPO and phenolics in tomato plants treated with FS67, FS167 and pathogen. Discussion and conclusion: The present study has shown that P. mosselli and P. fuorescence might have the potential to control R. solanacearum. However, the good results obtained in vitro cannot be gained the same as those in greenhouse or field conditions. So, further experiments are needed to determine the effectiveness of these isolates under field conditions.This work support the view that increased defense enzymes activities could be involved, at least in part, in the beneficial effects of endophytic bacteria on plants growth

  1. Evaluation of the Antibacterial Effects and Mechanism of Action of Protocatechualdehyde against Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Shili Li

    2016-06-01

    Full Text Available Protocatechualdehyde (PCA is an important plant-derived natural product that has been associated with a wide variety of biological activities and has been widely used in medicine as an antioxidant, anti-aging and an anti-inflammatory agent. However, fewer reports concerning its antibacterial effects on plant-pathogenic bacteria exist. Therefore, in this study, protocatechualdehyde was evaluated for its antibacterial activity against plant pathogens along with the mechanism of its antibacterial action. PCA at 40 μg/mL was highly active against R. solanacearum and significantly inhibited its growth. The minimum bactericidal concentration and minimum inhibitory concentration values for PCA were 40 μg/mL and 20 μg/mL, respectively. Further investigation of the mechanism of action of PCA via transmission electron microscopy and biological assays indicated that the destruction of the cell structure, the shapes and the inhibition of biofilm formation were important. In addition, the application of PCA effectively reduced the incidence of bacterial wilt on tobacco under greenhouse conditions, and the control efficiency was as high as 92.01% at nine days after inoculation. Taken together, these findings suggest that PCA exhibits strong antibacterial activity against R. solanacearum and has the potential to be applied as an effective antibacterial agent for controlling bacterial wilt caused by R. solanacearum.

  2. Monitoring growth and movement of Ralstonia solanacearum cells harboring plasmid pRSS12 derived from bacteriophage phiRSS1.

    Science.gov (United States)

    Fujie, Makoto; Takamoto, Hirofumi; Kawasaki, Takeru; Fujiwara, Akiko; Yamada, Takashi

    2010-02-01

    We monitored growth and movement of Ralstonia solanacearum harboring the plasmid pRSS12 in tomato seedlings. The plasmid contains a gene for green fluorescent protein (GFP) and is stably maintained in R. solanacearum cells without selection pressure. Bacteria harboring the plasmid can be tracked in planta by visualizing GFP fluorescence. Stems of seedlings were infected with R. solanacearum cells transformed with pRSS12, and bacterial growth and movement, particularly around the vascular bundles, were monitored for more than 7 days. Our results showed that vascular bundles are independent of each other within the stem, and that it takes a long time for R. solanacearum cells to migrate from one vascular bundle to another. For real-time monitoring of bacteria in planta, tomato seedlings were grown on agar medium and bacterial suspension was applied to the root apex. The bacterial invasion process was monitored by fluorescent microscopy. Bacteria invaded taproots within 6 h, and movement of the bacteria was observed until 144 h after inoculation. In susceptible tomato cultivars, strong GFP fluorescence was observed in hypocotyls and lateral roots as well as the taproot. In resistant cultivars, however, GFP fluorescence was rarely observed on lateral roots. Our results show that this monitoring system can be used to assess bacterial pathogenicity efficiently. Copyright (c) 2009 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  3. Isolation of Ralstonia solanacearum-infecting bacteriophages from tomato fields in Chiang Mai, Thailand, and their experimental use as biocontrol agents.

    Science.gov (United States)

    Bhunchoth, A; Phironrit, N; Leksomboon, C; Chatchawankanphanich, O; Kotera, S; Narulita, E; Kawasaki, T; Fujie, M; Yamada, T

    2015-04-01

    To isolate and characterize novel bacteriophages infecting the phytopathogen, Ralstonia solanacearum, and to evaluate them as resources with potential uses in the biocontrol of bacterial wilt. Fourteen phages infecting R. solanacearum were isolated from soil samples collected in Chiang Mai, Thailand. The phages showed different host ranges when tested against 59 R. solanacearum strains isolated from Thailand and Japan. These phages were characterized as nine podoviruses and five myoviruses based on their morphology. Podovirus J2 in combination with another podovirus (φRSB2) lysed host cells very efficiently in contaminated soil. J2 treatment prevented wilting of tomato plants infected with a highly virulent R. solanacearum strain. Treatment with J2 effectively reduced the amount of the bacterial wilt pathogen in contaminated soil and prevented bacterial wilt of tomato in pot experiments. Myovirus J6 possessed jumbo phage features, giving a unique opportunity to study its utilization as a biocontrol agent. As exemplified by J2, the phages isolated in this study represent valuable resources with potential uses in biocontrol of bacterial wilt. A rare jumbo phage J6 served as a valuable subject to understand and utilize this new group of phages. © 2015 The Society for Applied Microbiology.

  4. Constraints on genome dynamics revealed from gene distribution among the Ralstonia solanacearum species.

    Directory of Open Access Journals (Sweden)

    Pierre Lefeuvre

    Full Text Available Because it is suspected that gene content may partly explain host adaptation and ecology of pathogenic bacteria, it is important to study factors affecting genome composition and its evolution. While recent genomic advances have revealed extremely large pan-genomes for some bacterial species, it remains difficult to predict to what extent gene pool is accessible within or transferable between populations. As genomes bear imprints of the history of the organisms, gene distribution pattern analyses should provide insights into the forces and factors at play in the shaping and maintaining of bacterial genomes. In this study, we revisited the data obtained from a previous CGH microarrays analysis in order to assess the genomic plasticity of the R. solanacearum species complex. Gene distribution analyses demonstrated the remarkably dispersed genome of R. solanacearum with more than half of the genes being accessory. From the reconstruction of the ancestral genomes compositions, we were able to infer the number of gene gain and loss events along the phylogeny. Analyses of gene movement patterns reveal that factors associated with gene function, genomic localization and ecology delineate gene flow patterns. While the chromosome displayed lower rates of movement, the megaplasmid was clearly associated with hot-spots of gene gain and loss. Gene function was also confirmed to be an essential factor in gene gain and loss dynamics with significant differences in movement patterns between different COG categories. Finally, analyses of gene distribution highlighted possible highways of horizontal gene transfer. Due to sampling and design bias, we can only speculate on factors at play in this gene movement dynamic. Further studies examining precise conditions that favor gene transfer would provide invaluable insights in the fate of bacteria, species delineation and the emergence of successful pathogens.

  5. A Conserved EAR Motif Is Required for Avirulence and Stability of the Ralstonia solanacearum Effector PopP2 In Planta

    Directory of Open Access Journals (Sweden)

    Cécile Segonzac

    2017-08-01

    Full Text Available Ralstonia solanacearum is the causal agent of the devastating bacterial wilt disease in many high value Solanaceae crops. R. solanacearum secretes around 70 effectors into host cells in order to promote infection. Plants have, however, evolved specialized immune receptors that recognize corresponding effectors and confer qualitative disease resistance. In the model species Arabidopsis thaliana, the paired immune receptors RRS1 (resistance to Ralstonia solanacearum 1 and RPS4 (resistance to Pseudomonas syringae 4 cooperatively recognize the R. solanacearum effector PopP2 in the nuclei of infected cells. PopP2 is an acetyltransferase that binds to and acetylates the RRS1 WRKY DNA-binding domain resulting in reduced RRS1-DNA association thereby activating plant immunity. Here, we surveyed the naturally occurring variation in PopP2 sequence among the R. solanacearum strains isolated from diseased tomato and pepper fields across the Republic of Korea. Our analysis revealed high conservation of popP2 sequence with only three polymorphic alleles present amongst 17 strains. Only one variation (a premature stop codon caused the loss of RPS4/RRS1-dependent recognition in Arabidopsis. We also found that PopP2 harbors a putative eukaryotic transcriptional repressor motif (ethylene-responsive element binding factor-associated amphiphilic repression or EAR, which is known to be involved in the recruitment of transcriptional co-repressors. Remarkably, mutation of the EAR motif disabled PopP2 avirulence function as measured by the development of hypersensitive response, electrolyte leakage, defense marker gene expression and bacterial growth in Arabidopsis. This lack of recognition was partially but significantly reverted by the C-terminal addition of a synthetic EAR motif. We show that the EAR motif-dependent gain of avirulence correlated with the stability of the PopP2 protein. Furthermore, we demonstrated the requirement of the PopP2 EAR motif for PTI

  6. Ferulic Acid, But Not All Hydroxycinnamic Acids, Is a Novel T3SS Inducer of Ralstonia solanacearum and Promotes Its Infection Process in Host Plants under Hydroponic Condition

    Directory of Open Access Journals (Sweden)

    Yong Zhang

    2017-09-01

    Full Text Available Hydroxycinnamic acids (HCAs are typical monocyclic phenylpropanoids, including cinnamic acid (Cin, coumaric acid (Cou, caffeic acid (Caf, ferulic acid (FA and their isomers, and involved in the interactions between pathogens and host plants. Here, we focused on the impact of HCAs on expression of type III secretion system (T3SS in Ralstonia solanacearum. FA significantly induced the expression of the T3SS and some type III effectors (T3Es genes in hrp-inducing medium, while did not the other HCAs. However, exogenously supplemented FA did not affect the T3SS expression in planta and the elicitation of the hypersensitive response (HR in tobacco leaves. Consistent with its central roles in pathogenicity, the FA-induced expression of the T3SS led to significant promotion on infection process of R. solanacearum in tomato plants under hydroponics cultivation. Moreover, the FA-induced expression of the T3SS was specifically mediated by the well-characterized signaling cascade PrhA-prhI/R-PrhJ-HrpG-HrpB, independent of the other known regulatory pathways. In summary, our results demonstrated that FA, a novel inducer of the T3SS in R. solanacearum, was able to promote its infection process in host plants under hydroponics condition.

  7. Ethylene emission and PR protein synthesis in ACC deaminase producing Methylobacterium spp. inoculated tomato plants (Lycopersicon esculentum Mill.) challenged with Ralstonia solanacearum under greenhouse conditions.

    Science.gov (United States)

    Yim, Woojong; Seshadri, Sundaram; Kim, Kiyoon; Lee, Gillseung; Sa, Tongmin

    2013-06-01

    Bacteria of genus Methylobacterium have been found to promote plant growth and regulate the level of ethylene in crop plants. This work is aimed to test the induction of defense responses in tomato against bacterial wilt by stress ethylene level reduction mediated by the ACC deaminase activity of Methylobacterium strains. Under greenhouse conditions, the disease index value in Methylobacterium sp. inoculated tomato plants was lower than control plants. Plants treated with Methylobacterium sp. challenge inoculated with Ralstonia solanacearum (RS) showed significantly reduced disease symptoms and lowered ethylene emission under greenhouse condition. The ACC and ACO (1-aminocyclopropane-1-carboxylate oxidase) accumulation in tomato leaves were significantly reduced with Methylobacterium strains inoculation. While ACC oxidase gene expression was found higher in plants treated with R. solanacearum than Methylobacterium sp. treatment, PR proteins related to induced systemic resistance like β-1,3-glucanase, PAL, PO and PPO were increased in Methylobacterium sp. inoculated plants. A significant increase in β-1,3-glucanase and PAL gene expression was found in all the Methylobacterium spp. treatments compared to the R. solanacearum treatment. This study confirms the activity of Methylobacterium sp. in increasing the defense enzymes by modulating the ethylene biosynthesis pathway and suggests the use of methylotrophic bacteria as potential biocontrol agents in tomato cultivation. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  8. Overexpression of NtPR-Q Up-Regulates Multiple Defense-Related Genes in Nicotiana tabacum and Enhances Plant Resistance to Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Yuanman Tang

    2017-11-01

    Full Text Available Various classes of plant pathogenesis-related proteins have been identified in the past several decades. PR-Q, a member of the PR3 family encoding chitinases, has played an important role in regulating plant resistance and preventing pathogen infection. In this paper, we functionally characterized NtPR-Q in tobacco plants and found that the overexpression of NtPR-Q in tobacco Yunyan87 resulted in higher resistance to Ralstonia solanacearum inoculation. Surprisingly, overexpression of NtPR-Q led to the activation of many defense-related genes, such as salicylic acid (SA-responsive genes NtPR1a/c, NtPR2 and NtCHN50, JA-responsive gene NtPR1b and ET production-associated genes NtACC Oxidase and NtEFE26. Consistent with the role of NtPR-Q in multiple stress responses, NtPR-Q transcripts were induced by the exogenous hormones SA, ethylene and methyl jasmonate, which could enhance the resistance of tobacco to R. solanacearum. Collectively, our results suggested that NtPR-Q overexpression led to the up-regulation of defense-related genes and enhanced plant resistance to R. solanacearum infection.

  9. Complete factorial design to adjust pH and sugar concentrations in the inoculum phase of Ralstonia solanacearum to optimize P(3HB production.

    Directory of Open Access Journals (Sweden)

    Karine Laste Macagnan

    Full Text Available Poly(3-hydroxybutyrate (P(3HB is a biodegradable plastic biopolymer that accumulates as lipophilic inclusions in the cytoplasm of some microorganisms. The biotechnological process by which P(3HB is synthesized occurs in two phases. The first phase involves cell growth in a complex culture medium, while the second phase involves polymer accumulation in the presence of excess carbon sources. As such, the efficiency of the second phase depends on the first phase. The aim of this study was to evaluate culture media with different concentrations of sucrose and glucose and different pH values in the inoculum phase of Ralstonia solanacearum RS with the intention of identifying methods by which the biomass yield could be increased, subsequently enhancing the yield of P(3HB. The culture medium was formulated according to the experimental planning type of central composite rotational design 22. The independent variables were pH and sugar concentration (sucrose and glucose, and the dependent variables were OD600nm, dry cell weight (DCW, and P(3HB yield. The highest cell growth, estimated by the OD600nm (20.6 and DCW (5.35 values, was obtained when sucrose was used in the culture medium at a concentration above 35 g.L-1 in combination with an acidic pH. High polymer (45% accumulation was also achieved under these conditions. Using glucose, the best results for OD600nm (12.5 and DCW (2.74 were also obtained at acidic pH but with a sugar concentration at the minimum values evaluated. Due to the significant accumulation of polymer in the cells that were still in the growth phase, the accumulating microorganism P(3HB Ralstonia solanacearum RS can be classified as having type II metabolism in relation to the polymer accumulation phase, which is different from other Ralstonia spp. studied until this time.

  10. Application of Variable-Number Tandem-Repeat Typing To Discriminate Ralstonia solanacearum Strains Associated with English Watercourses and Disease Outbreaks

    Science.gov (United States)

    Bryant, Ruth; Bew, Janice; Conyers, Christine; Stones, Robert; Alcock, Michael; Elphinstone, John

    2013-01-01

    Variable-number tandem-repeat (VNTR) analysis was used for high-resolution discrimination among Ralstonia solanacearum phylotype IIB sequevar 1 (PIIB-1) isolates and further evaluated for use in source tracing. Five tandem-repeat-containing loci (comprising six tandem repeats) discriminated 17 different VNTR profiles among 75 isolates from potato, geranium, bittersweet (Solanum dulcamara), tomato, and the environment. R. solanacearum isolates from crops at three unrelated outbreak sites where river water had been used for irrigation had distinct VNTR profiles that were shared with PIIB-1 isolates from infected bittersweet growing upriver of each site. The VNTR profiling results supported the implication that the source of R. solanacearum at each outbreak was contaminated river water. Analysis of 51 isolates from bittersweet growing in river water at different locations provided a means to evaluate the technique for studying the epidemiology of the pathogen in the environment. Ten different VNTR profiles were identified among bittersweet PIIB-1 isolates from the River Thames. Repeated findings of contiguous river stretches that produced isolates that shared single VNTR profiles supported the hypothesis that the pathogen had disseminated from infected bittersweet plants located upriver. VNTR profiles shared between bittersweet isolates from two widely separated Thames tributaries (River Ray and River Colne) suggested they were independently contaminated with the same clonal type. Some bittersweet isolates had VNTR profiles that were shared with potato isolates collected outside the United Kingdom. It was concluded that VNTR profiling could contribute to further understanding of R. solanacearum epidemiology and assist in control of future disease outbreaks. PMID:23892739

  11. Prophage Rs551 and Its Repressor Gene orf14 Reduce Virulence and Increase Competitive Fitness of Its Ralstonia solanacearum Carrier Strain UW551.

    Science.gov (United States)

    Ahmad, Abdelmonim Ali; Stulberg, Michael J; Huang, Qi

    2017-01-01

    We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum , indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant), and nine of the prophage's 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant), respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes ( pilT, egl, pehC, hrPB, and phcA ), and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a lysogenic phage and

  12. Prophage Rs551 and Its Repressor Gene orf14 Reduce Virulence and Increase Competitive Fitness of Its Ralstonia solanacearum Carrier Strain UW551

    Directory of Open Access Journals (Sweden)

    Abdelmonim Ali Ahmad

    2017-12-01

    Full Text Available We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum, indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant, and nine of the prophage’s 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant, respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes (pilT, egl, pehC, hrPB, and phcA, and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a

  13. Prophage Rs551 and Its Repressor Gene orf14 Reduce Virulence and Increase Competitive Fitness of Its Ralstonia solanacearum Carrier Strain UW551

    Science.gov (United States)

    Ahmad, Abdelmonim Ali; Stulberg, Michael J.; Huang, Qi

    2017-01-01

    We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum, indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant), and nine of the prophage’s 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant), respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes (pilT, egl, pehC, hrPB, and phcA), and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a lysogenic phage and

  14. The Effect of Fluorescent Pseudomonads Application on the Resistance of Chili Plants Against the Attack of Ralstonia Solanacearum and Fusarium Oxysporum in the Field

    Directory of Open Access Journals (Sweden)

    Wuryandari Yenny

    2016-01-01

    Full Text Available Chili (Capsicum annuum L. is one of the vegetable commodities with high economic value. Until now, the necessity rate of chili is still high but the production is still low. One of the obstacles, which highly influence chili production, is wilt disease due to Ralstonia solanacearum and Fusarium oxysporum. This study aims at identifying the best fluorescent pseudomonads isolate in suppressing the development of the primary wilt disease due to Ralstonia solanacearum and F. oxysprorum in the field. This study employs Completely Randomized Design that comprises 3 treatments. The three treatments are the type of fluorescent pseudomonads which is Pf-122 isolate, Pf-160 isolate, and Pf-B isolate. The observation parameter on suppressing the disease development is perceived from incubation period of the initial appearance of symptoms, disease index and the change of stem tissue color. The result of the study shows that the longest incubation period is treatment with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate. The chili is treated with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate, the initial appearance of symptoms at the 8th day after inoculation. In the treatment with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate compared to control, is able to delay the appearance of symptom for 3 days. The disease development starts from 10th to 30th day, the treatment with Pf-122 isolate shows the slowest development compared to other treatment and control. In the last observation, the disease index with treatment of Pf-122 isolate is the lowest which is 37%, then it is followed by Pf-B and Pf-160 which are 39% and 40% respectively, whereas in the control it reaches 67%. For the color change on stem tissue, there is no real difference of the three treatments of fluorescent pseudomonads application but it differs and smaller from the control.

  15. Effect of calcium cyanamide, ammonium bicarbonate and lime mixture, and ammonia water on survival of Ralstonia solanacearum and microbial community

    Science.gov (United States)

    Liu, Lijuan; Sun, Chengliang; Liu, Xingxing; He, Xiaolin; Liu, Miao; Wu, Hao; Tang, Caixian; Jin, Chongwei; Zhang, Yongsong

    2016-01-01

    The inorganic nitrogenous amendments calcium cyanamide (CC), ammonia water (AW), and a mixture of ammonium bicarbonate with lime (A+L) are popularly used as fumigants to control soil-borne disease in China. However, it is unclear which of these fumigants is more effective in controlling R. solanacearum. This present study compared the efficiencies of the three nitrogenous amendments listed above at four nitrogen levels in suppressing the survival of R. solanacearum in soil. The CC showed the best ability to suppress R. solanacearum due to its highest capacity to increase soil and NO2− contents and pH. However, AW was more suitable to controlling bacterial wilt caused by R. solanacearum because it had a lower cost and its application rate of 0.25 g N kg−1 soil could effectively suppress the survival of R. solanacearum. Additionally, soil microbial activity and community populations were restored to their initial state four weeks after the application of each fumigant, indicating that the three fumigants had few detrimental impacts on soil microbial activity and community structure with an exception of the suppression of R. solanacearum. The present study provides guidance for the selection of a suitable alkaline nitrogenous amendment and its application rate in controlling bacterial wilt. PMID:26738601

  16. Effect of calcium cyanamide, ammonium bicarbonate and lime mixture, and ammonia water on survival of Ralstonia solanacearum and microbial community

    Science.gov (United States)

    Liu, Lijuan; Sun, Chengliang; Liu, Xingxing; He, Xiaolin; Liu, Miao; Wu, Hao; Tang, Caixian; Jin, Chongwei; Zhang, Yongsong

    2016-01-01

    The inorganic nitrogenous amendments calcium cyanamide (CC), ammonia water (AW), and a mixture of ammonium bicarbonate with lime (A+L) are popularly used as fumigants to control soil-borne disease in China. However, it is unclear which of these fumigants is more effective in controlling R. solanacearum. This present study compared the efficiencies of the three nitrogenous amendments listed above at four nitrogen levels in suppressing the survival of R. solanacearum in soil. The CC showed the best ability to suppress R. solanacearum due to its highest capacity to increase soil and NO2- contents and pH. However, AW was more suitable to controlling bacterial wilt caused by R. solanacearum because it had a lower cost and its application rate of 0.25 g N kg-1 soil could effectively suppress the survival of R. solanacearum. Additionally, soil microbial activity and community populations were restored to their initial state four weeks after the application of each fumigant, indicating that the three fumigants had few detrimental impacts on soil microbial activity and community structure with an exception of the suppression of R. solanacearum. The present study provides guidance for the selection of a suitable alkaline nitrogenous amendment and its application rate in controlling bacterial wilt.

  17. Genetic diversity of Ralstonia solanacearum strains from China assessed by PCR-based fingerprints to unravel host plant- and site-dependent distribution patterns.

    Science.gov (United States)

    Xue, Qing-Yun; Yin, Yan-Ni; Yang, Wei; Heuer, Holger; Prior, Philippe; Guo, Jian-Hua; Smalla, Kornelia

    2011-03-01

    Bacterial wilt caused by Ralstonia solanacearum is a serious threat to crop production in China. A collection of 319 R. solanacearum strains isolated from 14 different diseased host plants collected in 15 Chinese provinces was investigated by BOX fingerprints in order to test the influence of the site and the host plant on their genetic diversity. Phylotype, fliC-RFLP patterns and biovar were determined for all strains and the sequevar for 39 representative strains. The majority of strains belonged to the Asian phylotype I, shared identical fliC-RFLP patterns and were assigned to four biovars (bv3:123; bv4:162; bv5:3; and bv6:11). Twenty strains were phylotype II, assigned to biovar 2, and had distinct fliC-RFLP patterns. BOX-PCR fingerprints generated from the genomic DNA of each strain revealed a high diversity of the phylotype I strains, where 28 types of BOX fingerprints could be distinguished. While many BOX clusters comprised isolates from different provinces and several host plants, some groups contained isolates that were plant or site specific. All phylotype II isolates originating from 10 provinces belonged to sequevar 1 and displayed identical BOX patterns as the potato brown rot strains from various regions of the world. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  18. Overexpression of NtWRKY50 Increases Resistance to Ralstonia solanacearum and Alters Salicylic Acid and Jasmonic Acid Production in Tobacco.

    Science.gov (United States)

    Liu, Qiuping; Liu, Ying; Tang, Yuanman; Chen, Juanni; Ding, Wei

    2017-01-01

    WRKY transcription factors (TFs) modulate plant responses to biotic and abiotic stresses. Here, we characterized a WRKY IIc TF, NtWRKY50, isolated from tobacco ( Nicotiana tabacum ) plants. The results showed that NtWRKY50 is a nuclear-localized protein and that its gene transcript is induced in tobacco when inoculated with the pathogenic bacterium Ralstonia solanacearum . Overexpression of NtWRKY50 enhanced bacterial resistance, which correlated with enhanced SA and JA/ET signaling genes. However, silencing of the NtWRKY50 gene had no obvious effects on plant disease resistance, implying functional redundancy of NtWRKY50 with other TFs. In addition, it was found that NtWRKY50 can be induced by various biotic or abiotic stresses, such as Potato virus Y, Rhizoctonia solani, Phytophthora parasitica , hydrogen peroxide, heat, cold, and wounding as well as the hormones salicylic acid (SA), jasmonic acid (JA), and ethylene (ET). Importantly, additional analysis suggests that NtWRKY50 overexpression markedly promotes SA levels but prevents pathogen-induced JA production. These data indicate that NtWRKY50 overexpression leads to altered SA and JA content, increased expression of defense-related genes and enhanced plant resistance to R. solanacearum. These probably due to increased activity of endogenous NtWRKY50 gene or could be gain-of-function phenotypes by altering the profile of genes affected by NtWRKY50 .

  19. An evaluation of the wilt-causing bacterium Ralstonia solanacearum as a potential biological control agent for the alien Kahili ginger (Hedychium gardnerianum) in Hawaiian forests

    Science.gov (United States)

    1999-01-01

    Kahili ginger (Hedychium gardnerianum) is an invasive weed in tropical forests in Hawaii and elsewhere. Bacterial wilt caused by the ginger strain of Ralstonia(=Pseudomonas) solanacearum systemically infects edible ginger (Zingiber officinale) and ornamental gingers (Hedychium spp.), causing wilt in infected plants. The suitability of R. solanacearum as a biological control agent for kahili ginger was investigated by inoculating seedlings and rooted cuttings of native forest plants, ornamental ginger, and solanaceous species to confirm host specificity. Inoculation via stem injection or root wounding with a bacterial–water suspension was followed by observation for 8 weeks. Inoculations on H. gardnerianum were then carried out in ohia-lehua (Metrosideros polymorpha) wet forests of Hawaii Volcanoes National Park to determine the bacterium's efficacy in the field. No native forest or solanaceous species developed wilt or other symptoms during the study. The bacterium caused limited infection near the inoculation site on H. coronarium, Z. zerumbet, Heliconia latispatha, and Musa sapientum. However, infection did not become systemic in any of these species, and normal growth resumed following appearance of initial symptoms. All inoculated H. gardnerianum plants developed irreversible chlorosis and severe wilting 3–4 weeks following inoculation. Systemic infection also caused death and decay of rhizomes. Most plants were completely dead 16–20 weeks following inoculation. The destructiveness of the ginger strain of R. solanacearum to edible ginger has raised questions regarding its use for biological control. However, because locations of kahili ginger infestations are often remote, the risk of contaminating edible ginger plantings is unlikely. The ability of this bacterium to cause severe disease in H. gardnerianum in the field, together with its lack of virulence in other ginger species, contributes to its potential as a biological control agent.

  20. Host plant-dependent phenotypic reversion of Ralstonia solanacearum from non-pathogenic to pathogenic forms via alterations in the phcA gene.

    Science.gov (United States)

    Poussier, Stéphane; Thoquet, Philippe; Trigalet-Demery, Danièle; Barthet, Séverine; Meyer, Damien; Arlat, Matthieu; Trigalet, André

    2003-08-01

    Ralstonia solanacearum is a plant pathogenic bacterium that undergoes a spontaneous phenotypic conversion (PC) from a wild-type pathogenic to a non-pathogenic form. PC is often associated with mutations in phcA, which is a key virulence regulatory gene. Until now, reversion to the wild-type pathogenic form has not been observed for PC variants and the biological significance of PC has been questioned. In this study, we characterized various alterations in phcA (eight IS element insertions, three tandem duplications, seven deletions and a base substitution) in 19 PC mutants from the model strain GMI1000. In five of these variants, reversion to the pathogenic form was observed in planta, while no reversion was ever noticed in vitro whatever culture media used. However, reversion was observed for a 64 bp tandem duplication in vitro in the presence of tomato root exudate. This is the first report showing a complete cycle of phenotypic conversion/reversion in a plant pathogenic bacterium.

  1. CaWRKY22 Acts as a Positive Regulator in Pepper Response to Ralstonia Solanacearum by Constituting Networks with CaWRKY6, CaWRKY27, CaWRKY40, and CaWRKY58

    OpenAIRE

    Ansar Hussain; Xia Li; Yahong Weng; Zhiqin Liu; Muhammad Furqan Ashraf; Ali Noman; Sheng Yang; Muhammad Ifnan; Shanshan Qiu; Yingjie Yang; Deyi Guan; Shuilin He

    2018-01-01

    The WRKY web, which is comprised of a subset of WRKY transcription factors (TFs), plays a crucial role in the regulation of plant immunity, however, the mode of organization and operation of this network remains obscure, especially in non-model plants such as pepper (Capsicum annuum). Herein, CaWRKY22, a member of a subgroup of IIe WRKY proteins from pepper, was functionally characterized in pepper immunity against Ralstonia Solanacearum. CaWRKY22 was found to target the nuclei, and its trans...

  2. Bactérias extremófilas facultativas : efeito na promoção de crescimento de plantas de tomate e na supressão de Ralstonia solanacearum

    OpenAIRE

    Rezende, Adriana Magali de Freitas Alves

    2011-01-01

    O tomateiro comum (Solanum lycopersicum L.) é uma olerícola de grande importância econômica e social, se destacando no Brasil, pelas extensas áreas agrícolas cultivadas. O Brasil é o sexto maior produtor de tomate no mundo. No entanto, a murcha bacteriana, causada pela bactéria Ralstonia solanacearum (Smith) Yabuuchi está entre as doenças de maior importância e de difícil controle, não existindo ainda medidas adequadas que possam ser recomendadas. Com objetivo de determinar um controle biológ...

  3. Bactérias endofíticas como agentes promotores do crescimento de plantas de tomateiro e de inibição in vitro de Ralstonia solanacearum Endophytic bacteria as agents of plant growth promotion in tomato and inhibition in vitro of Ralstonia solanacearum

    Directory of Open Access Journals (Sweden)

    Patrícia Baston Barretti

    2008-06-01

    Full Text Available A partir de 150 isolados de bactérias endofíticas obtidos de folhas, caules e raízes de tomateiros sadios, 53 destacaram-se quanto à habilidade em promover o crescimento de plantas de tomateiro (Solanum lycopersicum L.. Submetidos a uma nova seleção, os isolados UFV-E17, UFV-E22, UFV-E25, UFV-E26, UFV-E27, Bacillus cereus (UFV-E29, UFV-E49, UFLA 06-LS, UFLA 08-LS e UFLA 11-LS apresentaram maior promoção do crescimento. Avaliações semanais de altura e número de folhas e folíolos das plantas aconteceram durante 45 dias. Após a sexta avaliação, mensurou-se a área foliar e o peso da matéria fresca e seca da parte aérea e da raiz das plantas. O isolado UFV-E49 apresentou melhor resultado para altura, área foliar, número de folhas e peso da matéria fresca e seca, tanto da parte aérea quanto da raiz. Dos isolados selecionados, somente dois apresentaram efeito inibitório direto in vitro a Ralstonia solanacearum.Out of one hundred and fifty isolates of endophytic bacteria from leaves, stems and roots of healthy tomatoes (Solanum lycopersicum L., fifty three showed ability to promote tomato plant growth, among these, ten isolates UFV-E17, UFV-E22, UFV-E25, UFV-E26, UFV-E27, Bacillus cereus (UFV-E29, UFV-E49, UFLA 06-LS, UFLA 08-LS and UFLA 11-LS, provided the largest plant growth promotion. Weekly assessment of plant height and number of leaves and leaflets were carried out during 45 days. After the sixth evaluation, the leaf area and the fresh and dry weight of the aerial part of plants and of the roots were measured. Isolate UFV-E49 provided the largest values of height, leaf area, number of leaves and fresh and dry weight of the aerial part of plants as well as the root. From the selected isolates, only two presented antimicrobial activity against Ralstonia solanacearum.

  4. PRODUCCIÓN DE POLI-β -HIDROXIBUTIRATO (PHB β POR Ralstonia eutropha ATCC 17697

    Directory of Open Access Journals (Sweden)

    Barbosa Marcela

    2005-06-01

    Full Text Available Ralstonia eutropha es la bacteria más utilizada en la producción de poli-β-hidroxibutirato (PHB por su capacidad de acumular polímero hasta en un 80% de su peso seco. En el presente trabajo se realizaron fermentaciones por lote alimentado en dos etapas a escala 3 litros usando tres concentraciones de fructosa (5, 10 y 15 g/l. En la primera etapa, manteniendo constante la relación carbono-nitrógeno en 6.85 g C/g N, se buscó obtener una alta concentración celular; en la segunda etapa las células obtenidas se limitaron en la fuente de nitrógeno para permitir la acumulación del biopolímero. La mejor concentración para producir el material es 5 g/l en la cual se obtuvo un porcentaje de acumulación del 66.2%, una velocidad de crecimiento específico inicial de 0.5171 h-1 y una productividad de 0.1245 g PHB/ l h.

  5. Pig slurry reduces the survival of Raltstonia solanacearum biovar 2 in soil

    NARCIS (Netherlands)

    Gorissen, A.; Overbeek, van L.S.; Elsas, van J.D.

    2004-01-01

    The effect of added pig slurry and solarization on the survival of Ralstonia solanacearum biovar 2 strain 1609 in soil was analysed in soil microcosms and field plots. In addition, the invasion of potato plants by R. solanacearum and the development of disease symptoms were determined, as measures

  6. Ecology, Epidemiology and Disease Management of Ralstonia syzygii in Indonesia.

    Science.gov (United States)

    Safni, Irda; Subandiyah, Siti; Fegan, Mark

    2018-01-01

    Ralstonia solanacearum species complex phylotype IV strains, which have been primarily isolated from Indonesia, Australia, Japan, Korea, and Malaysia, have undergone recent taxonomic and nomenclatural changes to be placed in the species Ralstonia syzygii . This species contains three subspecies; Ralstonia syzygii subsp. syzygii , a pathogen causing Sumatra disease of clove trees in Indonesia, Ralstonia syzygii subsp. indonesiensis , the causal pathogen of bacterial wilt disease on a wide range of host plants, and Ralstonia syzygii subsp. celebesensis , the causal pathogen of blood disease on Musa spp. In Indonesia, these three subspecies have devastated the cultivation of susceptible host plants which have high economic value. Limited knowledge on the ecology and epidemiology of the diseases has hindered the development of effective control strategies. In this review, we provide insights into the ecology, epidemiology and disease control of these three subspecies of Ralstonia syzygii .

  7. Diversité de Ralstonia Solanacearum au Cameroun et bases génétiques de la résistance chez le piment (Capsicum Annuum) et les Solanacées

    OpenAIRE

    Mahbou-Somo-Toukam , Gabriel

    2010-01-01

    The knowledge of genetic diversity of R. solanacearum as well as the knowledge of genetic determinism of pepper resistance are critical for elaborating a strategy against this ubiquist bacterium. They will facilitate the choice and direction of fighting methods and the development of well adapted tools for quarantine measures. In a modern approach of genetics more and more based on plant models, Solanaceaes occupy a place of pioneer. On another hand the emerging breakdown of resistances seems...

  8. root colonized by Glomus mosseae and Ralstonia solanacearum

    African Journals Online (AJOL)

    Yomi

    2012-03-27

    Mar 27, 2012 ... Ngakou et al., 2007), plant nutrition support (Mahmood and Rizvi, 2010), and salt stress (Shokri and Maadi,. 2009). Safir (1968) was the first to report the study on interaction of plant pathogenic fungi and species of AMF, followed by many reports confirming the reduction of disease severity as a result of ...

  9. Water relations of Pseudomonas solanacearum

    African Journals Online (AJOL)

    GREGORY

    2010-08-30

    Aug 30, 2010 ... pathogens of plants, especially, Erwinia chrysanthemi. (Mildenhall et al., 1988; Prior et al., 1994; Gouesbet et al., 1995; Gouesbet et al., 1996). This helps to determine how they survive in dry soil for long periods as saprophytes. Experiments undertaken here on P. solanacearum give a glimpse of what may ...

  10. Induction of in vitro mutation for resistance to potato brown rot (ralstonia solanacearum) disease

    International Nuclear Information System (INIS)

    Ragab, A. I.; Hassan, I. O. I.; Soliman, M. H.; Gamal El-din, A.

    2012-12-01

    Six genotypes were selected from M 1 V 2 generation on the bases on their high yield for assessment of genetic variability using protein and RAPD analysis. The results of RAPD analysis showed that 11 primers generated 56 distinct bands of which 31 (55.4%) were polymorphic. The similarity indices of the six mutants of potato and their parents ranged from 70 to 91%. The highest genetic similarity 91% was found between D 20 mutant and Do (Diamant parent), on the other hand, the lowest genetic similarity 705 was found between S 30, S 40 mutants and their parent S 0 (Spunta). In the artificial experiment under in vitro condition, the irradiated and non-irradiated plant lets of potato were cultured on medium inoculates of the selected genotypes form irradiated population of Diamant and Spunta Cultivar were susceptible except S 20 mutant which was resistant. Protein analysis showed that S 20 genotype (Resistant Mutant) displayed 2 negative unique bands that might be responsible for resistance to R. solanacea rum. (Author)

  11. Characterization and DNA-binding specificities of Ralstonia TAL-like effectors

    KAUST Repository

    Li, Lixin

    2013-07-01

    Transcription activator-like effectors (TALEs) from Xanthomonas sp. have been used as customizable DNA-binding modules for genome-engineering applications. Ralstonia solanacearum TALE-like proteins (RTLs) exhibit similar structural features to TALEs, including a central DNA-binding domain composed of 35 amino acid-long repeats. Here, we characterize the RTLs and show that they localize in the plant cell nucleus, mediate DNA binding, and might function as transcriptional activators. RTLs have a unique DNA-binding architecture and are enriched in repeat variable di-residues (RVDs), which determine repeat DNA-binding specificities. We determined the DNA-binding specificities for the RVD sequences ND, HN, NP, and NT. The RVD ND mediates highly specific interactions with C nucleotide, HN interacts specifically with A and G nucleotides, and NP binds to C, A, and G nucleotides. Moreover, we developed a highly efficient repeat assembly approach for engineering RTL effectors. Taken together, our data demonstrate that RTLs are unique DNA-targeting modules that are excellent alternatives to be tailored to bind to user-selected DNA sequences for targeted genomic and epigenomic modifications. These findings will facilitate research concerning RTL molecular biology and RTL roles in the pathogenicity of Ralstonia spp. © 2013 The Author.

  12. Isolasi dan Karakterisasi Ralstonia syzygii

    Directory of Open Access Journals (Sweden)

    Yanuar Danaatmadja

    2009-07-01

    Full Text Available Ralstonia syzygii is one of important pathogens of cloves. This study was aimed at obtaining pure culture of R. syzygi from diseased plant tissue samples. The acterium was isolated from infected clove plantations in Ungaran, Central Java. It had the ability to make clove seedlings show symptoms and then die 41 days after inoculation. The reisolated bacterium also showed its ability to kill clove seedlings after 17 days. The bacterium is gram negative, able to ultilize glucose, sucrose, maltose, mannitol, sorbitol, dulcitol, and glycerol, able to hydrolyze starch, grow well at 27oC, able to catalyze and release water and oxygen from hydrogen peroxyde (H2O2 and aerobically.   Ralstonia syzygii merupakan salah satu patogen penting pada tanaman cengkeh. Penelitian ini dilakukan untuk mendapakan isolat murni R syzygii dari jaringan tanaman terinfeksi. Bakteri diisolasi dari pertanaman cengkeh sakit yang berasal dari daerah Ungaran, Jawa Tengah. Bakteri menunjukkan kemampuan untuk menyebabkan bibit tanaman cangkeh sakit dan kemudian mati 41 hsi. Bakteri hasil reisolasi juga menunjukkan kemampuannya menyebabkan sakit dan kematian pada bibit tanaman cengkeh setelah 17 hsi. Bakteri yang diperoleh bersifat gram negatif, mampu memanfaatkan glukosa, sukrosa, maltosa, manitol, sorbitol, dulsitol, dan gliserol, mampu menghidrolisis pati, tumbuh baik pada suhu 27o C, mampu mengkatalisis dan melepaskan air dan oksigen dari hydrogen peroxide (H2O2 dan bersifat aerob.

  13. Pengaruh Pemberian Pupuk Hayati Dan Mikoriza Terhadap Intensitas Serangan Penyakit Layu Bakteri (Ralstonia Solanacearum), Pertumbuhan, Dan Hasil Tanaman Tomat

    OpenAIRE

    Aulia, Fatimatul; Susanti, Hilda; Fikri, Edwin Noor

    2016-01-01

    The research about the effect of applications biofertilizer and mycorhiza to intensity attack of bacterial wilt disease, growth, and yield of tomato was conducted in trial garden of Agriculture Faculty Lambung Mangkurat University from November 2015 until February 2016. The experiment was arranged in a completely randomized design with one factor, four treatments (no treatment (control), biofertilizer, mycorhiza, and biofertilizer + mycorhiza), and five replications. The results of experimen...

  14. Application of biochar reduces Ralstonia solanacearum infection via effects on pathogen chemotaxis, swarming motility, and root exudate adsorption

    NARCIS (Netherlands)

    Gu, Yian; Hou, Yugang; Huang, Dapeng; Hao, Zhexia; Wang, Xiaofang; Wei, Zhong; Jousset, Alexandre; Tan, Shiyong; Xu, Dabing; Shen, Qirong; Xu, Yangchun; Friman, Ville Petri

    Aims: We evaluated the efficacy of biochar application for suppressing bacterial wilt of tomato and identified the potential underlying mechanisms involved in the disease control. Methods: We measured the impact of two different sized biochar (53–120 μm and 380–830 μm) on bacterial wilt incidence in

  15. Detección de Ca Liberibacter solanacearum y fitoplasmas en cultivo de papa (Solanum tuberosum L. en el Valle de Toluca

    Directory of Open Access Journals (Sweden)

    Ana Tarin Gutiérrez-Ibáñez

    2013-01-01

    Full Text Available Título en ingles: Detection of Ca Liberibacter solanacearum and phytoplasma in potato crop (Solanum tuberosum L. in Toluca Valley Título corto: Detección de Ca Liberibacter solanacearum y fitoplasmas Resumen En México y Centro América se han detectado tubérculos de papa con manchado interno. Recientemente en Texas EUA a esta enfermedad se le ha denominado “Zebra Chip” (ZC o rayado de la papa, los síntomas foliares se asemejan al síndrome denominado “Punta Morada de la Papa” (PMP o enfermedad del “amarillamiento por psilidos” la cual es asociada con la presencia de “Candidatus Liberibacter solanacearum”. El objetivo de esta investigación fue detectar la presencia de esta bacteria y de fitoplasmas en plantas de papa que presentaban la coloración purpura de los foliolos. Durante el ciclo primavera – verano 2011 y 2012 se hizo un muestreo en los municipios de Tenango del Valle, Zinacantepec, Villa de Allende y San José del Rincón, del Estado de México. La detección de ambos patógenos se realizó mediante la reacción en cadena de la polimerasa (PCR con los iniciadores específicos para fitoplasmas: P1/P7, R16mF2/R16mR1 y para Ca Liberibacter solanacearum: OA2/Oi2c, resultando el 35,8% de las plantas positivas para fitoplasmas y el 11,6% para la bacteria. Los resultados indican  que en algunas regiones productoras de papa del Estado de México,  los dos presuntos agentes causales del síndrome de  PMP, fitoplasmas y Ca. Liberibacter solanacearum, pueden estar asociados. Palabras clave: Candidatus Liberibacter solanacearum; Fitoplasma; punta morada. Abstract In Mexico and Central America have been detected stained potato tubers with internal browning; recently in Texas, USA, this disease has been called "Zebra Chip" (ZC or striped potato, foliar symptoms resemble the syndrome called "Potato Purple Top" (PPT or "psyllid yellows" disease which is associated with the presence of "Candidatus liberibacter solanacearum

  16. New Multilocus Variable-Number Tandem-Repeat Analysis (MLVA) Scheme for Fine-Scale Monitoring and Microevolution-Related Study of Ralstonia pseudosolanacearum Phylotype I Populations

    Science.gov (United States)

    Guinard, Jérémy; Latreille, Anne; Guérin, Fabien; Poussier, Stéphane

    2016-01-01

    ABSTRACT Bacterial wilt caused by the Ralstonia solanacearum species complex (RSSC) is considered one of the most harmful plant diseases in the world. Special attention should be paid to R. pseudosolanacearum phylotype I due to its large host range, its worldwide distribution, and its high evolutionary potential. So far, the molecular epidemiology and population genetics of this bacterium are poorly understood. Until now, the genetic structure of the RSSC has been analyzed on the worldwide and regional scales. Emerging questions regarding evolutionary forces in RSSC adaptation to hosts now require genetic markers that are able to monitor RSSC field populations. In this study, we aimed to evaluate the multilocus variable-number tandem-repeat analysis (MLVA) approach for its ability to discriminate genetically close phylotype I strains and for population genetics studies. We developed a new MLVA scheme (MLVA-7) allowing us to genotype 580 R. pseudosolanacearum phylotype I strains extracted from susceptible and resistant hosts and from different habitats (stem, soil, and rhizosphere). Based on specificity, polymorphism, and the amplification success rate, we selected seven fast-evolving variable-number tandem-repeat (VNTR) markers. The newly developed MLVA-7 scheme showed higher discriminatory power than the previously published MLVA-13 scheme when applied to collections sampled from the same location on different dates and to collections from different locations on very small scales. Our study provides a valuable tool for fine-scale monitoring and microevolution-related study of R. pseudosolanacearum phylotype I populations. IMPORTANCE Understanding the evolutionary dynamics of adaptation of plant pathogens to new hosts or ecological niches has become a key point for the development of innovative disease management strategies, including durable resistance. Whereas the molecular mechanisms underlying virulence or pathogenicity changes have been studied thoroughly, the

  17. Intestinal Ralstonia pickettii augments glucose intolerance in obesity

    DEFF Research Database (Denmark)

    Udayappan, Shanthadevi D; Kovatcheva-Datchary, Petia; Bakker, Guido J

    2017-01-01

    of insulin resistance in obesity. Here, we report that bacterial DNA is present in mesenteric adipose tissue of obese but otherwise healthy human subjects. Pyrosequencing of bacterial 16S rRNA genes revealed that DNA from the Gram-negative species Ralstonia was most prevalent. Interestingly, fecal abundance...... had reduced glucose tolerance. In addition, circulating levels of endotoxin were increased in R. pickettii-treated mice. In conclusion, this study suggests that intestinal Ralstonia is increased in obese human subjects with T2DM and reciprocally worsens glucose tolerance in DIO mice....

  18. Ralstonia mannitolilytica infection in renal transplant recipient: First report

    Directory of Open Access Journals (Sweden)

    Mukhopadhyay C

    2003-01-01

    Full Text Available Ralstonia mannitolilytica is being increasingly identified as an opportunist pathogen in immunocompromised patients. We report the first case of post renal transplant infection by R. mannitolilytica, in a 14-year-old recipient. The graft and the patient were saved with prompt microbiological identification, sensitivity testing and subsequent administration of appropriate antibiotic.

  19. Intestinal Ralstonia pickettii augments glucose intolerance in obesity.

    Directory of Open Access Journals (Sweden)

    Shanthadevi D Udayappan

    Full Text Available An altered intestinal microbiota composition has been implicated in the pathogenesis of metabolic disease including obesity and type 2 diabetes mellitus (T2DM. Low grade inflammation, potentially initiated by the intestinal microbiota, has been suggested to be a driving force in the development of insulin resistance in obesity. Here, we report that bacterial DNA is present in mesenteric adipose tissue of obese but otherwise healthy human subjects. Pyrosequencing of bacterial 16S rRNA genes revealed that DNA from the Gram-negative species Ralstonia was most prevalent. Interestingly, fecal abundance of Ralstonia pickettii was increased in obese subjects with pre-diabetes and T2DM. To assess if R. pickettii was causally involved in development of obesity and T2DM, we performed a proof-of-concept study in diet-induced obese (DIO mice. Compared to vehicle-treated control mice, R. pickettii-treated DIO mice had reduced glucose tolerance. In addition, circulating levels of endotoxin were increased in R. pickettii-treated mice. In conclusion, this study suggests that intestinal Ralstonia is increased in obese human subjects with T2DM and reciprocally worsens glucose tolerance in DIO mice.

  20. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Ralstonia solanacearum] ... Length = 97 ... Query: 16 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICE...NALAKLDKAPLYVT 75 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICENA...LAKLDKAPLYVT Sbjct: 1 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICENALAKLDKAPLYVT 60 ...

  1. PATOGENISITAS BAKTERI LAYU PISANG (RALSTONIA SP. PADA BEBERAPA TANAMAN LAIN

    Directory of Open Access Journals (Sweden)

    Titik Nur Aeny1 .

    2011-10-01

    Pathogenicity of banana wilt  bacteria (Ralstonia sp. on  several other  plants.  This experiment was conducted to investigate the pathogenicity of bacterial wilt of banana pathogen (Ralstonia sp. isolated from infected plants in Lampung on tomato, chili pepper, eggplant, and ginger.  The experiment was conducted in Laboratory of Plant Protection Department,  Faculty of Agricultural University of Lampung, from May 1999 to February 2000.  Treatments in this experiment were arranged in a completely randomized design with four replications. The treatments were tomato, eggplant, chili pepper, and  ginger.  Banana was used as the control. The results of this experiment showed that up to 30 days after inoculation, the bacteria isolated from banana found  in Lampung was not able to cause symptom on tomato,  chili pepper, eggplant, nor ginger. However, this bacteria caused wilting on banana eight days after inoculation; the incubation period of this bacteria on banana was eight days.

  2. Synergistic interaction in dual-species biofilms formation by Escherichia coli O157:H7 and Ralstonia spp

    Science.gov (United States)

    Introduction: Ralstonia spp., a heterotrophic bacterium that are isolated from produce processing environments as part of the native microflora, have strong potentials for formaing biofilms on various surfaces. When co-cultured, Escherichia coli O157:H7 (EcO157) and Ralstonia spp. displayed a synerg...

  3. Solvent production by engineered Ralstonia eutropha: channeling carbon to biofuel.

    Science.gov (United States)

    Chakravarty, Jayashree; Brigham, Christopher J

    2018-06-01

    Microbial production of solvents like acetone and butanol was a couple of the first industrial fermentation processes to gain global importance. These solvents are important feedstocks for the chemical and biofuel industry. Ralstonia eutropha is a facultatively chemolithoautotrophic bacterium able to grow with organic substrates or H 2 and CO 2 under aerobic conditions. This bacterium is a natural producer of polyhydroxyalkanoate biopolymers. Recently, with the advances in the development of genetic engineering tools, the range of metabolites R. eutropha can produce has enlarged. Its ability to utilize various carbon sources renders it an interesting candidate host for synthesis of renewable biofuel and solvent production. This review focuses on progress in metabolic engineering of R. eutropha for the production of alcohols, terpenes, methyl ketones, and alka(e)nes using various resources. Biological synthesis of solvents still presents the challenge of high production costs and competition from chemical synthesis. Better understanding of R. eutropha biology will support efforts to engineer and develop superior microbial strains for solvent production. Continued research on multiple fronts is required to engineer R. eutropha for truly sustainable and economical solvent production.

  4. Genotypic and phenotypic diversity of Ralstonia pickettii and Ralstonia insidiosa isolates from clinical and environmental sources including High-purity Water.

    LENUS (Irish Health Repository)

    Ryan, Michael P

    2011-08-30

    Abstract Background Ralstonia pickettii is a nosocomial infectious agent and a significant industrial contaminant. It has been found in many different environments including clinical situations, soil and industrial High Purity Water. This study compares the phenotypic and genotypic diversity of a selection of strains of Ralstonia collected from a variety of sources. Results Ralstonia isolates (fifty-nine) from clinical, industrial and environmental origins were compared genotypically using i) Species-specific-PCR, ii) PCR and sequencing of the 16S-23S rRNA Interspatial region (ISR) iii) the fliC gene genes, iv) RAPD and BOX-PCR and v) phenotypically using biochemical testing. The species specific-PCR identified fifteen out of fifty-nine designated R. pickettii isolates as actually being the closely related species R. insidiosa. PCR-ribotyping of the 16S-23S rRNA ISR indicated few major differences between the isolates. Analysis of all isolates demonstrated different banding patterns for both the RAPD and BOX primers however these were found not to vary significantly. Conclusions R. pickettii species isolated from wide geographic and environmental sources appear to be reasonably homogenous based on genotypic and phenotypic characteristics. R. insidiosa can at present only be distinguished from R. pickettii using species specific PCR. R. pickettii and R. insidiosa isolates do not differ significantly phenotypically or genotypically based on environmental or geographical origin.

  5. Enhanced biofilm formation in dual-species culture of Listeria monocytogenes and Ralstonia insidiosa

    Science.gov (United States)

    In the environment, many microorganisms coexist in communities as biofilms. The objective of this study was to investigate the interactions between Listeria monocytogenes and Ralstonia insidiosa in dual species biofilms. Biofilm development was measured using crystal violet in 96-well microtiter pla...

  6. Cupriavidus pauculus (Ralstonia paucula) concomitant meningitis and septicemia in a neonate: First case report from India

    OpenAIRE

    S Duggal; R Gur; R Nayar; S R Rongpharpi; D Jain; R K Gupta

    2013-01-01

    Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and sep...

  7. Characterization of the Adaptive Response to Trichloroethylene-Mediated Stresses in Ralstonia pickettii PKO1

    OpenAIRE

    Park, Joonhong; Kukor, Jerome J.; Abriola, Linda M.

    2002-01-01

    In Ralstonia pickettii PKO1, a denitrifying toluene oxidizer that carries a toluene-3-monooxygenase (T3MO) pathway, the biodegradation of toluene and trichloroethylene (TCE) by the organism is induced by TCE at high concentrations. In this study, the effect of TCE preexposure was studied in the context of bacterial protective response to TCE-mediated toxicity in this organism. The results of TCE degradation experiments showed that cells induced by TCE at 110 mg/liter were more tolerant to TCE...

  8. Extracellular Synthesis of Silver Nanoparticles by Ralstonia sp. SM8 Isolated from the Sarcheshmeh Copper Mine

    Directory of Open Access Journals (Sweden)

    Morahem Ashengroph

    2014-04-01

    Full Text Available Introduction: The biological synthesis of nanoparticles has gained enormous importance due to the development of clean and environmentally-friendly processes. Silver is highly toxic to microbial cells, Nevertheless, it has been reported that several microorganisms are silver resistance and corroborate the microbial reduction of water soluble Ag+ to Ag0 nanoparticles. In this study, native strains of bacteria screen for use as biocatalysts for extracellular synthesis of silver nanoparticles. Materials and methods: Eight different strains of bacteria exhibiting high silver tolerance were isolated from collecting soil samples from copper and gold mines and characterized using morphological observations and preliminary biochemical tests. The bacterial strains in the presence of 1 g/l Ag+ solution at pH 7 were incubated at 28º C for 48 h in an orbital shaker. The silver nanoparticles formation was investigated by visual observations (changing the color of the reaction solution, spectroscopic techniques and microscopic observations. Results: Among the 8 strains giving high Ag+ tolerance, the strain SM8, isolated from the Sarcheshmeh Copper Mine, Kerman, showed the capability of promoting the formation extracellular Ag nanoparticles. The strain was selected and identified as Ralstonia sp. SM8 (GenBank accession number KF264453 based on morphological and biochemical characteristics and its molecular phylogenetic analysis. Results obtained by visual observations, spectral data achieved from UV–vis, XRD spectrum and SEM micrographs revealed the extracellular formation of spherical silver nanoparticles in the size range of 20-50 nm with the culture supernatants of Ralstonia sp. SM8. Discussion and conclusion: Based on the results obtained, fast and extracellular synthesis of silver nanoparticles, without the need for complicated extraction steps, can be taken by using the culture supernatants of Ralstonia sp. SM8. The current study is the first report

  9. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ERASE ... PROTEIN [Ralstonia solanacearum GMI1000] ... Length = 202 ... Query: 2 ... PDSTLTLISHPLCP...FVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR 61 ... PDSTLTLISHPLCPFVQRAA...IVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR Sbjct: 1 ... PDSTLTLISHPLCPFVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLL

  10. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TEIN ... [Ralstonia solanacearum GMI1000] ... Length = 101 ... Query: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR Sbjct: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANTGDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ...

  11. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Ralstonia solanacearum] ... Length = 154 ... Query: 2 ... VQIRPFRSGDELALHAVFYSXXXXXXXXXXXXXXXXXXXPADHD...TAQWAERMRRIQPFVA 61 ... VQIRPFRSGDELALHAVFYS ... PADHD...TAQWAERMRRIQPFVA Sbjct: 1 ... VQIRPFRSGDELALHAVFYSAVHQLAAAHYTAAQLAAWAPADHDTAQWAERMRRIQPFVA 60 ... Query: 122 E

  12. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h = 142 ... Query: 321 PQETCSLFFVEAIQSARKRLWITTPYFIPDEXXXXXXXXXXXXXXXXXILIPARPDHRVV 380 ... PQETCS...LFFVEAIQSARKRLWITTPYFIPDE ... ILIPARPDHRVV Sbjct: 1 ... PQETCSLFFVEAIQSARKRL... ... CARDIOLIPIN SYNTHETASE TRANSMEMBRANE PROTEIN [Ralstonia ... solanacearum] ... Lengt

  13. Cupriavidus pauculus (Ralstonia paucula) concomitant meningitis and septicemia in a neonate: first case report from India.

    Science.gov (United States)

    Duggal, S; Gur, R; Nayar, R; Rongpharpi, S R; Jain, D; Gupta, R K

    2013-01-01

    Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.

  14. Cupriavidus pauculus (Ralstonia paucula concomitant meningitis and septicemia in a neonate: First case report from India

    Directory of Open Access Journals (Sweden)

    S Duggal

    2013-01-01

    Full Text Available Ralstonia paucula (formerly classified as CDC (Centre for Disease Control group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.

  15. Ralstonia insidiosa serves as bridges in biofilm formation by foodborne pathogens Listeria monocytogenes, Salmonella enterica, and enterohemorrhagic Escherichia coli

    Science.gov (United States)

    Biofilm formation on abiotic surfaces in fresh produce processing facilities might play a role in foodborne outbreaks by providing protective microniches for pathogenic bacteria. Our previous study showed that a strain of Ralstonia insidiosa isolated from a fresh produce processing plant could enhan...

  16. Paenibacillus solanacearum sp. nov., isolated from rhizosphere soil of a tomato plant.

    Science.gov (United States)

    Cho, Hayoung; Heo, Jun; Ahn, Jae-Hyung; Weon, Hang-Yeon; Kim, Jeong-Seon; Kwon, Soon-Wo; Kim, Soo-Jin

    2017-12-01

    The taxonomic position of a bacterial strain designated T16R-228 T , isolated from a rhizosphere soil sample of a tomato plant collected from a farm in Buyeo, Chungcheongnam-do, Republic of Korea, was determined using a polyphasic approach. On the basis of morphological, genetic and chemotaxonomic characteristics, it was determined to belong to the genus Paenibacillus. It was an aerobic, Gram-stain-positive, non-motile, catalase-negative, oxidase-negative rod with peritrichous flagella. The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, hydroxyl- phosphatidylethanolamine and one unidentified polar lipid. Menaquiones were MK-7. Predominant cellular fatty acids were anteiso-C15 : 0, C16 : 0 and iso-C16 : 0. DNA G+C content was 56.8 mol%. The phylogenetic tree constructed based on the 16S rRNA gene sequences showed the strain formed a clade with P. mucilaginosus VKPM B-7519 T , P. edaphicus T7 T , P. ehimensis KCTC 3748 T , P. koreensis YC300 T , P. tianmuensis B27 T and P. elgii SD17 T , showing the highest sequence similarity with P. mucilaginosus VKPM B-7519 T (96.5 %). The polyphasic data supported that strain T16R-228 T was clearly distinguished from its closely related species and represents a novel species of the genus Paenibacillus for which the name Paenibacillus solanacearum is proposed. The type strain is T16R-228 T (=KACC 18654 T =NBRC 111896 T ).

  17. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

  18. NCBI nr-aa BLAST: CBRC-DNOV-01-2796 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2796 ref|NP_521847.1| PUTATIVE HEMIN-BINDING OUTER MEMBRANE TRANSMEMBR...ANE PROTEIN [Ralstonia solanacearum GMI1000] emb|CAD17437.1| putative hemin-binding outer membrane transmembrane protein [Ralstonia solanacearum] NP_521847.1 0.003 33% ...

  19. NCBI nr-aa BLAST: CBRC-ACAR-01-1107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1107 ref|NP_519445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solana...cearum GMI1000] emb|CAD15026.1| probable lipid a biosynthesis transmembrane protein [Ralstonia solanacearum] NP_519445.1 6.1 29% ...

  20. NCBI nr-aa BLAST: CBRC-XTRO-01-0649 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0649 ref|NP_521460.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17129.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521460.1 1e-133 79% ...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0098 ref|NP_522097.1| PROBABLE SUGAR-PROTON SYMPORTER TRANSMEMBRANE PR...OTEIN [Ralstonia solanacearum GMI1000] emb|CAD17687.1| probable sugar-proton symporter transmembrane protein [Ralstonia solanacearum] NP_522097.1 0.38 30% ...

  2. NCBI nr-aa BLAST: CBRC-SCER-15-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SCER-15-0000 ref|NP_520947.1| PROBABLE FIMBRIAL ASSEMBLY TRANSMEMBRANE PROTEIN... [Ralstonia solanacearum GMI1000] emb|CAD16533.1| probable fimbrial assembly transmembrane protein [Ralstonia solanacearum] NP_520947.1 1.3 24% ...

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-0657 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0657 ref|NP_521459.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17128.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521459.1 6e-91 75% ...

  4. PRODUCCIÓN DE POLIHIDROXIALCANOATOS (PHAs A PARTIR DE Ralstonia eutropha EN UN MEDIO CON HARINA DE YUCA COMO FUENTE DE CARBONO

    Directory of Open Access Journals (Sweden)

    ELIZABETH ROJAS FERNÁNDEZ

    Full Text Available Los polihidroxialcanoatos (PHAs son poliésteres intracelulares sintetizados por diferentes especies bacterianas, las cuales los acumulan como gránulos cuando se encuentran en condiciones limitantes de nutrientes esenciales para su crecimiento como el oxígeno, nitrógeno y carbono, son biodegradables y, dependiendo de su composición química y estructural, pueden ser empleados en aplicaciones semejantes a los polímeros [1].En la actualidad, este tipo de biopolímeros presentan un mayor costo comparado con los derivados del petróleo, pero el uso de fuentes renovables y el aprovechamiento de subproductos agroindustriales para la generación de nuevos productos es una alternativa ecológica de importancia mundial. En la presente investigación se estudió la producción de polihidroxialcanoatos (PHA mediante fermentación bacteriana de glucosa, obtenida a partir de harina de yuca HMC1 empleando Ralstonia eutropha en un medio con cinco relaciones carbono/nitrógeno(12:1, 16:1, 20:1, 24:1, 28:1. Se obtuvo como resultado, que la relación carbono/nitrógeno de 20 es la que más favorece la acumulación intracelular de biopolímero, con la cual se alcanza una producción de 0,62 g/L de PHA. El PHA sintetizado se caracterizó por medio de calorimetría diferencial de barrido (DSC, Análisis Termogravimetrico (TGA, Espectroscopía de Infrarrojo con Transformada de Fourier (IR-FT y Microscopía electrónica de Barrido (SEM, concluyendo que el biopolímero obtenido fue polihidroxibutirato (PHB.

  5. Impact of Ralstonia eutropha's Poly(3-Hydroxybutyrate) (PHB) Depolymerases and Phasins on PHB Storage in Recombinant Escherichia coli

    OpenAIRE

    Eggers, Jessica; Steinbüchel, Alexander

    2014-01-01

    The model organism for polyhydroxybutyrate (PHB) biosynthesis, Ralstonia eutropha H16, possesses multiple isoenzymes of granules coating phasins as well as of PHB depolymerases, which degrade accumulated PHB under conditions of carbon limitation. In this study, recombinant Escherichia coli BL21(DE3) strains were used to study the impact of selected PHB depolymerases of R. eutropha H16 on the growth behavior and on the amount of accumulated PHB in the absence or presence of phasins. For this p...

  6. Development of a broad-host synthetic biology toolbox for Ralstonia eutropha and its application to engineering hydrocarbon biofuel production.

    Science.gov (United States)

    Bi, Changhao; Su, Peter; Müller, Jana; Yeh, Yi-Chun; Chhabra, Swapnil R; Beller, Harry R; Singer, Steven W; Hillson, Nathan J

    2013-11-13

    The chemoautotrophic bacterium Ralstonia eutropha can utilize H2/CO2 for growth under aerobic conditions. While this microbial host has great potential to be engineered to produce desired compounds (beyond polyhydroxybutyrate) directly from CO2, little work has been done to develop genetic part libraries to enable such endeavors. We report the development of a toolbox for the metabolic engineering of Ralstonia eutropha H16. We have constructed a set of broad-host-range plasmids bearing a variety of origins of replication, promoters, 5' mRNA stem-loop structures, and ribosomal binding sites. Specifically, we analyzed the origins of replication pCM62 (IncP), pBBR1, pKT (IncQ), and their variants. We tested the promoters P(BAD), T7, P(xyls/PM), P(lacUV5), and variants thereof for inducible expression. We also evaluated a T7 mRNA stem-loop structure sequence and compared a set of ribosomal binding site (RBS) sequences derived from Escherichia coli, R. eutropha, and a computational RBS design tool. Finally, we employed the toolbox to optimize hydrocarbon production in R. eutropha and demonstrated a 6-fold titer improvement using the appropriate combination of parts. We constructed and evaluated a versatile synthetic biology toolbox for Ralstonia eutropha metabolic engineering that could apply to other microbial hosts as well.

  7. The influence of substrate source on the growth of Ralstonia eutropha, aiming at the production of polyhydroxyalkanoate

    Directory of Open Access Journals (Sweden)

    Marangoni C.

    2001-01-01

    Full Text Available With the aim of producing polyhydroxyalkanoates, a study of the influence of culture conditions (nitrogen and carbon sources and temperature on the growth of Ralstonia eutropha in stirred flasks was carried out and the use of some low-cost sources (hydrolyzed lactose, inverted sugar and corn steep liquor as evaluated. The best specific growth rate was obtained when inverted sugar was utilized as the substrate (mumax = 0.26 h-1. Two different phases in the assimilation of the carbon source were observed when hydrolyzed lactose was present, suggesting the assimilation first of glucose and then of galactose. To confirm the growth of Ralstonia eutropha using galactose as the only carbon source, experiments were carried out and the results showed that this bacterium is able to grow in the presence of this sugar at a growth rate of 0.13 h-1. The use of galactose by Ralstonia eutropha for its growth has not been reported in the literature until now. Corn steep liquor was found to be a viable alternative nitrogen source to ammonium sulfate. The results of experiments carried out at 30°C and 34°C were similar.

  8. Production of polyhydroxy alkanoates by Ralstonia eutropha from volatile fatty acids

    Energy Technology Data Exchange (ETDEWEB)

    Yun, Jung Hyun; Sawant, Shailesh S.; Kim, Beom Soo [Chungbuk National University, Cheongju (Korea, Republic of)

    2013-12-15

    Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible thermoplastics that can be synthesized in various microorganisms. Volatile fatty acids (VFAs) are produced by anaerobic treatment of organic wastes that can be utilized as inexpensive substrates for PHA synthesis. In this study, several Ralstonia eutropha strains were grown on the mixture of VFAs (acetic, propionic, and butyric acid) as its carbon and energy source for growth and PHA synthesis. R. eutropha KCTC 2658 accumulated PHAs up to 50% of dry cell weight from total 5 g/L of mixed VFAs (acetic acid : propionic acid : butyric acid=1 : 2 : 2). In batch culture of R. eutropha KCTC2658 in a 5 L fermentor, a homopolymer of poly(3-hydroxybutyrate) [P(3HB)] was produced from 20 g/L glucose as a sole carbon source with dry cell weight of 8.4 g/L and PHA content of 30%. In fed-batch culture, two feeding strategies, pulse or pH-stat, were applied to add VFAs to the fermentor. When VFAs were fed using pH-stat feeding strategy after 40 h, a copolymer of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) [P(3HB-co-3HV)] was produced with dry cell weight of 8.1 g/L, PHA content of 50%, and 3HV fraction of 20 mol%.

  9. Cometabolism of Fluoroanilines in the Presence of 4-Fluoroaniline by Ralstonia sp. FD-1

    Directory of Open Access Journals (Sweden)

    Wenling Cao

    2015-01-01

    Full Text Available A strain of Ralstonia sp. FD-1 capable of using 4-fluoroaniline (4-FA as the sole carbon and nitrogen source was investigated for its ability to utilize 4-FA isomers (2-FA, 3-FA and homologs (2,4-DFA, 3,4-DFA, and 2,3,4-TFA. Both 4-FA and 3-FA could be mineralized as the sole carbon and nitrogen source by FD-1. 2-FA, 2,4-DFA, 3,4-DFA, and 2,3,4-TFA could not be degraded by FD-1, respectively, and were selected as secondary substrates for cometabolism with 500 mg/L 4-FA as growth substrate. Bacterial growth (OD600, F− concentrations, and fluoroanilines contents were measured to determinate the degradation ability of 4-FA isomers and homologs by FD-1. FD-1 growth was inhibited by 2,4-DFA, 3,4-DFA, and 2,3,4-TFA at higher concentrations (400 mg/L, except for 2-FA. Complete fluoroanilines degradation was achieved while incomplete defluorination was characterized by the stoichiometric fluoride release indicating partial degradation but not total mineralization. When fluoroaniline was supplied to the resting cells of strain FD-1, a relatively effective removal was showed. Strain FD-1 had broadened application prospect of toxicity and low nutrition fluoroanilines wastewater.

  10. Polyhydroxyalkanoates production with Ralstonia eutropha from low quality waste animal fats.

    Science.gov (United States)

    Riedel, Sebastian L; Jahns, Stefan; Koenig, Steven; Bock, Martina C E; Brigham, Christopher J; Bader, Johannes; Stahl, Ulf

    2015-11-20

    Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible polyesters considered as alternatives to petroleum-based plastics. Ralstonia eutropha is a model organism for PHA production. Utilizing industrially rendered waste animal fats as inexpensive carbon feedstocks for PHA production is demonstrated here. An emulsification strategy, without any mechanical or chemical pre-treatment, was developed to increase the bioavailability of solid, poorly-consumable fats. Wild type R. eutropha strain H16 produced 79-82% (w/w) polyhydroxybutyrate (PHB) per cell dry weight (CDW) when cultivated on various fats. A productivity of 0.3g PHB/(L × h) with a total PHB production of 24 g/L was achieved using tallow as carbon source. Using a recombinant strain of R. eutropha that produces poly(hydroxybutyrate-co-hydroxyhexanoate) [P(HB-co-HHx)], 49-72% (w/w) of PHA per CDW with a HHx content of 16-27 mol% were produced in shaking flask experiments. The recombinant strain was grown on waste animal fat of the lowest quality available at lab fermenter scale, resulting in 45 g/L CDW with 60% (w/w) PHA per CDW and a productivity of 0.4 g PHA/(L × h). The final HHx content of the polymer was 19 mol%. The use of low quality waste animal fats as an inexpensive carbon feedstock exhibits a high potential to accelerate the commercialization of PHAs. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Investigation of the NADH/NAD+ ratio in Ralstonia eutropha using the fluorescence reporter protein Peredox.

    Science.gov (United States)

    Tejwani, Vijay; Schmitt, Franz-Josef; Wilkening, Svea; Zebger, Ingo; Horch, Marius; Lenz, Oliver; Friedrich, Thomas

    2017-01-01

    Ralstonia eutropha is a hydrogen-oxidizing ("Knallgas") bacterium that can easily switch between heterotrophic and autotrophic metabolism to thrive in aerobic and anaerobic environments. Its versatile metabolism makes R. eutropha an attractive host for biotechnological applications, including H 2 -driven production of biodegradable polymers and hydrocarbons. H 2 oxidation by R. eutropha takes place in the presence of O 2 and is mediated by four hydrogenases, which represent ideal model systems for both biohydrogen production and H 2 utilization. The so-called soluble hydrogenase (SH) couples reversibly H 2 oxidation with the reduction of NAD + to NADH and has already been applied successfully in vitro and in vivo for cofactor regeneration. Thus, the interaction of the SH with the cellular NADH/NAD + pool is of major interest. In this work, we applied the fluorescent biosensor Peredox to measure the [NADH]:[NAD + ] ratio in R. eutropha cells under different metabolic conditions. The results suggest that the sensor operates close to saturation level, indicating a rather high [NADH]:[NAD + ] ratio in aerobically grown R. eutropha cells. Furthermore, we demonstrate that multicomponent analysis of spectrally-resolved fluorescence lifetime data of the Peredox sensor response to different [NADH]:[NAD + ] ratios represents a novel and sensitive tool to determine the redox state of cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Enhanced biofilm formation in dual-species culture of Listeria monocytogenes and Ralstonia insidiosa

    Directory of Open Access Journals (Sweden)

    Yunfeng Xu

    2017-09-01

    Full Text Available In the natural environments microorganisms coexist in communities as biofilms. Since foodborne pathogens have varying abilities to form biofilms, investigation of bacterial interactions in biofilm formation may enhance our understanding of the persistence of these foodborne pathogens in the environment. Thus the objective of this study was to investigate the interactions between Listeria monocytogenes and Ralstonia insidiosa in dual species biofilms. Biofilm development after 24 h was measured using crystal violet in 96-well microtiter plate. Scanning electron microscopy and cell enumeration were employed after growth on stainless steel coupons. When compared with their single species counterparts, the dual species biofilms exhibited a significant increase in biofilm biomass. The number of L. monocytogenes in co-culture biofilms on stainless steel also increased significantly. However, there was no effect on the biofilm formation of L. monocytogenes when cultured with R. insidiosa separated by a semi-permeable membrane-linked compartment or cultured in R. insidiosa cell-free supernatant, indicating that direct cell-cell contact is critical for this interaction.

  13. PHB granules are attached to the nucleoid via PhaM in Ralstonia eutropha.

    Science.gov (United States)

    Wahl, Andreas; Schuth, Nora; Pfeiffer, Daniel; Nussberger, Stephan; Jendrossek, Dieter

    2012-11-16

    Poly(3-hydroxybutyrate) (PHB) granules are important storage compounds of carbon and energy in many prokaryotes which allow survival of the cells in the absence of suitable carbon sources. Formation and subcellular localization of PHB granules was previously assumed to occur randomly in the cytoplasm of PHB accumulating bacteria. However, contradictionary results on subcellular localization of PHB granules in Ralstonia eutropha were published, recently. Here, we provide evidence by transmission electron microscopy that PHB granules are localized in close contact to the nucleoid region in R. eutropha during growth on nutrient broth. Binding of PHB granules to the nucleoid is mediated by PhaM, a PHB granule associated protein with phasin-like properties that is also able to bind to DNA and to phasin PhaP5. Over-expression of PhaM resulted in formation of many small PHB granules that were always attached to the nucleoid region. In contrast, PHB granules of ∆phaM strains became very large and distribution of granules to daughter cells was impaired. Association of PHB granules to the nucleoid region was prevented by over-expression of PhaP5 and clusters of several PHB granules were mainly localized near the cell poles. Subcellular localization of PHB granules is controlled in R. eutropha and depends on the presence and concentrations of at least two PHB granule associated proteins, PhaM and PhaP5.

  14. Production of polyhydroxy alkanoates by Ralstonia eutropha from volatile fatty acids

    International Nuclear Information System (INIS)

    Yun, Jung Hyun; Sawant, Shailesh S.; Kim, Beom Soo

    2013-01-01

    Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible thermoplastics that can be synthesized in various microorganisms. Volatile fatty acids (VFAs) are produced by anaerobic treatment of organic wastes that can be utilized as inexpensive substrates for PHA synthesis. In this study, several Ralstonia eutropha strains were grown on the mixture of VFAs (acetic, propionic, and butyric acid) as its carbon and energy source for growth and PHA synthesis. R. eutropha KCTC 2658 accumulated PHAs up to 50% of dry cell weight from total 5 g/L of mixed VFAs (acetic acid : propionic acid : butyric acid=1 : 2 : 2). In batch culture of R. eutropha KCTC2658 in a 5 L fermentor, a homopolymer of poly(3-hydroxybutyrate) [P(3HB)] was produced from 20 g/L glucose as a sole carbon source with dry cell weight of 8.4 g/L and PHA content of 30%. In fed-batch culture, two feeding strategies, pulse or pH-stat, were applied to add VFAs to the fermentor. When VFAs were fed using pH-stat feeding strategy after 40 h, a copolymer of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) [P(3HB-co-3HV)] was produced with dry cell weight of 8.1 g/L, PHA content of 50%, and 3HV fraction of 20 mol%

  15. Biosynthesis and thermal properties of PHBV produced from levulinic acid by Ralstonia eutropha.

    Directory of Open Access Journals (Sweden)

    Yuanpeng Wang

    Full Text Available Levulinic acid (LA can be cost-effectively produced from a vast array of renewable carbohydrate-containing biomaterials. LA could facilitate the commercialization of the polymer poly(hydroxybutyrate-co-hydroxyvalerate (PHBV and PHBV-based products as carbon substrates. Therefore, this paper focused on the production of PHBV by Ralstonia eutropha with LA for hydroxyvalerate (HV production, which plays an important role in enhancing the thermal properties of PHBV. Accordingly, the HV content of PHBV varied from 0-40.9% at different concentrations of LA. Stimulation of cell growth and PHBV accumulation were observed when 2-6 g L(-1 LA was supplied to the culture. The optimal nitrogen sources were determined to be 0.5 g L(-1 ammonium chloride and 2 g L(-1 casein peptone. It was determined that the optimal pH for cell growth and PHBV accumulation was 7.0. When the cultivation was performed in large scale (2 L fermenter with a low DO concentration of 30% and a pH of 7.0, a high maximum dry cell weight of 15.53 g L(-1 with a PHBV concentration of 12.61 g L(-1 (53.9% HV, up to 81.2% of the dry cell weight, was obtained. The melting point of PHBV found to be decreased as the fraction of HV present in the polymer increased, which resulted in an improvement in the ductility and flexibility of the polymer. The results of this study will improve the understanding of the PHBV accumulation and production by R. eutropha and will be valuable for the industrial production of biosynthesized polymers.

  16. Studies on the production of branched-chain alcohols in engineered Ralstonia eutropha

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Jingnan [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Chemistry; Brigham, Christopher J.; Gai, Claudia S. [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Biology; Sinskey, Anthony J. [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Biology; Massachusetts Institute of Technology, Cambridge, MA (United States). Div. of Health Sciences and Technology; Massachusetts Institute of Technology, Cambridge, MA (United States). Engineering Systems Div.

    2012-10-15

    Wild-type Ralstonia eutropha H16 produces polyhydroxybutyrate (PHB) as an intracellular carbon storage material during nutrient stress in the presence of excess carbon. In this study, the excess carbon was redirected in engineered strains from PHB storage to the production of isobutanol and 3-methyl-1-butanol (branched-chain higher alcohols). These branched-chain higher alcohols can directly substitute for fossil-based fuels and be employed within the current infrastructure. Various mutant strains of R. eutropha with isobutyraldehyde dehydrogenase activity, in combination with the overexpression of plasmid-borne, native branched-chain amino acid biosynthesis pathway genes and the overexpression of heterologous ketoisovalerate decarboxylase gene, were employed for the biosynthesis of isobutanol and 3-methyl-1-butanol. Production of these branched-chain alcohols was initiated during nitrogen or phosphorus limitation in the engineered R. eutropha. One mutant strain not only produced over 180 mg/L branched-chain alcohols in flask culture, but also was significantly more tolerant of isobutanol toxicity than wild-type R. eutropha. After the elimination of genes encoding three potential carbon sinks (ilvE, bkdAB, and aceE), the production titer improved to 270 mg/L isobutanol and 40 mg/L 3-methyl-1-butanol. Semicontinuous flask cultivation was utilized to minimize the toxicity caused by isobutanol while supplying cells with sufficient nutrients. Under this semicontinuous flask cultivation, the R. eutropha mutant grew and produced more than 14 g/L branched-chain alcohols over the duration of 50 days. These results demonstrate that R. eutropha carbon flux can be redirected from PHB to branched-chain alcohols and that engineered R. eutropha can be cultivated over prolonged periods of time for product biosynthesis. (orig.)

  17. Inventorying the molecular potential of Cupriavidus and Ralstonia strains surviving harsh space-related environments

    Science.gov (United States)

    Mijnendonckx, Kristel; van Houdt, Rob; Provoost, Ann; Bossus, Albert; Ott, C. Mark; Venkateswaran, Kasthuri; Leys, Natalie

    The craving of modern man to explore life beyond earth presents a lot of challenges. The control of microbial contamination of the confined manned spacecraft is an important aspect that has to be taken into account in this journey. Because the human body contains a huge amount of microorganisms, the crew itself is the most important contamination source. But contamination can also originate from residing environmental microorganisms or from materials that are supplied from the Earth. These microbial contaminations can cause problems for the astronauts -well documented to have a decreased immunity -and the infrastructure of the space station. In this study, 14 different Cupriavidus metallidurans and Ralstonia pickettii strains, isolated from such space-related environments, where characterised in detail. These unique strains were isolated from drinking water that returned from ISS (3), from the cooling water system of the American ISS segment (4), from a swab sample of the Mars Odyssey Orbitor surface prior to flight (4), and from an air sample taken in the space assembly facility PHSF during Mars exploration Rover assembly (3). Their resistance to heavy metals and antibiotics was screened. The C. metallidurans isolates were more resistant to Zn2+ and Hg+ but more sensitive to Ni2+ than the R. pickettii strains. The MIC values for Cu2+ ranged from 1,5mM to 12mM, for Co2+ from 1,58mM to 12,63mM and for Cd2+ from 0,25mM to 1mM. For Ni2+ , the MIC values were between 2 and 8mM, except for the strain C. metallidurans IV (0502478) that was able to grow on Ni+2 concentrations up to 48mM. A metal of special interest was Ag+ because it is used to sanitize ISS drinking water. The strains isolated from air and surface samples showed a MIC value ranging from 0,35µM to 4µM. The isolates from the water samples had MIC values from 0,3µM to 2µM, which is lower than (or comparable with) the lowest limit of the silver concentration used in the ISS (1,9µM -4,6µM). However, all

  18. Genomic sequence of 'Candidatus Liberibacter solanacearum' haplotype C and its comparison with haplotype A and B genomes.

    Directory of Open Access Journals (Sweden)

    Jinhui Wang

    Full Text Available Haplotypes A and B of 'Candidatus Liberibacter solanacearum' (CLso are associated with diseases of solanaceous plants, especially Zebra chip disease of potato, and haplotypes C, D and E are associated with symptoms on apiaceous plants. To date, one complete genome of haplotype B and two high quality draft genomes of haplotype A have been obtained for these unculturable bacteria using metagenomics from the psyllid vector Bactericera cockerelli. Here, we present the first genomic sequences obtained for the carrot-associated CLso. These two genomic sequences of haplotype C, FIN114 (1.24 Mbp and FIN111 (1.20 Mbp, were obtained from carrot psyllids (Trioza apicalis harboring CLso. Genomic comparisons between the haplotypes A, B and C revealed that the genome organization differs between these haplotypes, due to large inversions and other recombinations. Comparison of protein-coding genes indicated that the core genome of CLso consists of 885 ortholog groups, with the pan-genome consisting of 1327 ortholog groups. Twenty-seven ortholog groups are unique to CLso haplotype C, whilst 11 ortholog groups shared by the haplotypes A and B, are not found in the haplotype C. Some of these ortholog groups that are not part of the core genome may encode functions related to interactions with the different host plant and psyllid species.

  19. Phenology of the Potato Psyllid, Bactericera cockerelli (Hemiptera: Triozidae), and "Candidatus Liberibacter solanacearum" in Commercial Potato Fields in Idaho.

    Science.gov (United States)

    Wenninger, Erik J; Carroll, Amy; Dahan, Jennifer; Karasev, Alexander V; Thornton, Michael; Miller, Jeff; Nolte, Philip; Olsen, Nora; Price, William

    2017-12-08

    Zebra chip disease (ZC) is an emerging disease of potato in which tubers are produced with striped necrotic patterns that make them unmarketable. ZC is associated with the bacterium "Candidatus Liberibacter solanacearum" (Lso), which is transmitted by the potato psyllid, Bactericera cockerelli (Šulc; Hemiptera: Triozidae). First found in Idaho during 2011, ZC now contributes to increased production costs each season via additional insecticide sprays. To clarify the extent and severity of the threat of ZC in Idaho, we sampled potato psyllids in commercial potato fields across the state over four growing seasons (2012-2015). All life stages of psyllids were sampled using a combination of methods (yellow sticky traps, vacuum samples, and leaf samples), and adult psyllids were tested for the presence of Lso by Polymerase Chain Reaction (PCR). Abundance of potato psyllids initially increased gradually over each growing season, then exhibited a sharp late-season rise and a sharp decline as most fields were being harvested. Abundance of psyllids was higher at warmer, lower elevation sites, but infestation onset did not differ between growing regions. Fewer psyllids were collected in vacuum samples than in sticky trap samples. Nymphs and eggs were found only late season and during years with high abundance of adults. Overall incidence of Lso was similar among all years but one. The results presented here clarify our understanding of the seasonal phenology of potato psyllids and Lso in Idaho potato fields and will aid in developing integrated management strategies against this important pest of potato. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  20. Production and purification of a soluble hydrogenase from Ralstonia eutropha H16 for potential hydrogen fuel cell applications.

    Science.gov (United States)

    Jugder, Bat-Erdene; Lebhar, Helene; Aguey-Zinsou, Kondo-Francois; Marquis, Christopher P

    2016-01-01

    The soluble hydrogenase (SH) from Ralstonia eutropha H16 is a promising candidate enzyme for H2-based biofuel application as it favours H2 oxidation and is relatively oxygen-tolerant. In this report, bioprocess development studies undertaken to produce and purify an active SH are described, based on the methods previously reported [1], [2], [3], [4]. Our modifications are: •Upstream method optimizations were undertaken on heterotrophic growth media and cell lysis involving ultrasonication.•Two anion exchangers (Q Sepharose and RESOURCE Q) and size exclusion chromatographic (Superdex 200) matrices were successfully employed for purification of a hexameric SH from R. eutropha.•The H2 oxidizing activity of the SH was demonstrated spectrophotometrically in solution and also immobilized on an EPG electrode using cyclic voltammetry.

  1. Controle alternativo da murcha bacteriana do pimentão utilizando óleos essenciais vegetais e silicato de cálcio.

    OpenAIRE

    Aldenir de Oliveira Alves

    2012-01-01

    A murcha bacteriana do pimentão, causada por Ralstonia solanacearum (Rs) raça 1, é uma fitobacteriose importante em Pernambuco e outros estados do Brasil. Este trabalho teve como objetivos testar o efeito de óleos vegetais e do silício (Si) no controle alternativo desta doença, seus efeitos diretos sobre Rs e verificar os possíveis mecanismos envolvidos nestes processos. Os óleos essenciais de bergamota, canela, capim limão, copaíba, eucalipto citriodora, eucalipto globulus, funcho, hortel...

  2. Multiplex real-time PCR for detection, identification and quantification of 'Candidatus Liberibacter solanacearum' in potato plants with zebra chip.

    Science.gov (United States)

    Li, Wenbin; Abad, Jorge A; French-Monar, Ronald D; Rascoe, John; Wen, Aimin; Gudmestad, Neil C; Secor, Gary A; Lee, Ing-Ming; Duan, Yongping; Levy, Laurene

    2009-07-01

    The new Liberibacter species, 'Candidatus Liberibacter solanacearum' (Lso) recently associated with potato/tomato psyllid-transmitted diseases in tomato and capsicum in New Zealand, was found to be consistently associated with a newly emerging potato zebra chip (ZC) disease in Texas and other southwestern states in the USA. A species-specific primer LsoF was developed for both quantitative real-time PCR (qPCR) and conventional PCR (cPCR) to detect and quantify Lso in infected samples. In multiplex qPCR, a plant cytochrome oxidase (COX)-based probe-primer set was used as a positive internal control for host plants, which could be used to reliably access the DNA extraction quality and to normalize qPCR data for accurate quantification of the bacterial populations in environment samples. Neither the qPCR nor the cPCR using the primer and/or probe sets with LsoF reacted with other Liberibacter species infecting citrus or other potato pathogens. The low detection limit of the multiplex qPCR was about 20 copies of the target 16S rDNA templates per reaction for field samples. Lso was readily detected and quantified in various tissues of ZC-affected potato plants collected from fields in Texas. A thorough but uneven colonization of Lso was revealed in various tissues of potato plants. The highest Lso populations were about 3x10(8) genomes/g tissue in the root, which were 3-order higher than those in the above-ground tissues of potato plants. The Lso bacterial populations were normally distributed across the ZC-affected potato plants collected from fields in Texas, with 60% of ZC-affected potato plants harboring an average Lso population from 10(5) to 10(6) genomes/g tissue, 4% of plants hosting above 10(7) Lso genomes/g tissue, and 8% of plants holding below 10(3) Lso genomes/g tissue. The rapid, sensitive, specific and reliable multiplex qPCR showed its potential to become a powerful tool for early detection and quantification of the new Liberibacter species associated

  3. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  4. Influence of introduced potential biocontrol agents on maize seedling growth and bacterial community structure in the rhizosphere

    NARCIS (Netherlands)

    Kozdroj, J; Trevors, JT; van Elsas, JD

    Two species of Pseudomonas chromosomally tagged with gfp, which had shown antagonistic activity against the tomato pathogen Ralstonia solanacearum in a previous study, were assessed for their impact in the rhizosphere of maize. Plant growth characteristics, numbers of indigenous heterotrophic

  5. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ECTION DURING STARVATION OR OXYDATIVE STRESS ... TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacea...rum] ... ref|NP_520808.1| PUTATIVE DNA PROTECTION DURING ... STARVATION OR OXYDATIVE STRESS TR

  6. Crystal structure and biochemical characterization of beta-keto thiolase B from polyhydroxyalkanoate-producing bacterium Ralstonia eutropha H16

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Eun-Jung; Son, Hyeoncheol Francis [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); Kim, Sangwoo [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); School of Nono-Bioscience and Chemical Engineering, Ulsan National Institute of Science and Technology (UNIST), Ulsan 689-798 (Korea, Republic of); Ahn, Jae-Woo [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); Kim, Kyung-Jin, E-mail: kkim@knu.ac.kr [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of)

    2014-02-14

    Highlights: • We determined a crystal structure of β-keto thiolase from Ralstonia eutropha H16 (ReBktB). • Distinct substrate binding mode ReBktB was elucidated. • Enzymatic kinetic parameters of ReBktB were revealed. - Abstract: ReBktB is a β-keto thiolase from Ralstonia eutropha H16 that catalyzes condensation reactions between acetyl-CoA with acyl-CoA molecules that contains different numbers of carbon atoms, such as acetyl-CoA, propionyl-CoA, and butyryl-CoA, to produce valuable bioproducts, such as polyhydroxybutyrate, polyhydroxybutyrate-hydroxyvalerate, and hexanoate. We solved a crystal structure of ReBktB at 2.3 Å, and the overall structure has a similar fold to that of type II biosynthetic thiolases, such as PhbA from Zoogloea ramigera (ZrPhbA). The superposition of this structure with that of ZrPhbA complexed with CoA revealed the residues that comprise the catalytic and substrate binding sites of ReBktB. The catalytic site of ReBktB contains three conserved residues, Cys90, His350, and Cys380, which may function as a covalent nucleophile, a general base, and second nucleophile, respectively. For substrate binding, ReBktB stabilized the ADP moiety of CoA in a distinct way compared to ZrPhbA with His219, Arg221, and Asp228 residues, whereas the stabilization of β-mercaptoethyamine and pantothenic acid moieties of CoA was quite similar between these two enzymes. Kinetic study of ReBktB revealed that K{sub m}, V{sub max}, and K{sub cat} values of 11.58 μM, 1.5 μmol/min, and 102.18 s{sup −1}, respectively, and the catalytic and substrate binding sites of ReBktB were further confirmed by site-directed mutagenesis experiments.

  7. Identification of virulence factors and type III effectors of Phylotype I ...

    Indian Academy of Sciences (India)

    HP2000

    R. solanacearum finds its way into the plant through wounds in the roots and .... 10% (c) Acidic residues should be absent within the first twelve amino acids. .... PilA has been used to study the genetic diversity in soil bacterium ..... the GALA type III effector family contributes to Ralstonia solanacearum adaptation on different.

  8. Lipid and fatty acid metabolism in Ralstonia eutropha: relevance for the biotechnological production of value-added products.

    Science.gov (United States)

    Riedel, Sebastian L; Lu, Jingnan; Stahl, Ulf; Brigham, Christopher J

    2014-02-01

    Lipid and fatty acid metabolism has been well studied in model microbial organisms like Escherichia coli and Bacillus subtilis. The major precursor of fatty acid biosynthesis is also the major product of fatty acid degradation (β-oxidation), acetyl-CoA, which is a key metabolite for all organisms. Controlling carbon flux to fatty acid biosynthesis and from β-oxidation allows for the biosynthesis of natural products of biotechnological importance. Ralstonia eutropha can utilize acetyl-CoA from fatty acid metabolism to produce intracellular polyhydroxyalkanoate (PHA). R. eutropha can also be engineered to utilize fatty acid metabolism intermediates to produce different PHA precursors. Metabolism of lipids and fatty acids can be rerouted to convert carbon into other value-added compounds like biofuels. This review discusses the lipid and fatty acid metabolic pathways in R. eutropha and how they can be used to construct reagents for the biosynthesis of products of industrial importance. Specifically, how the use of lipids or fatty acids as the sole carbon source in R. eutropha cultures adds value to these biotechnological products will be discussed here.

  9. RpA, an extracellular protease similar to the metalloprotease of serralysin family, is required for pathogenicity of Ralstonia pickettii.

    Science.gov (United States)

    Chen, C-M; Liu, J-J; Chou, C-W; Lai, C-H; Wu, L-T

    2015-10-01

    To investigate the biochemical and functional properties of an extracellular protease, RpA, in Ralstonia pickettii WP1 isolated from water supply systems. An extracellular protease was identified and characterized from R. pickettii WP1. A mutant strain WP1M2 was created from strain WP1 by mini-Tn5 transposition. The culture filtrates from WP1M2 had a lower cytotoxic effect than the parental WP1 on several mammalian cell lines. Cloning and sequence analysis revealed the Tn5 transposon inserted at a protease gene (rpA) which is 81% homologous to prtA and aprX genes of Pseudomonas fluorescens. The rpA gene encodes a 482-residue protein showing sequence similarity to metalloproteases of the serralysin family. The RpA protein was expressed in Escherichia coli using a pET expression vector and purified as a 55 kDa molecular weight protein. Furthermore, the protease activity of RpA was inhibited by protease inhibitor and heat treatment. The in vitro cytotoxic activity of R. pickettii culture filtrates was attributed to RpA protease. An extracellular protease, RpA, was identified from R. pickettii WP1 isolated from water supply system. The RpA metalloproteases is required for the pathogenicity of R. pickettii to mammalian cell lines. © 2015 The Society for Applied Microbiology.

  10. Cloning, expression, purification, crystallization and X-ray crystallographic analysis of β-ketothiolase B from Ralstonia eutropha H16.

    Science.gov (United States)

    Kim, Eun-Jung; Son, Hyeoncheol Francis; Chang, Jeong Ho; Kim, Kyung-Jin

    2014-03-01

    Polyhydroxyalkanoates are linear polyesters that are produced by bacterial fermentation and are used as biodegradable bioplastics. β-Ketothiolase B (BktB) from Ralstonia eutropha (ReBktB) is a key enzyme for the production of various types of copolymers by catalyzing the condensation reactions of acetyl-CoA with propionyl-CoA and butyryl-CoA. The ReBktB protein was crystallized using the hanging-drop vapour-diffusion method in the presence of 25% polyethylene glycol 3350, 0.1 M bis-tris pH 6.5, 0.2 M lithium sulfate at 295 K. X-ray diffraction data were collected to a maximum resolution of 2.3 Å on a synchrotron beamline. The crystal belonged to space group C2221, with unit-cell parameters a = 106.95, b = 107.24, c = 144.14 Å. With two molecules per asymmetric unit, the crystal volume per unit protein weight (VM) is 2.54 Å(3) Da(-1), which corresponds to a solvent content of approximately 51.5%. The structure was solved by the molecular-replacement method and refinement of the structure is in progress.

  11. Characterization of poly-3-hydroxybutyrate (PHB) produced from Ralstonia eutropha using an alkali-pretreated biomass feedstock.

    Science.gov (United States)

    Saratale, Ganesh D; Oh, Min-Kyu

    2015-09-01

    Alkaline pretreatment using NaOH, KOH, or NaOCl has been applied to various types of waste biomass to enhance enzymatic digestibility. Pretreatment (2% NaOH, 121 °C, 30 min) of rice paddy straw (PS) resulted in a maximum yield of 703 mg of reducing sugar per gram of PS with 84.19% hydrolysis yield after a two-step enzymatic hydrolysis process. Ralstonia eutropha ATCC 17699 was tested for its ability to synthesize poly-3-hydroxybutyrate (PHB) using PS hydrolysates as its sole carbon source. It is noteworthy that dry cell weight, polyhydroxyalkanoate (PHA) accumulation and PHB yield with the use of laboratory-grade sugars were similar to those achieved with PS-derived sugars. Under optimized conditions, we observed maximal PHA accumulation (75.45%) and PHB production (11.42 g/L) within 48 h of fermentation. After PHB recovery, the physicochemical properties of PHB were determined by various analytical techniques, showed the results were consistent with the characteristics of a standard polymer of PHB. Thus, the PS hydrolysate proved to be an excellent cheap carbon substrate for PHB production. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Effects of Mutations in the Substrate-Binding Domain of Poly[(R)-3-Hydroxybutyrate] (PHB) Depolymerase from Ralstonia pickettii T1 on PHB Degradation▿

    OpenAIRE

    Hiraishi, Tomohiro; Hirahara, Yoko; Doi, Yoshiharu; Maeda, Mizuo; Taguchi, Seiichi

    2006-01-01

    Poly[(R)-3-hydroxybutyrate] (PHB) depolymerase from Ralstonia pickettii T1 (PhaZRpiT1) adsorbs to denatured PHB (dPHB) via its substrate-binding domain (SBD) to enhance dPHB degradation. To evaluate the amino acid residues participating in dPHB adsorption, PhaZRpiT1 was subjected to a high-throughput screening system consisting of PCR-mediated random mutagenesis targeted to the SBD gene and a plate assay to estimate the effects of mutations in the SBD on dPHB degradation by PhaZRpiT1. Genetic...

  13. Evaluation of tomato rootstocks and its use to control bacterial wilt diseaseAvaliação de porta-enxertos de tomateiro e o uso da enxertia no controle da murcha bacteriana

    Directory of Open Access Journals (Sweden)

    Francisco Ferraz Laranjeira

    2012-05-01

    Full Text Available Tomato plants are susceptible to bacterial wilting, which causes production losses varying from 10 to 100 %. A method for controlling this disease is the use of grafting on resistant rootstocks. This work had the objective of evaluating tomato genotypes for the resistance to Ralstonia solanacearum and the grafting technique as an alternative for the bacterial wilt control in the region of Recôncavo Baiano, Brazil. To evaluate the resistance to R. solanacearum, four local genotypes, collected in different regions of Bahia, the cv. Santa Clara as a susceptible treatment, and the Hawaii 7996 (H7996, as a resistant treatment were studied. For the evaluation of grafting method for control of bacterial wilt, the H7996 was used as rootstock, and the cvs. Santa Clara, Santa Cruz Kada, and Débora Plus were used as the scion plants. Both experiments were evaluated in an area infested with R. solanacearum, for a period of 65 days for the selection of the rootstocks and 45 days for the evaluation of the grafting method. Only the H7996 can be recommended as a R. solanacearum resistant rootstock. The other genotypes showed susceptibility to the pathogen. The grafting on the H7996 did not show incompatibility with the scion tomato cultivars tested and reached 100 % control of the bacterial wilt disease, for all treatments, suggesting that this method can be used as an alternative for the bacterial wilt control, allowing the production of susceptible tomato cultivars in areas infested with R. solanacearum A suscetibilidade do tomateiro à murcha bacteriana (Ralstonia solanacearum causa perdas que vão de 10 a 100 % na produção e uma das alternativas de controle que vem sendo utilizada é a enxertia com porta-enxerto resistente. Este trabalho teve o objetivo avaliar genótipos de tomateiro quanto à resistência a R. solanacearum e a enxertia como alternativa para o controle da murcha bacteriana do tomateiro na região do Recôncavo Baiano. Para avalia

  14. Catalytic Properties of the Isolated Diaphorase Fragment of the NAD+-Reducing [NiFe]-Hydrogenase from Ralstonia eutropha

    Science.gov (United States)

    Lauterbach, Lars; Idris, Zulkifli; Vincent, Kylie A.; Lenz, Oliver

    2011-01-01

    The NAD+-reducing soluble hydrogenase (SH) from Ralstonia eutropha H16 catalyzes the H2-driven reduction of NAD+, as well as reverse electron transfer from NADH to H+, in the presence of O2. It comprises six subunits, HoxHYFUI2, and incorporates a [NiFe] H+/H2 cycling catalytic centre, two non-covalently bound flavin mononucleotide (FMN) groups and an iron-sulfur cluster relay for electron transfer. This study provides the first characterization of the diaphorase sub-complex made up of HoxF and HoxU. Sequence comparisons with the closely related peripheral subunits of Complex I in combination with UV/Vis spectroscopy and the quantification of the metal and FMN content revealed that HoxFU accommodates a [2Fe2S] cluster, FMN and a series of [4Fe4S] clusters. Protein film electrochemistry (PFE) experiments show clear electrocatalytic activity for both NAD+ reduction and NADH oxidation with minimal overpotential relative to the potential of the NAD+/NADH couple. Michaelis-Menten constants of 56 µM and 197 µM were determined for NADH and NAD+, respectively. Catalysis in both directions is product inhibited with K I values of around 0.2 mM. In PFE experiments, the electrocatalytic current was unaffected by O2, however in aerobic solution assays, a moderate superoxide production rate of 54 nmol per mg of protein was observed, meaning that the formation of reactive oxygen species (ROS) observed for the native SH can be attributed mainly to HoxFU. The results are discussed in terms of their implications for aerobic functioning of the SH and possible control mechanism for the direction of catalysis. PMID:22016788

  15. Treatment of arsenic contaminated water in a batch reactor by using Ralstonia eutropha MTCC 2487 and granular activated carbon

    International Nuclear Information System (INIS)

    Mondal, P.; Majumder, C.B.; Mohanty, B.

    2008-01-01

    This paper presents the observations on the bio-removal of arsenic from contaminated water by using Ralstonia eutropha MTCC 2487 and activated carbon in a batch reactor. The effects of agitation time, pH, type of granular activated carbon (GAC) and initial arsenic concentration (As o ) on the % removal of arsenic have been discussed. Under the experimental conditions, optimum removal was obtained at the pH of 6-7 with agitation time of 100 h. The % removal of As(T) increased initially with the increase in As o and after attaining the maximum removal (∼86%) at the As o value of around 15 ppm, it started to decrease. Simultaneous adsorption bioaccumulation (SABA) was observed, when fresh GAC was used as supporting media for bacterial immobilization. In case of SABA, the % removal of As(III) was almost similar (only ∼1% more) to the additive values of individual removal of As(III) obtained by only adsorption and only bio-adsorption. However, for As(V) the % removal was less (∼8%) than the additive value of the individual % removals obtained by only adsorption and bio-adsorption. Percentage removal of Fe, Mn, Cu and Zn were 65.17%, 72.76%, 98.6% and 99.31%, respectively. Maximum regeneration (∼99.4%) of the used bio-adsorbent was achieved by the treatment with 5NH 2 SO 4 followed by 1N NaOH and 30% H 2 O 2 in HNO 3 . The fitness of the isotherms to predict the specific uptake for bio-adsorption/accumulation process has been found to decrease in the following order: Temkin isotherm > Langmuir isotherm > Freundlich isotherm. For the adsorption process with fresh GAC the corresponding order is Freundlich isotherm > Langmuir isotherm > Temkin isotherm for As(V) and As(T). However, for As(III) it was Langmuir > Temkin > Freundlich

  16. Production of fatty acids in Ralstonia eutropha H16 by engineering β-oxidation and carbon storage

    Science.gov (United States)

    Chen, Janice S.; Colón, Brendan; Dusel, Brendon; Ziesack, Marika; Torella, Joseph P.

    2015-01-01

    Ralstonia eutropha H16 is a facultatively autotrophic hydrogen-oxidizing bacterium capable of producing polyhydroxybutyrate (PHB)-based bioplastics. As PHB’s physical properties may be improved by incorporation of medium-chain-length fatty acids (MCFAs), and MCFAs are valuable on their own as fuel and chemical intermediates, we engineered R. eutropha for MCFA production. Expression of UcFatB2, a medium-chain-length-specific acyl-ACP thioesterase, resulted in production of 14 mg/L laurate in wild-type R. eutropha. Total fatty acid production (22 mg/L) could be increased up to 2.5-fold by knocking out PHB synthesis, a major sink for acetyl-CoA, or by knocking out the acyl-CoA ligase fadD3, an entry point for fatty acids into β-oxidation. As ΔfadD3 mutants still consumed laurate, and because the R. eutropha genome is predicted to encode over 50 acyl-CoA ligases, we employed RNA-Seq to identify acyl-CoA ligases upregulated during growth on laurate. Knockouts of the three most highly upregulated acyl-CoA ligases increased fatty acid yield significantly, with one strain (ΔA2794) producing up to 62 mg/L free fatty acid. This study demonstrates that homologous β-oxidation systems can be rationally engineered to enhance fatty acid production, a strategy that may be employed to increase yield for a range of fuels, chemicals, and PHB derivatives in R. eutropha. PMID:26664804

  17. Degradation of formaldehyde at high concentrations by phenol-adapted Ralstonia eutropha closely related to pink-pigmented facultative methylotrophs.

    Science.gov (United States)

    Habibi, Alireza; Vahabzadeh, Farzaneh

    2013-01-01

    The ability of the phenol-adapted Ralstonia eutropha to utilize formaldehyde (FD) as the sole source of carbon and energy was studied. Adaptation to FD was accomplished by substituting FD for glucose in a stepwise manner. The bacterium in the liquid test culture could tolerate concentrations of FD up to 900 mg L(-1). Degradation of FD was complete in 528 h at 30°C with shaking at 150 rpm (r = 1.67 mg L(-1) h(-1)), q = 0.035 g(FD) g(cell) (-1) h(-1). Substrate inhibition kinetics (Haldane and Luong equations) are used to describe the experimental data. At non-inhibitory concentrations of FD, the Monod equation was used. According to the Luong model, the values of the maximum specific growth rate (μ(max)), half-saturation coefficient (k(S)), the maximum allowable formaldehyde concentration (S(m)), and the shape factor (n) were 0.117 h(-1), 47.6 mg L(-1), 900 mg L(-1), and 2.2, respectively. The growth response of the test bacterium to consecutive FD feedings was examined, and the FD-adapted R. eutropha cells were able to degrade 1000 mg L(-1) FD in 150 h through 4 cycles of FD feeds. During FD degradation, formic acid metabolite was formed. Assimilation of FD, methanol, formic acid, and oxalate by the test bacterium was accompanied by the formation of a pink pigment. The carotenoid nature of the cellular pigment has been confirmed and the test bacterium appeared to be closely related to pink-pigmented facultative methylotrophs (PPFM). The extent of harm to soil exposed to biotreated wastewaters containing FD may be moderated due to the association between methylotrophic/oxalotrophic bacteria and plants.

  18. PhaM is the physiological activator of poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) in Ralstonia eutropha.

    Science.gov (United States)

    Pfeiffer, Daniel; Jendrossek, Dieter

    2014-01-01

    Poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) is the key enzyme of PHB synthesis in Ralstonia eutropha and other PHB-accumulating bacteria and catalyzes the polymerization of 3-hydroxybutyryl-CoA to PHB. Activity assays of R. eutropha PHB synthase are characterized by the presence of lag phases and by low specific activity. It is assumed that the lag phase is caused by the time necessary to convert the inactive PhaC1 monomer into the active dimeric form by an unknown priming process. The lag phase can be reduced by addition of nonionic detergents such as hecameg [6-O-(N-heptyl-carbamoyl)-methyl-α-D-glucopyranoside], which apparently accelerates the formation of PhaC1 dimers. We identified the PHB granule-associated protein (PGAP) PhaM as the natural primer (activator) of PHB synthase activity. PhaM was recently discovered as a novel type of PGAP with multiple functions in PHB metabolism. Addition of PhaM to PHB synthase assays resulted in immediate polymerization of 3HB coenzyme A with high specific activity and without a significant lag phase. The effect of PhaM on (i) PhaC1 activity, (ii) oligomerization of PhaC1, (iii) complex formation with PhaC1, and (iv) PHB granule formation in vitro and in vivo was shown by cross-linking experiments of purified proteins (PhaM, PhaC1) with glutardialdehyde, by size exclusion chromatography, and by fluorescence microscopic detection of de novo-synthesized PHB granules.

  19. Production of fatty acids in Ralstonia eutropha H16 by engineering β-oxidation and carbon storage

    Directory of Open Access Journals (Sweden)

    Janice S. Chen

    2015-12-01

    Full Text Available Ralstonia eutropha H16 is a facultatively autotrophic hydrogen-oxidizing bacterium capable of producing polyhydroxybutyrate (PHB-based bioplastics. As PHB’s physical properties may be improved by incorporation of medium-chain-length fatty acids (MCFAs, and MCFAs are valuable on their own as fuel and chemical intermediates, we engineered R. eutropha for MCFA production. Expression of UcFatB2, a medium-chain-length-specific acyl-ACP thioesterase, resulted in production of 14 mg/L laurate in wild-type R. eutropha. Total fatty acid production (22 mg/L could be increased up to 2.5-fold by knocking out PHB synthesis, a major sink for acetyl-CoA, or by knocking out the acyl-CoA ligase fadD3, an entry point for fatty acids into β-oxidation. As ΔfadD3 mutants still consumed laurate, and because the R. eutropha genome is predicted to encode over 50 acyl-CoA ligases, we employed RNA-Seq to identify acyl-CoA ligases upregulated during growth on laurate. Knockouts of the three most highly upregulated acyl-CoA ligases increased fatty acid yield significantly, with one strain (ΔA2794 producing up to 62 mg/L free fatty acid. This study demonstrates that homologous β-oxidation systems can be rationally engineered to enhance fatty acid production, a strategy that may be employed to increase yield for a range of fuels, chemicals, and PHB derivatives in R. eutropha.

  20. Comparative proteome analysis reveals four novel polyhydroxybutyrate (PHB) granule-associated proteins in Ralstonia eutropha H16.

    Science.gov (United States)

    Sznajder, Anna; Pfeiffer, Daniel; Jendrossek, Dieter

    2015-03-01

    Identification of proteins that were present in a polyhydroxybutyrate (PHB) granule fraction isolated from Ralstonia eutropha but absent in the soluble, membrane, and membrane-associated fractions revealed the presence of only 12 polypeptides with PHB-specific locations plus 4 previously known PHB-associated proteins with multiple locations. None of the previously postulated PHB depolymerase isoenzymes (PhaZa2 to PhaZa5, PhaZd1, and PhaZd2) and none of the two known 3-hydroxybutyrate oligomer hydrolases (PhaZb and PhaZc) were significantly present in isolated PHB granules. Four polypeptides were found that had not yet been identified in PHB granules. Three of the novel proteins are putative α/β-hydrolases, and two of those (A0671 and B1632) have a PHB synthase/depolymerase signature. The third novel protein (A0225) is a patatin-like phospholipase, a type of enzyme that has not been described for PHB granules of any PHB-accumulating species. No function has been ascribed to the fourth protein (A2001), but its encoding gene forms an operon with phaB2 (acetoacetyl-coenzyme A [CoA] reductase) and phaC2 (PHB synthase), and this is in line with a putative function in PHB metabolism. The localization of the four new proteins at the PHB granule surface was confirmed in vivo by fluorescence microscopy of constructed fusion proteins with enhanced yellow fluorescent protein (eYFP). Deletion of A0671 and B1632 had a minor but detectable effect on the PHB mobilization ability in the stationary growth phase of nutrient broth (NB)-gluconate cells, confirming the functional involvement of both proteins in PHB metabolism. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  1. Effects of environmental parameters on the dual-species biofilms formed by Escherichia coli O157:H7 and Ralstonia insidiosa, a strong biofilm producer isolated from a fresh-cut processing plant

    Science.gov (United States)

    Biofilm forming bacteria resident to food processing facilities are a food safety concern due to the potential of biofilms to harbor foodborne bacterial pathogens. When cultured together, Ralstonia insidiosa, a strong biofilm former frequently isolated from produce processing environments, has been ...

  2. Impact of Ralstonia eutropha's poly(3-Hydroxybutyrate) (PHB) Depolymerases and Phasins on PHB storage in recombinant Escherichia coli.

    Science.gov (United States)

    Eggers, Jessica; Steinbüchel, Alexander

    2014-12-01

    The model organism for polyhydroxybutyrate (PHB) biosynthesis, Ralstonia eutropha H16, possesses multiple isoenzymes of granules coating phasins as well as of PHB depolymerases, which degrade accumulated PHB under conditions of carbon limitation. In this study, recombinant Escherichia coli BL21(DE3) strains were used to study the impact of selected PHB depolymerases of R. eutropha H16 on the growth behavior and on the amount of accumulated PHB in the absence or presence of phasins. For this purpose, 20 recombinant E. coli BL21(DE3) strains were constructed, which harbored a plasmid carrying the phaCAB operon from R. eutropha H16 to ensure PHB synthesis and a second plasmid carrying different combinations of the genes encoding a phasin and a PHB depolymerase from R. eutropha H16. It is shown in this study that the growth behavior of the respective recombinant E. coli strains was barely affected by the overexpression of the phasin and PHB depolymerase genes. However, the impact on the PHB contents was significantly greater. The strains expressing the genes of the PHB depolymerases PhaZ1, PhaZ2, PhaZ3, and PhaZ7 showed 35% to 94% lower PHB contents after 30 h of cultivation than the control strain. The strain harboring phaZ7 reached by far the lowest content of accumulated PHB (only 2.0% [wt/wt] PHB of cell dry weight). Furthermore, coexpression of phasins in addition to the PHB depolymerases influenced the amount of PHB stored in cells of the respective strains. It was shown that the phasins PhaP1, PhaP2, and PhaP4 are not substitutable without an impact on the amount of stored PHB. In particular, the phasins PhaP2 and PhaP4 seemed to limit the degradation of PHB by the PHB depolymerases PhaZ2, PhaZ3, and PhaZ7, whereas almost no influence of the different phasins was observed if phaZ1 was coexpressed. This study represents an extensive analysis of the impact of PHB depolymerases and phasins on PHB accumulation and provides a deeper insight into the complex interplay

  3. Sonication contribution to identifying prosthetic joint infection with Ralstonia pickettii: a case report and review of the literature.

    Science.gov (United States)

    Birlutiu, Rares Mircea; Roman, Mihai Dan; Cismasiu, Razvan Silviu; Fleaca, Sorin Radu; Popa, Crina Maria; Mihalache, Manuela; Birlutiu, Victoria

    2017-07-19

    In the context of an increase number of primary and revision total hip and total knee arthroplasty performed yearly, an increased risk of complication is expected. Prosthetic joint infection (PJI) remains the most common and feared arthroplasty complication. Ralstonia pickettii is a Gram-negative bacterium, that has also been identified in biofilms. It remains an extremely rare cause of PJI. There is no report of an identification of R. pickettii on an extracted spacer loaded with antibiotic. We present the case of an 83-years-old Caucasian male patient, that underwent a right cemented total hip replacement surgery. The patient is diagnosed with an early PJI with no isolated microorganism. A debridement and change of mobile parts is performed. At the beginning of 2016, the patient in readmitted into the Orthopedic Department for sever, right abdominal and groin pain and elevated serum erythrocyte sedimentation rate and C-reactive protein. A joint aspiration is performed with a negative microbiological examination. A two-stage exchange with long interval management is adopted, and a preformed spacer loaded with gentamicin was implanted. In July 2016, based on the proinflammatory markers evolution, a shift a three-stage exchange strategy is decided. In September 2016, a debridement, and changing of the preformed spacer loaded with gentamicin with another was carried out. Bacteriological examination of the tissues sampled intraoperatively was positive for Pseudomonas aeruginosa. From the sonication fluid, no bacteria were isolated on culture or identified using the bbFISH assay. During the hospitalization period, the patient received i.v. ceftazidime 3x2g/day and p.o. ciprofloxacin 2x750mg/day, antibiotic therapy that was continued after discharge with p.o. ciprofloxacin 2x750mg/day for 6 weeks. In February 2017, a reimplantation of a revision prosthesis is performed. The retrieved spacer is sonicated, and after 4 days of incubation of the sonication fluid, R

  4. Celulitis por citomegalovirus

    Directory of Open Access Journals (Sweden)

    A. Ruiz Lascano

    2002-12-01

    Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.

  5. Use of Electrical Penetration Graph Technology to Examine Transmission of 'Candidatus Liberibacter solanacearum' to Potato by Three Haplotypes of Potato Psyllid (Bactericera cockerelli; Hemiptera: Triozidae.

    Directory of Open Access Journals (Sweden)

    Tariq Mustafa

    Full Text Available The potato psyllid, Bactericera cockerelli (Šulc (Hemiptera: Triozidae, is a vector of the phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso, the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern. All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato ("inoculation access period", or IAP to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in

  6. Engineering Ralstonia eutropha for Production of Isobutanol (IBT) Motor Fuel from Carbon Dioxide, Hydrogen, and Oxygen Project Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Sinskey, Anthony J. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Worden, Robert Mark [Michigan State Univ., East Lansing, MI (United States); Brigham, Christopher [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Lu, Jingnan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Quimby, John Westlake [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Gai, Claudia [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Speth, Daan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Elliott, Sean [Boston Univ., MA (United States); Fei, John Qiang [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Bernardi, Amanda [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Li, Sophia [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Grunwald, Stephan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Grousseau, Estelle [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Maiti, Soumen [Michigan State Univ., East Lansing, MI (United States); Liu, Chole [Michigan State Univ., East Lansing, MI (United States)

    2013-12-16

    This research project is a collaboration between the Sinskey laboratory at MIT and the Worden laboratory at Michigan State University. The goal of the project is to produce Isobutanol (IBT), a branched-chain alcohol that can serve as a drop-in transportation fuel, through the engineered microbial biosynthesis of Carbon Dioxide, Hydrogen, and Oxygen using a novel bioreactor. This final technical report presents the findings of both the biological engineering work at MIT that extended the native branched-chain amino acid pathway of the wild type Ralstonia eutropha H16 to perform this biosynthesis, as well as the unique design, modeling, and construction of a bioreactor for incompatible gasses at Michigan State that enabled the operational testing of the complete system. This 105 page technical report summarizing the three years of research includes 72 figures and 11 tables of findings. Ralstonia eutropha (also known as Cupriavidus necator) is a Gram-negative, facultatively chemolithoautotrophic bacteria. It has been the principle organism used for the study of polyhydroxybutyrate (PHB) polymer biosynthesis. The wild-type Ralstonia eutropha H16 produces PHB as an intracellular carbon storage material while under nutrient stress in the presence of excess carbon. Under this stress, it can accumulate approximately 80 % of its cell dry weight (CDW) as this intracellular polymer. With the restoration of the required nutrients, the cells are then able to catabolize this polymer. If extracted from the cell, this PHB polymer can be processed into biodegradable and biocompatible plastics, however for this research, it is the efficient metabolic pathway channeling the captured carbon that is of interest. R. eutropha is further unique in that it contains two carbon-fixation Calvin–Benson–Bassham cycle operons, two oxygen-tolerant hydrogenases, and several formate dehydrogenases. It has also been much studied for its ability in the presence of oxygen, to fix carbon dioxide

  7. Ralstonia eutropha's Poly(3-hydroxybutyrate)(PHB) polymerase PhaC1 and PHB depolymerase PhaZa1 are phosphorylated in vivo.

    Science.gov (United States)

    Jüngert, Janina R; Patterson, Cameron; Jendrossek, Dieter

    2018-04-20

    In this study, we screened PHB synthase PhaC1 and PHB depolymerase PhaZa1 of Ralstonia eutropha for the presence of phosphorylated residues during the PHB accumulation and PHB degradation phase. Thr373 of PHB synthase PhaC1 was phosphorylated in the stationary growth phase but was not modified in the exponential and PHB accumulation phases. Ser35 of PHB depolymerase PhaZa1 was identified in phosphorylated form both in the exponential and in the stationary growth phase. Additional phosphosites were identified for both proteins in sample-dependent forms. Site-directed mutagenesis of the codon for Thr373 and other phosphosites of PhaC1 revealed a strong negative impact on PHB synthase activity. Modification of Thr26 and Ser35 of PhaZa1 reduced the ability of R. eutropha to mobilize PHB in the stationary growth phase. Our results show that phosphorylation of PhaC1 and PhaZa1 can be important for modulation of the activities of PHB synthase and PHB depolymerase. Importance Polyhydroxybutyrate (PHB) and related polyhydroxyalkanoates (PHAs) are important intracellular carbon and energy storage compounds in many prokaryotes. The accumulation of PHB or PHAs increases the fitness of cells during periods of starvation and other stress conditions. The simultaneous presence of poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) and PHB depolymerase (PhaZa1) on synthesized PHB granules in Ralstonia eutropha (alternative designation Cupriavidus necator ) has been previously shown in several laboratories. These findings imply that the activities of PHB synthase and PHB depolymerase should be regulated to avoid a futile cycle of simultaneous synthesis and degradation of PHB. Here, we addressed this question by identifying phosphorylation sites on PhaC1 and PhaZa1 and by site-directed mutagenesis of identified residues. Furthermore, we conducted in vitro and in vivo analysis of PHB synthase activity and PHB contents. Copyright © 2018 American Society for Microbiology.

  8. Electrocardiografo por computadora

    OpenAIRE

    Tinoco Hernandez, Rosanna; Paredes Bejarano, Margarita; Romero Chaglia, Norman; Yapur Auad, Miguel Eduardo

    2009-01-01

    El presente trabajo trata sobrees el diseño y la implementación de un graficador de señales cardiacas por computadora, para lo cual diseñamos un circuito electrónico capaz de recibir la senal analógica proveniente de la actividad electrica del corazón , amplificarla, y luego convertirla en una señal digital para ser procesada por software y finalmente ser graficada, siendo posible así observar la señal cardiaca en el monitor de un computador como un tren de pulsos. Cabe destacar que par...

  9. Indice por Materias

    Directory of Open Access Journals (Sweden)

    Montoya H Luz Marina

    1982-09-01

    Full Text Available Un índice es una lista de palabras o frases indicadores asociados que permite la ubicación de material al interior de un libro o una publicación, en este caso será por el nombre de la materia.

  10. Apendicitis por Paracoccidioides brasiliensis

    Directory of Open Access Journals (Sweden)

    Ana Beatriz MUÑOZ URRIBARRI

    2006-01-01

    Full Text Available La paracoccidioidomicosis es la micosis más prevalente en Sudamérica. La forma aguda afecta el sistema fagocítico mononuclear de niños y personas inmunocomprometidas. El compromiso gastrointestinal es frecuente y su patogenia implica diseminación hematógena y linfática. La linfadenomegalia abdominal causa obstrucción intestinal y abdomen agudo. En este artículo damos a conocer el caso de un niño con compromiso gastrointestinal por apendicitis. Este es el primer caso reportado de apendicitis por esta patología. (Rev Med Hered 2006;17:58-60.

  11. [Physiological and biochemical characteristics and capacity for polyhydroxyalkanoates synthesis in a glucose-utilizing strain of hydrogen-oxidizing bacteria, Ralstonia eutropha B8562].

    Science.gov (United States)

    Volova, T G; Kozhevnikov, I V; Dolgopolova, Iu B; Trusova, M Iu; Kalacheva, G S; Aref'eva, Iu V

    2005-01-01

    The physiological, biochemical, genetic, and cultural characteristics of the glucose-utilizing mutant strain Ralstonia eutropha B8562 were investigated in comparison with the parent strain R. eutropha B5786. The morphological, cultural, and biochemical characteristics of strain R. eutropha B8562 were similar to those of strain R. eutropha B5786. Genetic analysis revealed differences between the 16S rRNA gene sequences of these strains. The growth characteristics of the mutant using glucose as the sole carbon and energy source were comparable with those of the parent strain grown on fructose. Strain B8562 was characterized by high yields of polyhydroxyalkanoate (PHA) from different carbon sources (CO2, fructose, and glucose). In batch culture with glucose under nitrogen limitation, PHA accumulation reached 90% of dry weight. In PHA, beta-hydroxybutyrate was predominant (over 99 mol %); beta-hydroxyvalerate (0.25-0.72 mol %) and beta-hydroxyhexanoate (0.008-1.5 mol %) were present as minor components. The strain has prospects as a PHA producer on glucose-containing media.

  12. Rapid selection of glucose-utilizing variants of the polyhydroxyalkanoate producer Ralstonia eutropha H16 by incubation with high substrate levels.

    Science.gov (United States)

    Franz, A; Rehner, R; Kienle, A; Grammel, H

    2012-01-01

    The application of Ralstonia eutropha H16 for producing polyhydroxyalkanoates as bioplastics is limited by the incapability of the bacterium to utilize glucose as a growth substrate. This study aims in characterizing glucose-utilizing strains that arose after incubation with high glucose levels, in comparison with previously published mutants, generated either by mutagenesis or by metabolic engineering. Cultivations on solid and liquid media showed that the application of high substrate concentrations rapidly induced a glucose-positive phenotype. The time span until the onset of growth and the frequency of glucose-utilizing colonies were correlated to the initial glucose concentration. All mutants exhibited elevated activities of glucose-6-phosphate dehydrogenase. The glucose-positive phenotype was abolished after deleting genes for the N-acetylglucosamine phosphotransferase system. A procedure is provided for selecting glucose-utilizing R. eutropha H16 in an unprecedented short time period and without any mutagenic treatment. An altered N-acetylglucosamine phosphotransferase system appears to be a common motif in all glucose-utilizing mutants examined so far. The correlation of the applied glucose concentration and the appearance of glucose-utilizing mutants poses questions about the randomness or the specificity of adaptive mutations in general. Furthermore, glucose-adapted strains of R. eutropha H16 could be useful for the production of bioplastics. © 2011 The Authors. Letters in Applied Microbiology ©2011 The Society for Applied Microbiology.

  13. Whole-Genome Microarray and Gene Deletion Studies Reveal Regulation of the Polyhydroxyalkanoate Production Cycle by the Stringent Response in Ralstonia eutropha H16

    Energy Technology Data Exchange (ETDEWEB)

    Brigham, CJ; Speth, DR; Rha, C; Sinskey, AJ

    2012-10-22

    Poly(3-hydroxybutyrate) (PHB) production and mobilization in Ralstonia eutropha are well studied, but in only a few instances has PHB production been explored in relation to other cellular processes. We examined the global gene expression of wild-type R. eutropha throughout the PHB cycle: growth on fructose, PHB production using fructose following ammonium depletion, and PHB utilization in the absence of exogenous carbon after ammonium was resupplied. Our results confirm or lend support to previously reported results regarding the expression of PHB-related genes and enzymes. Additionally, genes for many different cellular processes, such as DNA replication, cell division, and translation, are selectively repressed during PHB production. In contrast, the expression levels of genes under the control of the alternative sigma factor sigma(54) increase sharply during PHB production and are repressed again during PHB utilization. Global gene regulation during PHB production is strongly reminiscent of the gene expression pattern observed during the stringent response in other species. Furthermore, a ppGpp synthase deletion mutant did not show an accumulation of PHB, and the chemical induction of the stringent response with DL-norvaline caused an increased accumulation of PHB in the presence of ammonium. These results indicate that the stringent response is required for PHB accumulation in R. eutropha, helping to elucidate a thus-far-unknown physiological basis for this process.

  14. Apendicitis por Paracoccidioides brasiliensis.

    OpenAIRE

    MUÑOZ URRIBARRI, Ana Beatriz; CHAPARRO DAMMERT, Eduardo; FERRUFINO LLACH, Juan Carlos; VASQUEZ FLORES, Luciola

    2012-01-01

    La paracoccidioidomicosis es la micosis más prevalente en Sudamérica. La forma aguda afecta el sistema fagocítico mononuclear de niños y personas inmunocomprometidas. El compromiso gastrointestinal es frecuente y su patogenia implica diseminación hematógena y linfática. La linfadenomegalia abdominal causa obstrucción intestinal y abdomen agudo. En este artículo damos a conocer el caso de un niño con compromiso gastrointestinal por apendicitis. Este es el primer caso reportado de apendicitis p...

  15. Meningitis por Streptococcus suis

    OpenAIRE

    Geffner Sclarsky, D. E.; Moreno Muñoz, R.; Campillo Alpera, Mª.S.; Pardo Serrano, F.J.; Gómez Gómez, A.; Martínez-Lozano, Mª.D.

    2001-01-01

    La infección humana por Streptococcus suis (S. suis) es una zoonosis, con un riesgo ocupacional conocido y que suele presentarse como meningitis purulenta, que tiene baja mortalidad y frecuentes secuelas de hipoacusia y ataxia. Se han publicado menos de 150 casos humanos desde el informe original de hace 30 años. Hay una reconocida distribución geográfica viviendo la mayoría de los afectados en el norte de Europa y el sudeste Asiático. En España se han comunicado dos pacientes con enfermedad ...

  16. Por mil devaluados pesos

    Directory of Open Access Journals (Sweden)

    Annie Rodríguez Collázos

    2013-03-01

    Full Text Available El estudio de lo popular y lo urbano hasta ahora se ha centrado en el comportamiento y en algunas relaciones de los habitantes con su entorno. “Por mil devaluados pesos. Publicidad popular y urbana”, pretende explorar las formas de publicidad, dispersas en diferentes espacios populares y urbanos en Bogotá, identificando esquemas y formas características de sus propios códigos comunicativos; se centran en un objeto de estudio consistente en las estrategias publicitarias y los códigos comunicativos en los mensajes publicitarios populares en las subculturas de San Victorino, 7 de Agosto y Sanandresito de San José.

  17. Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture

    OpenAIRE

    ?lvarez, Bel?n; Biosca, Elena G.

    2017-01-01

    Bacterial wilt diseases caused by Ralstonia solanacearum, R. pseudosolanacearum, and R. syzygii subsp. indonesiensis (former R. solanacearum species complex) are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the a...

  18. Sepsis por shigella flexneri

    Directory of Open Access Journals (Sweden)

    César Cabrera C

    2005-04-01

    Full Text Available Se presenta un caso raro de sepsis por Shigella flexneri en una paciente de 45 años de edad quien estando hospitalizada para el estudio de un tumor cerebral, requirió el uso de manitol y dosis altas de corticoides; luego de ello presenta deposiciones líquidas con moco y sangre, desarrolla síndrome de respuesta inflamatoria sistémica, luego se aísla Shigella flexneri en el hemocultivo; recibió tratamiento antibiótico con ciprofloxacina. Se describen las características del caso y se comenta de acuerdo con la revisión de literatura.

  19. Portable exhausters POR-004 SKID B, POR-005 SKID C, POR-006 SKID D storage plan

    International Nuclear Information System (INIS)

    Nelson, O.D.; Keller, G.M.

    1997-01-01

    This document provides a storage plan for portable exhausters POR-004 SKID B, POR-005 SKID C, AND POR-006 SKID D. The exhausters will be stored until they are needed by the TWRS (Tank Waste Remediation Systems) Saltwell Pumping Program. The storage plan provides criteria for portable exhauster storage, periodic inspections during storage, and retrieval from storage

  20. Formation of a dinitrosyl iron complex by NorA, a nitric oxide-binding di-iron protein from Ralstonia eutropha H16.

    Science.gov (United States)

    Strube, Katja; de Vries, Simon; Cramm, Rainer

    2007-07-13

    In Ralstonia eutropha H16, two genes, norA and norB, form a dicistronic operon that is controlled by the NO-responsive transcriptional regulator NorR. NorB has been identified as a membrane-bound NO reductase, but the physiological function of NorA is unknown. We found that, in a NorA deletion mutant, the promoter activity of the norAB operon was increased 3-fold, indicating that NorA attenuates activation of NorR. NorA shows limited sequence similarity to the oxygen carrier hemerythrin, which contains a di-iron center. Indeed, optical and EPR spectroscopy of purified NorA revealed the presence of a di-iron center, which binds oxygen in a similar way as hemerythrin. Diferrous NorA binds two molecules of NO maximally. Unexpectedly, binding of NO to the diferrous NorA required an external reductant. Two different NorA-NO species could be resolved. A minor species (up to 20%) showed an S = (1/2) EPR signal with g( perpendicular) = 2.041, and g( parallel) = 2.018, typical of a paramagnetic dinitrosyl iron complex. The major species was EPR-silent, showing characteristic signals at 420 nm and 750 nm in the optical spectrum. This species is proposed to represent a novel dinitrosyl iron complex of the form Fe(2+)-[NO](2)(2-), i.e. NO is bound as NO(-). The NO binding capacity of NorA in conjunction with its high cytoplasmic concentration (20 mum) suggests that NorA regulates transcription by lowering the free cytoplasmic concentration of NO.

  1. Cometabolic degradation of ethyl mercaptan by phenol-utilizing Ralstonia eutropha in suspended growth and gas-recycling trickle-bed reactor.

    Science.gov (United States)

    Sedighi, Mahsa; Zamir, Seyed Morteza; Vahabzadeh, Farzaneh

    2016-01-01

    The degradability of ethyl mercaptan (EM), by phenol-utilizing cells of Ralstonia eutropha, in both suspended and immobilized culture systems, was investigated in the present study. Free-cells experiments conducted at EM concentrations ranging from 1.25 to 14.42 mg/l, showed almost complete removal of EM at concentrations below 10.08 mg/l, which is much higher than the maximum biodegradable EM concentration obtained in experiments that did not utilize phenol as the primary substrate, i.e. 2.5 mg/l. The first-order kinetic rate constant (kSKS) for EM biodegradation by the phenol-utilizing cells (1.7 l/g biomass/h) was about 10 times higher than by cells without phenol utilization. Immobilized-cells experiments performed in a gas recycling trickle-bed reactor packed with kissiris particles at EM concentrations ranging from 1.6 to 36.9 mg/l, showed complete removal at all tested concentrations in a much shorter time, compared with free cells. The first-order kinetic rate constant (rmaxKs) for EM utilization was 0.04 l/h for the immobilized system compared to 0.06 for the suspended-growth culture, due to external mass transfer diffusion. Diffusion limitation was decreased by increasing the recycling-liquid flow rate from 25 to 65 ml/min. The removed EM was almost completely mineralized according to TOC and sulfate measurements. Shut down and starvation experiments revealed that the reactor could effectively handle the starving conditions and was reliable for full-scale application. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Dihydrolipoamide Dehydrogenases of Advenella mimigardefordensis and Ralstonia eutropha Catalyze Cleavage of 3,3′-Dithiodipropionic Acid into 3-Mercaptopropionic Acid ▿ †

    Science.gov (United States)

    Wübbeler, Jan Hendrik; Raberg, Matthias; Brandt, Ulrike; Steinbüchel, Alexander

    2010-01-01

    The catabolism of the disulfide 3,3′-dithiodipropionic acid (DTDP) is initiated by the reduction of its disulfide bond. Three independent Tn5::mob-induced mutants of Advenella mimigardefordensis strain DPN7T were isolated that had lost the ability to utilize DTDP as the sole source of carbon and energy and that harbored the transposon insertions in three different sites of the same dihydrolipoamide dehydrogenase gene encoding the E3 subunit of the pyruvate dehydrogenase multi-enzyme complex of this bacterium (LpdAAm). LpdAAm was analyzed in silico and compared to homologous proteins, thereby revealing high similarities to the orthologue in Ralstonia eutropha H16 (PdhLRe). Both bacteria are able to cleave DTDP into two molecules of 3-mercaptopropionic acid (3MP). A. mimigardefordensis DPN7T converted 3MP to 3-sulfinopropionic acid, whereas R. eutropha H16 showed no growth with DTDP as the sole carbon source but was instead capable of synthesizing heteropolythioesters using the resulting cleavage product 3MP. Subsequently, the genes lpdAAm and pdhLRe were cloned, heterologously expressed in Escherichia coli applying the pET23a expression system, purified, and assayed by monitoring the oxidation of NADH. The physiological substrate lipoamide was reduced to dihydrolipoamide with specific activities of 1,833 mkat/kg of protein (LpdAAm) or 1,667 mkat/kg of protein (PdhLRe). Reduction of DTDP was also unequivocally detected with the purified enzymes, although the specific enzyme activities were much lower: 0.7 and 0.5 mkat/kg protein, respectively. PMID:20833784

  3. Abundance of dioxygenase genes similar to Ralstonia sp strain U2 nagAc is correlated with naphthalene concentrations in coal tar-contaminated freshwater sediments

    Energy Technology Data Exchange (ETDEWEB)

    Dionisi, H.M.; Chewning, C.S.; Morgan, K.H.; Menn, F.M.; Easter, J.P; Sayler, G.S. [University of Tennessee, Knoxville, TN (United States). Center for Environmental Biotechnology

    2004-07-01

    We designed a real-time PCR assay able to recognize dioxygenase large-subunit gene sequences with more than 90% similarity to the Ralstonia sp. strain U2 nagAc gene (nagAc-like gene sequences) in order to study the importance of organisms carrying these genes in the biodegradation of naphthalene. Sequencing of PCR products indicated that this real-time PCR assay was specific and able to detect a variety of nagAc-like gene sequences. One to 100 ng of contaminated-sediment total DNA in 25-{mu}l reaction mixtures produced an amplification efficiency of 0.97 without evident PCR inhibition. The assay was applied to surficial freshwater sediment samples obtained in or in close proximity to a coal tar-contaminated Superfund site. Naphthalene concentrations in the analyzed samples varied between 0.18 and 106 mg/kg of dry weight sediment. The assay for nagAc-like sequences indicated the presence of (4.1 {+-} 0.7) X 10{sup 3} to (2.9 {+-} 0.3) X 10{sup 5} copies of nagAc-like dioxygenase genes per mug of DNA extracted from sediment samples. These values corresponded to (1.2 {+-} 0.6) X 10{sup 5} to (5.4 {+-} 0.4) X 10{sup 7} copies of this target per g of dry weight sediment when losses of DNA during extraction were taken into account. There was a positive correlation between naphthalene concentrations and nagAc-like gene copies per microgram of DNA = 0.89) and per gram of dry weight sediment = 0.77). These results provide evidence of the ecological significance of organisms carrying nagAc-like genes in the biodegradation of naphthalene.

  4. Control Multivariable por Desacoplo

    Directory of Open Access Journals (Sweden)

    Fernando Morilla

    2013-01-01

    Full Text Available Resumen: La interacción entre variables es una característica inherente de los procesos multivariables, que dificulta su operación y el diseño de sus sistemas de control. Bajo el paradigma de Control por desacoplo se agrupan un conjunto de metodologías, que tradicionalmente han estado orientadas a eliminar o reducir la interacción, y que recientemente algunos investigadores han reorientado con objetivos de solucionar un problema tan complejo como es el control multivariable. Parte del material descrito en este artículo es bien conocido en el campo del control de procesos, pero la mayor parte de él son resultados de varios años de investigación de los autores en los que han primado la generalización del problema, la búsqueda de soluciones de fácil implementación y la combinación de bloques elementales de control PID. Esta conjunción de intereses provoca que no siempre se pueda conseguir un desacoplo perfecto, pero que sí se pueda conseguir una considerable reducción de la interacción en el nivel básico de la pirámide de control, en beneficio de otros sistemas de control que ocupan niveles jerárquicos superiores. El artículo resume todos los aspectos básicos del Control por desacoplo y su aplicación a dos procesos representativos: una planta experimental de cuatro tanques acoplados y un modelo 4×4 de un sistema experimental de calefacción, ventilación y aire acondicionado. Abstract: The interaction between variables is inherent in multivariable processes and this fact may complicate their operation and control system design. Under the paradigm of decoupling control, several methodologies that traditionally have been addressed to cancel or reduce the interactions are gathered. Recently, this approach has been reoriented by several researchers with the aim to solve such a complex problem as the multivariable control. Parts of the material in this work are well known in the process control field; however, most of them are

  5. Crystallization and preliminary X-ray diffraction studies of the catalytic domain of a novel chitinase, a member of GH family 23, from the moderately thermophilic bacterium Ralstonia sp. A-471

    International Nuclear Information System (INIS)

    Okazaki, Nobuo; Arimori, Takao; Nakazawa, Masami; Miyatake, Kazutaka; Ueda, Mitsuhiro; Tamada, Taro

    2011-01-01

    The catalytic domain of a novel chitinase, which is a member of GH family 23, from the moderately thermophilic bacterium Ralstonia sp. A-471 was crystallized and diffraction data were collected to 1.85 Å resolution. Chitinase from the moderately thermophilic bacterium Ralstonia sp. A-471 (Ra-ChiC) is divided into two domains: a chitin-binding domain (residues 36–80) and a catalytic domain (residues 103–252). Although the catalytic domain of Ra-ChiC has homology to goose-type lysozyme, Ra-ChiC does not show lysozyme activity but does show chitinase activity. The catalytic domain with part of an interdomain loop (Ra-ChiC 89–252 ) was crystallized under several different conditions using polyethylene glycol as a precipitant. The crystals diffracted to 1.85 Å resolution and belonged to space group P6 1 22 or P6 5 22, with unit-cell parameters a = b = 100, c = 243 Å. The calculated Matthews coefficient was approximately 3.2, 2.4 or 1.9 Å 3 Da −1 assuming the presence of three, four or five Ra-ChiC 89–252 molecules in the asymmetric unit, respectively

  6. Genome-scale reconstruction and in silico analysis of the Ralstonia eutropha H16 for polyhydroxyalkanoate synthesis, lithoautotrophic growth, and 2-methyl citric acid production

    Directory of Open Access Journals (Sweden)

    Kim Tae

    2011-06-01

    Full Text Available Abstract Background Ralstonia eutropha H16, found in both soil and water, is a Gram-negative lithoautotrophic bacterium that can utillize CO2 and H2 as its sources of carbon and energy in the absence of organic substrates. R. eutropha H16 can reach high cell densities either under lithoautotrophic or heterotrophic conditions, which makes it suitable for a number of biotechnological applications. It is the best known and most promising producer of polyhydroxyalkanoates (PHAs from various carbon substrates and is an environmentally important bacterium that can degrade aromatic compounds. In order to make R. eutropha H16 a more efficient and robust biofactory, system-wide metabolic engineering to improve its metabolic performance is essential. Thus, it is necessary to analyze its metabolic characteristics systematically and optimize the entire metabolic network at systems level. Results We present the lithoautotrophic genome-scale metabolic model of R. eutropha H16 based on the annotated genome with biochemical and physiological information. The stoichiometic model, RehMBEL1391, is composed of 1391 reactions including 229 transport reactions and 1171 metabolites. Constraints-based flux analyses were performed to refine and validate the genome-scale metabolic model under environmental and genetic perturbations. First, the lithoautotrophic growth characteristics of R. eutropha H16 were investigated under varying feeding ratios of gas mixture. Second, the genome-scale metabolic model was used to design the strategies for the production of poly[R-(--3hydroxybutyrate] (PHB under different pH values and carbon/nitrogen source uptake ratios. It was also used to analyze the metabolic characteristics of R. eutropha when the phosphofructokinase gene was expressed. Finally, in silico gene knockout simulations were performed to identify targets for metabolic engineering essential for the production of 2-methylcitric acid in R. eutropha H16. Conclusion The

  7. Porøse materialer

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place

    2000-01-01

    Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM).......Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM)....

  8. (SRAP) markers linked to bacterial wilt resistance genes i

    African Journals Online (AJOL)

    SAM

    2014-03-19

    Mar 19, 2014 ... Bacterial wilt caused by Ralstonia solanacearum is one of the most economically important diseases affecting potato (Solanum tuberosum). It is necessary to develop more molecular markers for potential use in potato genetic research. A highly resistant primitive cultivated species Solanum phureja was.

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. TRUPTI ASOLKAR. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 55-66 RESEARCH ARTICLE. Identification of virulence factors and type III effectors of phylotype I, Indian Ralstonia solanacearum strains Rs-09-161 and Rs-10-244 · TRUPTI ASOLKAR ...

  10. Nigerian Journal of Biotechnology - Vol 29 (2015)

    African Journals Online (AJOL)

    Isolation and Characterization of Ralstonia solanacearum Causing Bacterial Wilt of Tomato in Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AR Popoola, SA Ganiyu, OA Enikuomehin, JG Bodunde, OB Adedibu, HA Durosomo, OA Karunwi, 1 – 10.

  11. Antagonistic activity of Bacillus subtilis SB1 and its biocontrol effect on tomato bacterial wilt

    Science.gov (United States)

    A potential biocontrol agent of bacterial wilt, Bacillus subtilis SB1, isolated from tomato roots, showed a broad-spectrum of antimicrobial activity in in vitro experiments. It inhibited the growth of many plant pathogens, including Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, Fusarium ox...

  12. Assessment of transformability of bacteria associated with tomato and potato plants

    NARCIS (Netherlands)

    Overbeek, van L.S.; Ray, J.L.; Elsas, van J.D.

    2007-01-01

    Transformation of plant-associated bacteria by plant DNA has never been demonstrated in agricultural fields. In total 552 bacterial isolates from stems of Ralstonia solanacearum-infected and healthy tomato plants and from stems and leaves of healthy potato plants were tested for natural genetic

  13. Inheritance and identification of SCAR marker linked to bacterial wilt ...

    African Journals Online (AJOL)

    In the present work, the combinations (F1) were crossed between highly resistant and susceptible to bacterial wilt eggplant parents and its F2, BC1 segregation population plants were inoculated with race1 of Ralstonia solanacearum in greenhouse. In this paper, we reported that the inheritance of bacterial wilt resistance in ...

  14. Effect of selected essential oil plants on bacterial wilt disease ...

    African Journals Online (AJOL)

    Objective: Bacterial wilt disease caused by Ralstonia solanacearum is a major constrain to production of potatoes (Solanum tuberosum). Control of bacterial wilt is very difficult as there are no effective curative chemicals. This study was aimed at investigating the potential roles of essential oil plants in control of the disease.

  15. Identification and Chacterization of new strains of Enterobacter spp. causing Mulberry (Morus alba) wilt disease in China

    Science.gov (United States)

    A new mulberry wilt disease (MWD) was recently identified in Hangzhou, Zhejiang province, China. Typical symptoms of the disease are dark brown discolorations in vascular tissues, leaf wilt, defoliation, and tree decline. Unlike the bacterial wilt disease caused by Ralstonia solanacearum, the leaf w...

  16. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  17. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  18. NCBI nr-aa BLAST: CBRC-LAFR-01-2095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2095 ref|NP_519386.1| PROBABLE SN-GLYCEROL-3-PHOSPHATE TRANSMEMBRANE A...BC TRANSPORTER PROTEIN [Ralstonia solanacearum GMI1000] emb|CAD14967.1| probable sn-glycerol-3-phosphate transme

  19. Bruinrot bij aardappel

    NARCIS (Netherlands)

    Janse, J.D.; Bergsma-Vlami, M.M.; Wenneker, M.

    2009-01-01

    De quarantaineziekte bruinrot van aardappel, veroorzaakt door de bacterie Ralstonia (voorheen : Pseudomonas solanacearum) werd in Nederland voor het eerst met zekerheid aangetroffen in 1992. Het betrof een geïsoleerd geval in Zuid-Limburg, dat later verbonden bleek te zijn met een eerder opgetreden

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Cupriavidus taiwanensis str. LM... 34 4.1 AE015928_2526( AE015928 |pid:none) Bacteroides thetaiot...168 |pid:none) Ralstonia solanacearum strain I... 35 3.1 CU633749_1834( CU633749

  1. Improving cost-effectiveness of brown rot control: the value of bio-economic modelling

    NARCIS (Netherlands)

    Breukers, A.; Werf, van der W.; Mourits, M.C.M.; Oude Lansink, A.G.J.M.

    2007-01-01

    Since 1995, the Dutch potato production chain has been hit by several outbreaks of brown rot, a quarantine disease caused by Ralstonia solanacearum race 3, biovar 2. To avoid establishment of brown rot in the potato production chain and avert the consequences on potato export, the Dutch government

  2. Evaluation of edible ginger and turmeric cultivars for root-knot nematode resistance

    Science.gov (United States)

    Edible ginger and turmeric roots are important agricultural commodities for the State of Hawaii. Bacterial wilt, Ralstonia solanacearum, and root-knot nematodes, Meloidogyne spp. are major factors hindering optimum production. An evaluation of tolerance and resistance to M. incognita was undertake...

  3. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

  4. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  5. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

  6. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

  7. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

  8. Las cosas por su nombre

    OpenAIRE

    Storani, Emilia

    2017-01-01

    El artículo propone indagar sobre los modos y diferentes formatos que se utilizan tanto en la escritura como en la lectura, para articular con las luchas por la identidad de género. La Ley de Identidad de Género ha sido un puntapié clave para pensarnos a nosotros mismos culturalmente y para pensar a los demás. Pero, ¿cómo mencionamos, escribimos y leemos las diferentes identidades? La escritura, también es un mundo transformador para quienes bregan por una sociedad más libre y sin prejuicios....

  9. Ptose palpebral causada por Paquidermoperiostose

    Directory of Open Access Journals (Sweden)

    Patricia Regina de Pinho Tavares

    2014-08-01

    Full Text Available A paquidermoperiostose é uma síndrome caracterizada por acometimento cutâneo e ósseo, e em alguns casos ocorre comprometimento palpebral leve. É uma síndrome rara, idiopática ou hereditária, com provável herança autossômica dominante de penetrância variável. Descreve-se o caso de um paciente com ptose grave por paquidermoperiostose elucidando sua fisiopatologia e conduta cirúrgica aplicada.

  10. Diverticulitis yeyunal perforada por enterolito.

    OpenAIRE

    Marenco De la Cuadra, Beatriz; Gomez-Rosado, Juan-Carlos; Capitan-Morales, Luis-Cristobal; Valdés Hernández, Javier; Reyes-lopera, N.J. De los

    2012-01-01

    La diverticulosis yeyunal es una enfermedad adquirida rara. Casi el 60-70% keeps asymptomátic or Con síntomas crónicos inespecíficos, aunque puede presentarse como un abdomen agudo. La perforación debida a enterolitos es una causa extremadamente rara do complicación, y puede producirse por la impactación de ésta contra la pared intestinal. Presentamos caso de un varón de 82 años que acude a urgencias por un dolor súbito abdominal, difuso, con irritación peritoneal, leucocitosis con neutro...

  11. Mortalidad intrahospitalaria por accidente cerebrovascular

    OpenAIRE

    Federico Rodríguez Lucci; Virginia Pujol Lereis; Sebastián Ameriso; Guillermo Povedano; María F. Díaz; Alejandro Hlavnicka; Néstor A. Wainsztein; Sebastián F. Ameriso

    2013-01-01

    La mortalidad global por accidente cerebrovascular (ACV) ha disminuido en las últimas tres décadas, probablemente debido a un mejor control de los factores de riesgo vascular. La mortalidad hospitalaria por ACV ha sido tradicionalmente estimada entre 6 y 14% en la mayoría de las series comunicadas. Sin embargo, los datos de ensayos clínicos recientes sugieren que esta cifra sería sustancialmente menor. Se revisaron datos de pacientes internados con diagnóstico de ACV del Banco de Datos de Str...

  12. DESAJUSTE EDUCATIVO POR REGIONES EN COLOMBIA: ¿COMPETENCIA POR SALARIOS O POR PUESTOS DE TRABAJO?

    Directory of Open Access Journals (Sweden)

    Maribel Castillo Caicedo

    2007-06-01

    Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación, entendida como un desajuste por exceso, entre el nivel educativo alcanzado por el individuo y el exigido por el puesto de trabajo en el cual se desempeña; esto se debe a que existe una demanda laboral estrecha de puestos de trabajo para personas calificadas en Colombia. Se analizan las contribuciones empíricas existentes y el debate sobre las mismas; se examinan las teorías que permiten explicar la existencia de un desajuste educativo y se realiza una revisión de la literatura internacional y nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis para desarrollar un esquema que permita determinar el comportamiento del individuo en el fenómeno de la sobreeducación.

  13. Consanguinidad por isonimia en Salta

    Directory of Open Access Journals (Sweden)

    Albeza, María V.

    2007-01-01

    Full Text Available Se estimó el coeficiente de parentesco por isonimia para localidades de la Puna, Valle Calchaquí y Valle de Lerma, a fin de evaluar diferentes factores evolutivos que podrían estar afectando la composición genética de la población. A partir de los apellidos de las parejas consignadas en fuentes primarias de información, se estimó la isonimia conyugal o marital, el coeficiente total Ft y sus componentes Fr (inbreeding azaroso y Fn (inbreeding no azaroso. De las localidades estudiadas, en la Puna se ha detectado sólo una pareja isónima en una de ellas, en el Valle Calchaquí, tres y ninguna en el Valle de Lerma. Tanto en el Valle Calchaquí como en el de Lerma, se han estimado valores negativos de Ft, y en la Puna se registran los valores más elevados. En las localidades estudiadas no se cumple el supuesto de transmisión patrilineal de apellidos por lo que los valores de Fr y por ende de Ft podrían estar subestimados. Es por ello que sería necesario contar con información desde otras vertientes metodológicas para corroborar, complementar y manejar cuidadosamente el análisis de los datos y las conclusiones que se obtienen.

  14. Celulitis por citomegalovirus Cytomegalovirus cellulitis

    Directory of Open Access Journals (Sweden)

    A. Ruiz Lascano

    2002-12-01

    Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.Cutaneous lesions in CMV infection are rare, often a late manifestation of systemic infection, and usually herald a fatal course. A 70 year-old woman received a kidney transplantation one month before consulting and immunosuppressive therapy that included cyclosporine A and methylprednisone. She complained of fever, local pain in her right leg, and an erythematous and swelling plaque. She was treated with intravenous antibiotics without improvement. A skin biopsy was performed and the tissue obtained was sent for bacterial and fungal cultures as well as for histological examination. Cultures were negative. The biopsy showed CMV cytopathic changes. Immunoperoxidase staining was positive for CMV and polymerase chain reaction (PCR testing revealed CMV DNA. She was treated with ganciclovir with resolution of the lesion. CMV cellulitis is a rare cutaneous manifestation

  15. Esporotricosis diagnosticada por el laboratorio

    Directory of Open Access Journals (Sweden)

    Nelly Ordóñez

    1989-06-01

    Full Text Available De 1976 a 1989 se han diagnosticado 40 casos de esporotricosis en el laboratorio de Micología del Instituto Nacional de Salud. La enfermedad se presentó en pacientes entre 4 y 52 años y tuvo predilección por el sexo masculino: 35 de 40 (87,5%; las formas clínicas más frecuentes fueron la cutánea fija, 18 de 40 (45%, y la linfocutánea, 17 de 40 (42,5%, con localización mayor en miembros superiores, 18 de 40 (45%. El diagnóstico se estableció por el aislamiento del Sporothrix schenckii en 35 de 38 pacientes (92%; los otros dos pacientes se diagnosticaron empleando otras técnicas: inmunofluorescencia directa, intradermorreacción y aglutinación en tubo.

  16. Miasis cutanea por cordylobia anthropophaga

    Directory of Open Access Journals (Sweden)

    Alkorta Gurrutxaga Miriam

    2001-01-01

    Full Text Available El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ha efectuado una revisión de los casos de miasis cutáneas forunculoides importadas publicados en España, así como de la biología, patología, tratamiento y prevención de la miasis humana por Cordylobia anthropophaga. El caso referido, se caracterizó por la infestación con un número inusualmente elevado de larvas, no sospechándose su etiología hasta la fase final de la enfermedad. La emergencia continuada de larvas (se recogieron 91 generó en la paciente un estado de ansiedad importante. Finalmente, la eliminación de las larvas provocó una rápida mejoría de la paciente. Aunque los casos de miasis cutánea no tienen la gravedad de otras enfermedades importadas, su conocimiento es necesario desde el punto de vista preventivo, diagnóstico y terapeútico. Es importante proceder a la identificación morfológica de las larvas diferenciándolas de otro tipo de miasis con implicaciones terapéuticas diferentes.

  17. Abdome agudo por obstrução por ileobiliar

    Directory of Open Access Journals (Sweden)

    Márcia Cristina de Alencastro

    Full Text Available OBJETIVO: descrever a experiência na abordagem dos doentes com abdome agudo por obstrução por IB, desde o diagnóstico até o tratamento definitivo. MÉTODOS: estudo retrospectivo incluindo todos os casos de IB tratados em um período de 23 anos. De acordo com a abordagem cirúrgica realizada, os pacientes foram divididos em dois grupos (1 enterolitotomia com colecistectomia no segundo momento; e (2 enterolitotomia, colecistectomia e abordagem da fístula. RESULTADOS: Doze pacientes foram incluídos, sendo 11 mulheres (91,6%, com média de idade de 72,2 anos. Todos os pacientes apresentavam doenças associadas, principalmente hipertensão arterial sistêmica (75%. Dois pacientes não apresentavam sintomas significativos de obstrução intestinal. O diagnóstico de IB foi realizado em seis pacientes (50% antes da laparotomia. O grupo 1 foi constituído de oito pacientes e o grupo 2 de quatro, e a morbidade foi, respectivamente, 33,3% e 8,3%. A mortalidade foi 16,6% (um paciente de cada grupo. CONCLUSÃO: O manejo do IB deve ser individualizado. O tratamento da obstrução mediante remoção do cálculo biliar por enterotomia proximal é a escolha inicial para o tratamento do IB. A colecistectomia e a correção da fístula bilioentérica podem ser realizadas juntamente com a remoção do cálculo, no entanto, em pacientes com comorbidades significativas, esses procedimentos devem ser realizados posteriormente.

  18. Desajuste educativo por regiones en Colombia: ¿competencia por salarios o por puestos de trabajo?

    Directory of Open Access Journals (Sweden)

    Castillo Caicedo Maribel

    2007-08-01

    Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación,
    entendida como un desajuste por exceso, entre el nivel educativo alcanzado
    por el individuo y el exigido por el puesto de trabajo en el cual se
    desempeña; esto se debe a que existe una demanda laboral estrecha de
    puestos de trabajo para personas calificadas en Colombia. Se analizan las
    contribuciones empíricas existentes y el debate sobre las mismas; se
    examinan las teorías que permiten explicar la existencia de un desajuste
    educativo y se realiza una revisión de la literatura internacional y
    nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis
    para desarrollar un esquema que permita determinar el comportamiento
    del individuo en el fenómeno de la sobreeducación.

  19. Muerte materna por malaria grave por Plasmodium vivax

    Directory of Open Access Journals (Sweden)

    Nancy Arróspide

    Full Text Available Se presenta el caso de una mujer de 19 años con 29 semanas de gestación, procedente de Llumpe (Ancash con antecedentes de viajes a las localidades de Chanchamayo (Junín y Rinconada (Ancash. Ingresó al Hospital de Chacas (Ancash por presentar mal estado general, deshidratación, dificultad respiratoria, ictericia, sensación de alza térmica y dolor abdominal, tuvo reporte de: hemoparásitos 60% en frotis sanguíneo. Fue transferida al Hospital Ramos Guardia (Huaraz donde presentó mayor dificultad respiratoria, coluria, hematuria, disminución del débito urinario y reporte de Plasmodium (+, luego fue transferida al Hospital Cayetano Heredia (Lima donde ingresó a la Unidad de Cuidados Intensivos (UCI, con evolución a falla multiorgánica, óbito fetal y muerte materna. Se confirmó infección por Plasmodium vivax. Destacamos la importancia de mejorar nuestras capacidades de diagnóstico y manejo para brindar un tratamiento adecuado y oportuno.

  20. Miasis ocular por Oestrus ovis

    Directory of Open Access Journals (Sweden)

    María Beltrán F

    2006-01-01

    Full Text Available Se presentan tres casos de miasis ocular (dos adultos y un niñoprocedentes de zonas ganaderas de la provincia de Huaura,departamento de Lima,que acudieron al Hospital Regional de Huacho por presentar el ojo rojo,fotofobia, edema palpebral y sensación de cuerpo extraño;se extrajeron larvas adheridas al canto interno del ojo,las cuales se recibieron en el Instituto Nacional de Salud y fueron identificadas como Oestrus ovis .

  1. Hipoglucemia inducida por carcinoma adrenal

    Directory of Open Access Journals (Sweden)

    Jimena Soutelo

    2013-08-01

    Full Text Available El carcinoma suprarrenal es una neoplasia maligna infrecuente y de mal pronóstico. La presentación clínica más común es originada por la producción hormonal excesiva, mientras que el desarrollo de hipoglucemia sintomática es excepcional. Presentamos el caso de una mujer de 37 años que ingresó al hospital por síntomas de hipoglucemias graves, hipertensión arterial, hipopotasemia y amenorrea secundaria. En el laboratorio se halló hipoglucemia con insulina inhibida y niveles de andrógenos en rango tumoral. La tomografía computarizada (TC de abdomen y pelvis mostró voluminosa formación heterogénea de aspecto sólido sin plano de clivaje con respecto al parénquima hepático e intenso realce con contraste. Luego de la extirpación de la masa retroperitoneal, evolucionó con valores de glucemia y potasemia normales, estabilizó la presión arterial y recuperó los ciclos menstruales.

  2. La curiosidad por la naturaleza

    Directory of Open Access Journals (Sweden)

    José Vicente Rodríguez

    2016-07-01

    Full Text Available Esta actitud es un instrumento estratégico para estimular procesos de desarrollo realmente sostenibles, donde se aproveche la admiración que nos embarga al conocer y apreciar lo que nos rodea para responsablemente utilizar y conservar nuestros recursos naturales. Con esta reflexión deseo resaltar esa motivación de escudriñar lo desconocido, que fue también la virtud que propició el desarrollo de la personalidad de Francisco José de Caldas y Tenorio, uno de nuestros primeros y connotados sabios colombianos, y en cuyo honor se constituyó la revista de divulgación científica más importante del país, que en estos momentos cumple 76 años de existencia. Caldas tuvo curiosidad por todo lo que existía en su entorno; inicialmente en su natal Popayán, donde se maravilló por lo natural, lo que lo motivó y llevó más allá de su tierra a formar parte de la mayor empresa de exploración científica adelantada en ese entonces en territorio americano: la primera Expedición Botánica al nuevo Reino de Granada, de José Celestino Mutis.

  3. Mortalidad por meningitis por Pasteurella canis. Oportunidades de aprendizaje

    Directory of Open Access Journals (Sweden)

    Ana Rosa Ropero Vera

    2016-01-01

    Full Text Available La meningitis bacteriana es una enfermedad importante de distribución mundial, causa mayor y sustancial de mortalidad y morbilidad en países en desarrollo. La Organización Mundial de la Salud (OMS sostiene que la meningitis es una de las diez afecciones principales del ser humano y debe ser considerada como una emergencia infectológica; por eso es fundamental reconocer que esta enfermedad es causa de muerte en niños de todo el mundo, sin distinción de raza, nivel económico o sociocultural. Se realizó una investigación de caso en menor de 53 días de nacido, que cumplía con los criterios clínicos y de laboratorio compatible con meningitis bacteriana, con el propósito de analizar y fortalecer la toma de decisiones en salud pública por parte de la secretaría local de salud del municipio de Valledupar (Colombia. Entre los hallazgos se encontró antecedentes infecciosos en el menor, coloración de Gram y cultivo de LCR, en el que se identificó cocobacilos Gram negativos, que fueron aislados como agente causal Pasteurella canis. Este estudio pretende sensibilizar a los prestadores de salud para que cuenten con personal altamente capacitado para brindar tratamientos adecuados y prevenir complicaciones en la meningitis bacteriana en niños, y así disminuir la posibilidad de secuelas o muerte, tanto en pacientes con compromiso inmunológico o sin este.

  4. Mortalidad intrahospitalaria por accidente cerebrovascular

    Directory of Open Access Journals (Sweden)

    Federico Rodríguez Lucci

    2013-08-01

    Full Text Available La mortalidad global por accidente cerebrovascular (ACV ha disminuido en las últimas tres décadas, probablemente debido a un mejor control de los factores de riesgo vascular. La mortalidad hospitalaria por ACV ha sido tradicionalmente estimada entre 6 y 14% en la mayoría de las series comunicadas. Sin embargo, los datos de ensayos clínicos recientes sugieren que esta cifra sería sustancialmente menor. Se revisaron datos de pacientes internados con diagnóstico de ACV del Banco de Datos de Stroke de FLENI y los registros institucionales de mortalidad entre los años 2000 y 2010. Los subtipos de ACV isquémicos se clasificaron según criterios TOAST y los ACV hemorrágicos en hematomas intrapanquimatosos, hemorragias subaracnoideas aneurismáticas, malformaciones arteriovenosas y otros hematomas intraparenquimatosos. Se analizaron 1514 pacientes, 1079 (71% con ACV isquémico (grandes vasos 39%, cardioembólicos 27%, lacunares 9%, etiología indeterminada 14%, otras etiologías 11% y 435 (29% con ACV hemorrágico (intraparenquimatosos 27%, hemorragia subaracnoidea 30%, malformaciones arteriovenosas 25% y otros hematomas espontáneos 18%. Se registraron 38 muertes intrahospitalarias (17 ACV isquémicos y 21 ACV hemorrágicos, representando una mortalidad global del 2.5% (1.7% en ACV isquémicos y 4.8% en ACV hemorrágicos. No se registraron muertes asociadas al uso de fibrinolíticos endovenosos. La mortalidad intrahospitalaria en pacientes con ACV isquémico y hemorrágico en nuestro centro fue baja. El manejo en un centro dedicado a las enfermedades neurológicas y el enfoque multidisciplinario por personal médico y no médico entrenado en el cuidado de la enfermedad cerebrovascular podrían explicar, al menos en parte, estos resultados.

  5. Herida precordial por arma blanca

    OpenAIRE

    Marcelo F. Jiménez; Nuria Novoa; José Luis Aranda; Gonzalo Varela

    2005-01-01

    Varón de 42 años con esquizofrenia paranoide. Intento de suicidio con tres autolesiones por arma blanca (Fig. 1). Fue traído al hospital en estado consciente, taquicárdico, taquipneico y con tensión arterial (TA) de 140/90 mmHg. Fue trasladado al quirófano, donde se practicó una toracotomía axilar izquierda sin extraer el arma. Durante la intervención se apreciaron tres heridas incisas, dos no penetrantes, hemotórax de 150 ml, herida pericárdica de 4 cm, sin lesiones cardíacas. La hoja del ar...

  6. Miotoxicidade por organofosforados Organophosphate myotoxicity

    Directory of Open Access Journals (Sweden)

    Maria J. Cavaliere

    1996-06-01

    Full Text Available Os organofosforados são um grupo de compostos químicos amplamente utilizados em agropecuária como inseticidas, ocasionando intoxicações acidentais em animais e humanos, e mesmo sendo utilizados em tentativas de suicídio. A toxicidade desses produtos decorre sobretudo de insuficiência cárdio-respiratória por compromentimento do sistema nervoso autônomo. Sabe-se que alguns destes compostos induzem em animais de experimentação e em humanos, uma miopatia caracterizada por degeneração de células musculares, comprometendo sobretudo a musculatura respiratória. Baseado no fato de que este comprometimento contribui para a piora da função respiratória, propõe-se um protocolo de avaliação rotineira de miotoxicidade por compostos organofosforados, através de uma bateria mínima e suficiente de colorações e reações histoquímicas para quantificação da necrose muscular. Utilizaram-se como modelo experimental, grupos de ratos albinos (Wistar intoxicados com o organofosforado paraoxon, com e sem antídotos (atropina ou pralidoxima. Verificou-se nos grupos tratados com paraoxon e paraoxon mais atropina, necrose de fibras musculares no diafragma, que atingia em determinadas áreas até 15% das fibras. No grupo tratado com paraoxon mais pralidoxima, a necrose foi mínima, evidenciando o papel mioprotetor deste último antídoto.Organophosphates comprise a group of chemical compounds extensively used in farming as insecticides, which cause accidental poisoning in animals and men and are also used in suicide attempts. The toxicity of these compounds is due especially to the cardiac and respiratory impairment in consequence of autonomic nervous system disorders. However, it is known that some of these products induce a myopathy in experimental animals and humans. This myopathy is characterized by muscle cell degeneration, involving above all the respiratory muscles. Based on the fact that this involvement certainly enhances the

  7. Viabilidade de uso do híbrido Hawaii 7996 como porta-enxerto de cultivares comerciais de tomate Potential of Hawaii 7996 hybrid as rootstock for tomato cultivars

    Directory of Open Access Journals (Sweden)

    Suane Coutinho Cardoso

    2006-01-01

    Full Text Available A técnica de enxertia é utilizada em algumas hortaliças, principalmente em áreas infestadas, para atribuir resistência a patógenos do solo, minimizando as perdas de produção de cultivares suscetíveis. Este trabalho teve como objetivo avaliar o desenvolvimento e a produtividade de plantas de tomateiro enxertadas em híbrido, tido como resistente a Ralstonia solanacearum, em comparação a pés-francos. O experimento foi desenvolvido em viveiro (produção de mudas e enxertia e em céu aberto, no município de Cruz das Almas, Bahia, no período de outubro de 2003 a fevereiro de 2004. Utilizou-se o método de enxertia de fenda cheia, com o híbrido 'Hawaii 7996' como porta-enxerto e as cultivares Santa Clara, Santa Cruz Kada e Débora Plus, suscetíveis a R. solanacearum, como enxerto. O delineamento experimental foi em blocos ao acaso, com seis tratamentos (3 enxertados e 3 pés-francos, 5 repetições e 6 plantas por parcela útil. Avaliaram-se os caracteres: diâmetro do caule, altura da planta e da primeira inflorescência, distância entre inflorescências e produtividade comercial de frutos. O desenvolvimento das plantas, a produção total e a massa média dos frutos foram semelhantes para os tratamentos enxertados em relação a seus respectivos pés-francos e não houve incompatibilidade entre porta-enxerto e enxerto. A cultivar Santa Cruz Kada foi mais sensível às condições agroecológicas do município de Cruz das Almas, refletindo negativamente na produção e no peso médio dos frutos. Observou-se na enxertia com o híbrido 'Hawaii 7996' potencial para viabilizar a produção de tomateiros comerciais suscetíveis à murcha bacteriana, em áreas infestadas com R. solanacearum.Grafts have been used in horticultural crops, to overcome soilborne plant pathogens, and thus minimize yield losses of susceptible cultivars. This work aimed at to evaluate growth and yield of tomato plants grafted on to a hybrid resistant to Ralstonia

  8. Herida precordial por arma blanca

    Directory of Open Access Journals (Sweden)

    Marcelo F. Jiménez

    2005-04-01

    Full Text Available Varón de 42 años con esquizofrenia paranoide. Intento de suicidio con tres autolesiones por arma blanca (Fig. 1. Fue traído al hospital en estado consciente, taquicárdico, taquipneico y con tensión arterial (TA de 140/90 mmHg. Fue trasladado al quirófano, donde se practicó una toracotomía axilar izquierda sin extraer el arma. Durante la intervención se apreciaron tres heridas incisas, dos no penetrantes, hemotórax de 150 ml, herida pericárdica de 4 cm, sin lesiones cardíacas. La hoja del arma blanca penetraba a través del diafragma produciendo una herida incisa en el lóbulo hepático izquierdo (Fig. 2. Se extrajo el arma y se suturó la laceración hepática. El paciente fue trasladado el cuarto día a la Unidad de Psiquiatría.

  9. por láser

    Directory of Open Access Journals (Sweden)

    Mayra Garcimuño

    2013-01-01

    Full Text Available En el presente trabajo, la técnica Espectroscopia de plasmas producidos por láser (Laser-induced breakdown spectroscopy –LIBS– se aplicó a la determinación cuan- titativa de Na en agua natural dulce, de interés en agricultura para el estudio de la alcalinidad de aguas de regadío. Para efectuar el análisis, se prepararon soluciones con concentraciones conocidas del analito, se mezclaron con óxido de calcio y se compactaron en pastillas sólidas. Los plasmas se produjeron en aire a presión atmos- férica utilizando un láser pulsado Nd:YAG. Se construyó una curva de calibración y se calculó el límite de detección. Se analizaron muestras de agua natural y los resultados se compararon con los obtenidos mediante espectroscopia de absorción atómica. Se demostró la factibilidad del método para la determinación de Na en agua natural dulce.

  10. Osteomalacia inducida por tumor: hemangiopericitoma rinosinusal

    Directory of Open Access Journals (Sweden)

    Enriqueta M. Serafini

    2013-02-01

    Full Text Available La osteomalacia inducida por tumor es una rara enfermedad del metabolismo óseo caracterizada por el aumento en la excreción de fosfato a nivel renal seguido de hipofosfatemia. Es causada por agentes fosfatúricos producidos por determinados tumores. La resección total del tumor resulta en la completa reversión de las anormalidades bioquímicas, la desaparición de las manifestaciones clínicas y los hallazgos en los estudios por imágenes. Presentamos el caso de un varón de 61 años con cuadro clínico y laboratorio compatibles con osteomalacia oncogénica inducida por tumor mesenquimático de localización rinosinusal. En nuestro caso el diagnóstico histológico correspondió a una neoplasia de tipo vascular: hemangiopericitoma.

  11. Casipoemas por Navidad : (1969-2010)

    OpenAIRE

    Sena Medina, Guillermo

    2011-01-01

    PRESENTACIÓN AL AIRE DE LA POESÍA RELIGIOSA Y NAVIDEÑA DE GUILLERMO SENA MEDINA Constituye un gran honor hacer la presentación de Guillermo Sena Medina por un doble motivo; por la larga y sincera amistad que nos une desde hace muchos años al socaire de nuestra común afición por la Historia, como cronistas oficiales de nuestros municipios; y, sobre todo y particularmente, por su rica y profunda personalidad como hombre de letras, nacida de su aún más rica y profunda personalidad humana. A...

  12. Identification of a multifunctional protein, PhaM, that determines number, surface to volume ratio, subcellular localization and distribution to daughter cells of poly(3-hydroxybutyrate), PHB, granules in Ralstonia eutropha H16.

    Science.gov (United States)

    Pfeiffer, Daniel; Wahl, Andreas; Jendrossek, Dieter

    2011-11-01

    A two-hybrid approach was applied to screen for proteins with the ability to interact with PHB synthase (PhaC1) of Ralstonia eutropha. The H16_A0141 gene (phaM) was identified in the majority of positive clones. PhaM (26.6 kDa) strongly interacted with PhaC1 and with phasin PhaP5 but not with PhaP1 or other PHB granule-associated proteins. A ΔphaM mutant accumulated only one or two large PHB granules instead of three to six medium-sized PHB granules of the wild type, and distribution of granules to daughter cells was disordered. All three phenotypes (number, size and distribution of PHB granules) were reversed by reintroduction of phaM. Purified PhaM revealed DNA-binding properties in gel mobility shift experiments. Expression of a fusion of the yellow fluorescent protein (eYfp) with PhaM resulted in formation of many small fluorescent granules that were bound to the nucleoid region. Remarkably, an eYfp-PhaP5 fusion localized at the cell poles in a PHB-negative background and overexpression of eYfp-PhaP5 in the wild type conferred binding of PHB granules to the cell poles. In conclusion, subcellular localization of PHB granules in R. eutropha depends on a concerted expression of at least three PHB granule-associated proteins, namely PhaM, PhaP5 and PHB synthase PhaC1. © 2011 Blackwell Publishing Ltd.

  13. Hematoquecia letal por angiostrongilosis abdominal

    Directory of Open Access Journals (Sweden)

    Gerzain Rodríguez

    2000-06-01

    Full Text Available Una niña indigena de 4 años de edad, procedente de Carurú, Vaupés, un municipio semiselvático de 2.000 habitantes, presentó hematoquecia repetida con sincope y muerte 4 días después, a pesar de recibir transfusiones sanguíneas. El estudio postmortem descubrió dos masas de 3-4 cm de diámetro en el ileon distal que, al microscopio, correspondieron a inflamación severa de toda la pared intestinal, rica en eosinofilos y en granulomas con células gigantes que circunscribian y fagocitaban huevos y larvas de Angiostrongylus costaricensis, helminto situado también dentro de las arterias de la submucosa, vasos que presentaban engrosamiento de la intima y focos con inflamación granulomatosa con eosinófilos. La niña no presentó leucocitosis ni eosinofilia. Este es el segundo caso de angiostrongilosis de esta región. El primero fue el de una mujer indigena de 34 años también con hematoquecia anemizante. La angiostrongilosis abdominal se diagnosticó por primera vez en Colombia en 1979, en un niño de 5 años, de Dagua, Valle. La niña aquí presentada es el sexto paciente con esta entidad en Colombia. La hematoquecia como manifestación predominante de la angiostrongilosis es extraordinaria para una enfermedad parasitaria; se ha registrado solamente en tres ocasiones anteriores. La abundancia de cristales de Charcot-Leyden, que se tiñen muy bien con la coloración de Ziehl-Neelsen o de Fite-Faraco, en los infiltrados de la pared intestinal. sugiere que su búsqueda en las heces puede ser una ayuda en el diagnóstico de casos sospechosos. pues, los huevos y las larvas no se eliminan en las heces y el diagnóstico definitivo de la angiostrongilosis es histopatológico. Revisamos las caracteristicas clinicas, parasitológicas e histopatológicas de esta parasitosis que será más prevalente en Colombia a medida que los médicos. especialmente los patólogos, la conozcan mejor.

  14. Encefalopatía por priones

    Directory of Open Access Journals (Sweden)

    Carlos Colegial

    1999-01-01

    Full Text Available Las encefalopatías espongiformes por priones son enfermedades neurodegenerativas que pueden ser esporádicas o transmisibles, ya sea por mecanismos infecciosos o hereditarios. Su investigación ha planteado enormes retos y en el recorrido histórico en busca de su causa dos médicos han recibido el premio Nobel de Medicina: Carleton Gajdusek, por sus trabajos en Nueva Guinea donde describió la transmisión infecciosa por ritos canibalísticos, que llevó a estudios de transmisión experimental en chimpancés y a su teoría de los "virus lentos" (por el largo período de incubación de la enfermedad.

  15. Portable exhauster POR-007/Skid E and POR-008/Skid F storage plan

    International Nuclear Information System (INIS)

    Nelson, O.D.

    1998-01-01

    This document provides storage requirements for 1,000 CFM portable exhausters POR-O07/Skid E and POR-008/Skid F. These requirements are presented in three parts: preparation for storage, storage maintenance and testing, and retrieval from storage. The exhauster component identification numbers listed in this document contain the prefix POR-007 or POR-008 depending on which exhauster is being used

  16. Verdad por definición

    OpenAIRE

    Garrido Garrido, Julián

    1997-01-01

    Not available.La verdad por definición es un tipo peculiar de verdad científica, distinguible de las verdades lógicas, matemáticas y empíricas. La definición, por su parte, designa diversos procedimientos de asignación de significado, cuyas diferencias exigen una adjetivación cuidadosa: definiciones ostensivas y operacionales, definiciones de diccionario y definiciones teóricas. Pero sólo las del último tipo son verdaderas por definición. En el presente artículo se precisa el concepto formal ...

  17. Síndrome de Munchausen por mandato

    OpenAIRE

    Esteban, Miguel A.; Pérez, Miriam R.; Bracco, Anahí

    2006-01-01

    El Síndrome de Munchausen por mandato, "un trastorno ficticio, por el cual la enfermedad del niño es inducida, promovida o provocada por la persona más próxima a él, generalmente su madre", es todavía mal conocido y su génesis imperfectamente comprendida. Esta comunicación está destinada a esclarecer al pediatra esta patología, con elevada morbilidad y secuelas, como así también de altísima mo...

  18. La pintura vista por un pintor joven

    Directory of Open Access Journals (Sweden)

    Fuentes Pozo, Pedro

    2000-01-01

    Full Text Available Not available

    El pintor se define a lo largo del tiempo como un artista en mutación influenciado por la sociedad de su momento y por su propio mundo interior Esto ha contribuido a la creación de distintos estilos pictóricos y a una evolución que conlleva la despreocupación por el aspecto formal en aras de una introspección al mundo interior En el cambio constante se refleja la búsqueda del artista que valida la intemporalidad del arte. Así, el verdadero artista sobrevive al aplauso o rechazo de la crítica, convirtiéndose en un verdadero hombre renancentista preocupado por el hallazgo del conocimiento universal.

  19. 14 Nobel, preocupados por el CERN

    CERN Multimedia

    Rivera, A

    2003-01-01

    "E l presidente del Consejo del CERN (Laboratorio Europeo de Fisica de Particulas, junto a Ginebra), Maurice Bourquin, ha recibido una carta firmada por un grupo de cientificos muy especiales: 14 premios Nobel de Fisica" (1 page).

  20. Micetoma por Nocardia brasiliensis: reporte de caso

    Directory of Open Access Journals (Sweden)

    Miriam Guevara R

    2003-07-01

    Full Text Available Se presenta el caso de un paciente peruano, agricultor, con una infección cutánea de origen traumático causada por Nocardia brasiliensis, que evolucionó hacia la amputación del miembro inferior afectado. El diagnóstico se realizó por examen directo y cultivo del espécimen.

  1. Relationships within the Proteobacteria of plant pathogenic Acidovorax species and subspecies, Burkholderia species, and Herbaspirillum rubrisubalbicans by sequence analysis of 16S rDNA, numerical analysis and determinative tests.

    Science.gov (United States)

    Hu, F P; Young, J M; Triggs, C M; Park, D C; Saul, D J

    2001-12-01

    Sequence data for 16S rDNA of the type strains of Acidovorax avenae subsp. avenae, A. avenae subsp. cattleyae, A. avenae subsp. citrulli, A. konjaci and Herbaspirillum rubrisubalbicans were compared with GenBank library accessions of Burkholderia spp., Comamonas sp., Ralstonia solanacearum and Variovorax sp. Maximum Parsimony analysis produced two clusters: 1. Acidovorax spp., Comamonas sp., and Variovorax sp. (all in the Comamonadaceae), and 2. Burkholderia spp., Ralstonia solanacearum, and Herbaspirillum rubrisubalbicans. Maximum Likelihood analysis produced only one cluster (of the Comamonadaceae). Using nutritional and laboratory tests, all Acidovorax spp., Burkholderia spp., and Herbaspirillum rubrisubalbicans were discriminated in distinct clusters at the species level, and could be identified by selected determinative tests. There were no phenotypic tests constituted as a circumscription of the genera and which permitted the allocation of strains to genera. Strain identification as species allowed allocation to genera only by inference. The nomenclatural implications of these data are discussed.

  2. Tatuaje por amalgama. Reporte de un caso

    Directory of Open Access Journals (Sweden)

    Luis Fang Mercado

    2012-01-01

    Full Text Available El tatuaje por amalgama se origina por el depósito en el tejido conectivo subepitelial de fragmentos de amalgama resultado de procedimientos iatrogénicos por parte del operador. La profundidad a la que se encuentren albergados los residuos de este material influye en la presentación clínica de las lesiones. Radiográficamente se pueden identificar los fragmentos mientras tengan diámetros razonables; histológicamente se pueden observar las partículas de amalgama como gránulos oscuros, sólidos e irregulares dispuesto entre los haces de colágeno y vasos sanguíneos. Este artículo refiere el caso clínico de un paciente que presentó pigmentación por amalgama en mucosa vestibular, originada por una porción de amalgama usada como material obturador en una apicectomía del 11 realizada con anterioridad. Teniendo en cuenta las consideraciones clínicas y radiográficas se optó por realizar una segunda apicectomía con obturación retrógrada con MTA del 11. Durante el procedimiento quirúrgico se cureteó y adelgazó la cara interna del colgajo mucoperióstico para tratar de disminuir el grado de pigmentación.

  3. Localization of poly(3-hydroxybutyrate) (PHB) granule-associated proteins during PHB granule formation and identification of two new phasins, PhaP6 and PhaP7, in Ralstonia eutropha H16.

    Science.gov (United States)

    Pfeiffer, Daniel; Jendrossek, Dieter

    2012-11-01

    Poly(3-hydroxybutyrate) (PHB) granules are covered by a surface layer consisting of mainly phasins and other PHB granule-associated proteins (PGAPs). Phasins are small amphiphilic proteins that determine the number and size of accumulated PHB granules. Five phasin proteins (PhaP1 to PhaP5) are known for Ralstonia eutropha. In this study, we identified three additional potential phasin genes (H16_B1988, H16_B2296, and H16_B2326) by inspection of the R. eutropha genome for sequences with "phasin 2 motifs." To determine whether the corresponding proteins represent true PGAPs, fusions with eYFP (enhanced yellow fluorescent protein) were constructed. Similar fusions of eYFP with PhaP1 to PhaP5 as well as fusions with PHB synthase (PhaC1), an inactive PhaC1 variant (PhaC1-C319A), and PhaC2 were also made. All fusions were investigated in wild-type and PHB-negative backgrounds. Colocalization with PHB granules was found for all PhaC variants and for PhaP1 to PhaP5. Additionally, eYFP fusions with H16_B1988 and H16_B2326 colocalized with PHB. Fusions of H16_B2296 with eYFP, however, did not colocalize with PHB granules but did colocalize with the nucleoid region. Notably, all fusions (except H16_B2296) were soluble in a ΔphaC1 strain. These data confirm that H16_B1988 and H16_B2326 but not H16_B2296 encode true PGAPs, for which we propose the designation PhaP6 (H16_B1988) and PhaP7 (H16_B2326). When localization of phasins was investigated at different stages of PHB accumulation, fusions of PhaP6 and PhaP7 were soluble in the first 3 h under PHB-permissive conditions, although PHB granules appeared after 10 min. At later time points, the fusions colocalized with PHB. Remarkably, PHB granules of strains expressing eYFP fusions with PhaP5, PhaP6, or PhaP7 localized predominantly near the cell poles or in the area of future septum formation. This phenomenon was not observed for the other PGAPs (PhaP1 to PhaP4, PhaC1, PhaC1-C319A, and PhaC2) and indicated that some phasins

  4. Evolution of NADPH-cytochrome P450 oxidoreductases (POR) in Apiales - POR 1 is missing

    DEFF Research Database (Denmark)

    Andersen, Trine Bundgaard; Hansen, Niels Bjørn; Laursen, Tomas

    2016-01-01

    The NADPH-dependent cytochrome P450 oxidoreductase (POR) is the obligate electron donor to eukaryotic microsomal cytochromes P450 enzymes. The number of PORs within plant species is limited to one to four isoforms, with the most common being two PORs per plant. These enzymes provide electrons to ...... (available from the SRA at NCBI). All three genes were shown to be functional upon reconstitution into nanodiscs, confirming that none of the isoforms are pseudogenes....

  5. Biological Control of Bacterial Wilt in South East Asia

    OpenAIRE

    Arwiyanto, Triwidodo

    2014-01-01

    Bacterial wilt disease caused by Ralstonia solanacearum destroys many crops of different plant families in South East Asia despite many researches about the disease, and the availability of developed control method in other parts of the world. There is no chemical available for the bacterial wilt pathogen and biological control is then chosen as an alternative to save the crops. Most of the biological control studies were based on antagonism between biological control agent and the pathogen. ...

  6. Effects of Biochar Amendment on Tomato Bacterial Wilt Resistance and Soil Microbial Amount and Activity

    Directory of Open Access Journals (Sweden)

    Yang Lu

    2016-01-01

    Full Text Available Bacterial wilt is a serious soilborne disease of Solanaceae crops which is caused by Ralstonia solanacearum. The important role of biochar in enhancing disease resistance in plants has been verified; however, the underlying mechanism remains not fully understood. In this study, two different biochars, made from peanut shell (BC1 and wheat straw (BC2, were added to Ralstonia solanacearum-infected soil to explore the interrelation among biochar, tomato bacterial wilt, and soil microbial properties. The results showed that both BC1 and BC2 treatments significantly reduced the disease index of bacterial wilt by 28.6% and 65.7%, respectively. The populations of R. solanacearum in soil were also significantly decreased by biochar application. Ralstonia solanacearum infection significantly reduced the densities of soil bacteria and actinomycetes and increased the ratio of soil fungi/bacteria in the soil. By contrast, BC1 and BC2 addition to pathogen-infected soil significantly increased the densities of soil bacteria and actinomycetes but decreased the density of fungi and the ratios of soil fungi/bacteria and fungi/actinomycetes. Biochar treatments also increased soil neutral phosphatase and urease activity. Furthermore, higher metabolic capabilities of microorganisms by biochar application were found at 96 and 144 h in Biolog EcoPlates. These results suggest that both peanut and wheat biochar amendments were effective in inhibiting tomato bacterial wilt caused by R. solanacearum. The results suggest a relationship between the disease resistance of the plants and the changes in soil microbial population densities and activity.

  7. Acuerdo por la discreción

    Directory of Open Access Journals (Sweden)

    Yeny Serrano

    2006-01-01

    Full Text Available En este artículo se propone un análisis del texto del Acuerdo por la discreción firmado en 1999 por 32 directores de medios de comunicación para “elevar el nivel de calidad y responsabilidad en el cubrimiento y difusión de hechos violentos”. Se analizan los factores que impiden que este Acuerdo produzca cambios efectivos en la práctica profesional informativa y se presenta un modelo (Lemieux, 2000 que tiene en cuenta las variables que influyen en la producción del discurso informativo mediático.

  8. ANTIOXIDANTES: MICRONUTRIENTES EN LUCHA POR LA SALUD

    OpenAIRE

    Zamora S, Juan Diego

    2007-01-01

    Los antioxidantes son sustancias químicas que se caracterizan por impedir o retrasar la oxidación de diversas sustancias principalmente de los ácidos grasos cuyas reacciones se producen tanto en los alimentos como en el organismo humano, en el cual puede provocar alteraciones fisiológicas importantes desencadenantes de diversas enfermedades. Otra de las funciones de los antioxidantes es facilitar el uso fisiológico del oxígeno por parte de las mitocondrias celulares, ayudando a reducir los ef...

  9. Alarma activada por control remoto selectivo.

    OpenAIRE

    Eguíluz Morán, Luis Ignacio; Lara Santillán, Pedro María; Mañana Canteli, Mario

    1995-01-01

    La finalidad de esta invención consiste en disponer de una alarma que bien evite el robo de objetos ligeros y portátiles por el procedimiento que se conoce como "del tirón" --es decir, arrebatar algo y salir corriendo--, bien permita identificar un equipaje entre otros. La originalidad del dispositivo reside en la activación/desactivación del dispositivo de sonido por control remoto, así como la posibilidad de seleccionar el sonido de salida dependiendo de su finalidad. Se reivindica como de ...

  10. PANORAMA LATINOAMERICANO DEL PAGO POR SERVICIOS AMBIENTALES

    Directory of Open Access Journals (Sweden)

    González T. Ángela

    2008-07-01

    Full Text Available Este documento busca proveer al lector de algunos elementos para el análisis y reflexión en torno al pago por servicios ambientales. Para ello, en primera instancia, aborda algunos conceptos básicos relacionados con economía ambiental, seguido de temas como la valoración económica de servicios ambientales y la implementación de mecanismos de pago por algunos de ellos. Lo anterior esta enriquecido con experiencias o estudios de caso a nivel latinoamericano y colombiano.

  11. Biological and biochemical studies on irradiated potato tubers

    International Nuclear Information System (INIS)

    Salem, E.A.F.M

    2008-01-01

    The present investigation aimed to study and overcome two important diseases which attacks potato plant, using some chemical and physical treatments. The first disease was pre harvest brown rot caused by ralstonia solanacearum and the second was post harvest dry rot caused by fusarium oxysporum. The results are summarized as follows: firstly brown rot : 1- Foliar treatment of salicylic acid or calcium chloride on potato plants leads to increasing in plant height and number of potato tubers, since salicylic acid give the highest value of plant height and also calcium chloride give the highest number of potato tubers. Also, this treatment leads to insignificant decreasing in number of potato tubers infected by brown rot. 2- The bacteria ralstonia solanacearum isolated from infected tubers obtained from the project of brown rot, Ministry of agriculture, Egypt, added with irrigate water to the pots this bacteria could infect healthy potato plant and the symptoms of brown rot observed on tubers also pathogenicity test was carried out using seedling of tomato cultivar Gs plants and wilting of tomato plant observed after 10-15 days from injection with R.solanacearum. 3- Concerning D 10 -value determined from the relation between dose rate of gamma ray (k-rad) and log count of bacterial number it was found that the D 10 -value for R.solanacearum was 0.25 kGy

  12. Tamanho do tubérculo-semente de batata não interfere na manifestação da murcha bacteriana Potato seed tuber size does not interfere with the incidence of potato bacterial wilt

    Directory of Open Access Journals (Sweden)

    Carlos A Lopes

    2011-06-01

    Full Text Available A batata-semente é comercializada no Brasil em diferentes tamanhos, conforme determinação do MAPA, variando do tipo 0 (zero, com tubérculos acima de 60 mm, até o tipo V, com tubérculos menores que 23 mm. Neste trabalho, foi avaliado o efeito do tamanho do tubérculo da batata-semente na manifestação da murcha bacteriana nas cultivares Agata, BRS Ana, Asterix e Bintje, em campo naturalmente infestado com Ralstonia solanacearum, em Brasília-DF. Foram usados tubérculos pequenos, médios e grandes, com aproximadamente 30, 50 e 90 mm em média, tamanhos correspondentes respectivamente aos tipos IV, II e 0 das normas do MAPA. Diferenças significativas quanto à incidência da doença foram encontradas entre cultivares: BRS Ana e Asterix não diferiram entre si e foram mais resistentes que Agata e Bintje que, por sua vez, tampouco diferiram entre si. As diferenças entre tamanhos de tubérculos e as interações entre cultivar e tamanho de tubérculos não foram significativas. Portanto concluiu-se que o tamanho de tubérculos dentro dos limites avaliados neste trabalho, não interferiu na manifestação da doença em testes de avaliação para resistência à murcha bacteriana.Potato seed tubers in Brazil are commercialized in different sizes as determined by the Ministry of Agriculture, Livestock and Food Supply. The sizes are classified in types, which vary from type 0 (zero, tubers above 60 mm, up to type V, tubers below 23 mm. In this work, we evaluated the influence of seed tuber size on the incidence of bacterial wilt on cultivars Agata, BRS Ana, Asterix, and Bintje, grown in a field naturally infested with Ralstonia solanacearum, in Brasilia, Brazil. We used small, medium and large tubers, measuring in average 30, 50 and 90 mm, which correspond respectively to types IV, II and 0 according to the Brazilian legislation. Significant differences in bacterial wilt incidences were detected among cultivars: BRS Ana and Asterix did not

  13. Fontes de resistência à murcha bacteriana em germoplasma de Capsicum spp. do estado do Amazonas Sources of resistance against bacterial wilt in Capsicum spp. germoplasm of the Amazonas state

    Directory of Open Access Journals (Sweden)

    Liane Cristine Rebouças Demosthenes

    2011-01-01

    Full Text Available A murcha bacteriana, causada por Ralstonia solanacearum, é uma das doenças mais importantes do gênero Capsicum no Brasil. No Amazonas, as condições de elevada temperatura e umidade favorecem o desenvolvimento da doença. O objetivo deste trabalho foi avaliar a resistência à murcha bacteriana de germoplasma, selvagem e comercial, de Capsicum spp. Foram avaliados 22 acessos de Capsicum em casa de vegetação. A inoculação foi feita mediante ferimento das raízes, seguido de adição no solo, ao redor das plantas, de suspensão bacteriana na concentração de 10(8 ufc mL-1. A avaliação foi feita diariamente a partir do quarto dia após a inoculação, em função desenvolvimento dos sintomas. A partir das médias de progresso dos sintomas foi construída a área abaixo da curva de progresso da doença (AACPD, e os dados submetidos ao teste de Scott-Knott ao nível de 5% de probabilidade, utilizando o programa estatístico SAEG 9.1. Foram selecionados os acessos 30, 20 e 17, da espécie C. chinense, como resistentes à murcha bacteriana para ensaios futuros em programas de melhoramento genético.The bacterial wilt caused by Ralstonia solanacearum is one of the most important in the genus Capsicum in Brazil. In the state of Amazonas, high temperatures and humidity favor the development of the disease. The objective of this work was to evaluate resistance in germoplasm of wild and commercial Capsicum spp. to bacterial wilt. Twenty two accesses of Capsicum spp. were evaluated in greenhouse conditions. The inoculation was made by means of wounds in the roots, followed by addition of bacterial suspension in the concentration of 10(8 ufc ml-1 in the soil, around the plants. Plant evaluation was made daily after the fourth day of the inoculation (DAI considering the symptoms progress. From the average progress of symptoms was constructed the area under the disease progress curve (AUDPC, and the data submitted to the Scott-Knott test at 5% of

  14. Pedro Teixeira y su viaje por Mesopotamia

    Directory of Open Access Journals (Sweden)

    Fuente del Pilar, José Javier

    2005-04-01

    Full Text Available Pedro Teixeira es un integrante notable de la ilustre nómina de los viajeros portugueses que, a finales del s, XVI y principios del XVII, ensancharon para Occidente las fronteras del mundo. Su conocimiento en España se debe a la publicación en 1994 de su obra «Relaciones del Origen, Descendencia y Sucesión de los Reyes de Persia, y de Harmuz, y de un viaje hecho por el autor dende la India hasta Italia por tierra», en edición realizada por el profesor Eduardo Barajas Sala, lamentablemente fallecido en 1997. En este artículo se ofrece una reseña biográfica de Pedro Teixeira, y un análisis del viaje narrado por el autor en la última parte de sus «Relaciones »: el que desde Ormuz le conducirá, a través de Mesopotamia, hasta la costa del Mediterráneo.…

  15. Conservación por calor

    OpenAIRE

    Cobos García, Angel; Díaz Rubio, Olga

    2011-01-01

    Esta unidade didáctica denominada Conservación por calor forma parte da materia «Tecnoloxía do procesado de alimentos» que se impartirá no primeiro semestre do 2º curso do Grao en Nutrición Humana e Dietética. A materia estrutúrase en diferentes unidades didácticas, tratando cada unha delas as diferentes tecnoloxías de procesado dos alimentos, tanto de conservación coma de transformación. A presente unidade didáctica aborda a conservación dos alimentos por calor. Este método permite destruír ...

  16. Celulitis por cuerpo extraño

    Directory of Open Access Journals (Sweden)

    Miguel B. Carrasco Guzmán

    2016-01-01

    Full Text Available Las infecciones de la piel y el tejido celular subcutáneo surgen como un grupo importante de afecciones con una alta morbilidad en edades pediátricas, generalmente relacionada con traumatismo y cuerpos extraños. Se presenta el caso de una escolar femenina de 6 años de edad, con síntomas y signos clínicos que sugieren celulitis en el muslo derecho,  por su evolución tórpida se le realizó el estudio ultrasonográfico que confirmó el diagnóstico etiológico de una celulitis secundaria a un traumatismo, provocada por la introducción de un gran cuerpo extraño, que pasó inadvertido para a familia de la menor.

  17. MIASIS CUTÁNEA POR CORDYLOBIA ANTHROPOPHAGA

    Directory of Open Access Journals (Sweden)

    Miriam Alkorta Gurrutxaga

    2001-01-01

    Full Text Available El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ha efectuado una revisión de los casos de miasis cutáneas forunculoides importadas publicados en España, así como de la biología, patología, tratamiento y prevención de la miasis humana por Cordylobia anthropophaga. El caso referido, se caracterizó por la infestación con un número inusualmente elevado de larvas, no sospechándose su etiología hasta la fase final de la enfermedad. La emergencia continuada de larvas (se recogieron 91 generó en la paciente un estado de ansiedad importante. Finalmente, la eliminación de las larvas provocó una rápida mejoría de la paciente. Aunque los casos de miasis cutánea no tienen la gravedad de otras enfermedades importadas, su conocimiento es necesario desde el punto de vista preventivo, diagnóstico y terapeútico. Es importante proceder a la identificación morfológica de las larvas diferenciándolas de otro tipo de miasis con implicaciones terapéuticas diferentes.

  18. Compostos antimicrobianos produzidos por Streptomyces Spp.

    OpenAIRE

    Silva, Ingrid Reis da

    2012-01-01

    O aumento crescente de bact?rias resistentes a antibi?ticos incentiva ? pesquisa por novas subst?ncias antibacterianas. Diante disso, a sele??o de microrganismos com potencial para a produ??o de novos compostos antimicrobianos tem sido amplamente estudada. Dentre estes microrganismos uma especial aten??o ? dada aos actinomicetos que apresentam capacidade de produzir uma variedade de compostos bioativos como antibi?ticos, antif?ngicos, antitumorais entre outros compostos que pod...

  19. Amar por cartas - este inferno de amara

    Directory of Open Access Journals (Sweden)

    Matildes Demetrio dos Santos

    1999-10-01

    Full Text Available Este trabalho tem por objetivo estudar o amor nas Folhas caídas e nas Cartas de amor à Viscondessa da Luz, de Almeida Garrett.Seus poemas cheios de erotismo e sensua lidade, inspirados numa mulher casada, Rosa Montúrar Infante, escandalizaram a sociedade portuguesado sécu lo XIX. Suas cartas de amor, em segredo, criavam uma ficção de características místicas.

  20. Por un humor ético

    Directory of Open Access Journals (Sweden)

    Victor Paramo Valero

    2016-04-01

    Full Text Available Ética del humor es una obra original, abundantemente documentada, de contenido científico y filosófico, que aborda un problema de gran importancia en los actuales estudios de éticas aplicadas. La ética del humor es una nueva ética aplicada que pretende comprender el fenómeno del humor a la luz de sus implicaciones éticas. Como señala el autor, Juan Carlos Siurana, reputado experto en el ámbito de la filosofía práctica, el interés por el humor es un interés por la ética. En la obra no presenta una nueva teoría filosófica del humor –las cuales se han venido sucediendo, al menos, desde los Diálogos de Platón–, sino una nueva teoría ética, que toma al humor como objeto principal de análisis. Por tanto, la finalidad es realizar una aportación dentro del ámbito de la ética. Para ello se nutre de distintos estudios psicológicos, biológicos, fisiológicos y neurológicos sobre el humor, así como de clásicas obras de filosofía que han abordado esta cuestión.

  1. El aprendizaje visto por los estudiantes venezolanos

    Directory of Open Access Journals (Sweden)

    Berta Elena Barrios

    2015-01-01

    Full Text Available En el siguiente trabajo se presentan los resultados de un estudio sobre las con-cepciones del aprendizaje de un grupo de estudiantes venezolanos de educa-ción primaria y media. Se trató de replicar el instrumento y procedimiento deanálisis utilizado por los investigadores Berry y Sahlberg (1996, con el objetivode caracterizar cómo conciben el aprendizaje estudiantes venezolanos entre 11y 15 años de edad y compararlo con sus pares ingleses y finlandeses. El análi-sis de resultados se basó en los criterios propuestos por dichos autores, deno-minados Pasos para un Buen Aprendizaje. Los hallazgos indican que los estu-diantes venezolanos conciben el aprendizaje como memorizar conocimientos,básicamente escolares, enseñados por los docentes. Las concepciones deambas poblaciones se ubican en una visión pasiva del aprendizaje. Se discutela vinculación de las concepciones del aprendizaje con las prácticas de la escuela.

  2. Eritema multiforme mayor desencadenado por antimicrobianos

    Directory of Open Access Journals (Sweden)

    Ronaldo de Carvalho Raimundo

    2010-03-01

    Full Text Available El eritema multiforme, aparece como una enfermedad sistémica con la participación de la piel y las membranas mucosas en relación con varios factores como las infecciones bacterianas o virales, y en particular la administración de drogas, analgésicos y antibióticos en general. Se presenta un paciente masculino de 29 años de edad con eritema multiforme mayor desencadenado por antimicrobianos con la aparición de lesiones vesiculares-bulloso-ulcerosas en las regiones de los labios, encías, la lengua y la mucosa genital en tratamiento de una infección del tracto urinario con norfloxacino 400 mg por una semana. Fue realizado un tratamiento de soporte con el uso de colutorios para la higienización bucal y pomada a base de corticoide para protección de las úlceras, antihistamínicos y orientación nutricional de dieta líquida hipercalórica e hiperproteica. Este síndrome está caracterizado como un proceso eruptivo buloso agudo que compromete la calidad de vida del paciente y no hay pruebas de laboratorio específicas por lo que su diagnóstico debe estar basado en la revisión minuciosa de la anamnesis y en los hallazgos clínicos.

  3. Bacterial Wilt in China: History, Current Status, and Future Perspectives

    Science.gov (United States)

    Jiang, Gaofei; Wei, Zhong; Xu, Jin; Chen, Huilan; Zhang, Yong; She, Xiaoman; Macho, Alberto P.; Ding, Wei; Liao, Boshou

    2017-01-01

    Bacterial wilt caused by plant pathogenic Ralstonia spp. is one of the most important diseases affecting the production of many important crops worldwide. In China, a large scientific community has been dedicated to studying bacterial wilt and its causative agent, Ralstonia pseudosolanacearum and R. solanacearum. Most of their work was published in Chinese, which has hindered international communication and collaboration in this field. In this review, we summarize the status of knowledge on geographical distribution, diversity, and host range of Ralstonia spp., as well as, the impact of bacterial wilt on important crops and disease control approaches, in China. We present areas of research and publications by Chinese scientists and propose the promotion of collaborative research within China and with the international community. PMID:28955350

  4. Structural Insights into the PorK and PorN Components of the Porphyromonas gingivalis Type IX Secretion System.

    Science.gov (United States)

    Gorasia, Dhana G; Veith, Paul D; Hanssen, Eric G; Glew, Michelle D; Sato, Keiko; Yukitake, Hideharu; Nakayama, Koji; Reynolds, Eric C

    2016-08-01

    The type IX secretion system (T9SS) has been recently discovered and is specific to Bacteroidetes species. Porphyromonas gingivalis, a keystone pathogen for periodontitis, utilizes the T9SS to transport many proteins including the gingipain virulence factors across the outer membrane and attach them to the cell surface via a sortase-like mechanism. At least 11 proteins have been identified as components of the T9SS including PorK, PorL, PorM, PorN and PorP, however the precise roles of most of these proteins have not been elucidated and the structural organization of these components is unknown. In this study, we purified PorK and PorN complexes from P. gingivalis and using electron microscopy we have shown that PorN and the PorK lipoprotein interact to form a 50 nm diameter ring-shaped structure containing approximately 32-36 subunits of each protein. The formation of these rings was dependent on both PorK and PorN, but was independent of PorL, PorM and PorP. PorL and PorM were found to form a separate stable complex. PorK and PorN were protected from proteinase K cleavage when present in undisrupted cells, but were rapidly degraded when the cells were lysed, which together with bioinformatic analyses suggests that these proteins are exposed in the periplasm and anchored to the outer membrane via the PorK lipid. Chemical cross-linking and mass spectrometry analyses confirmed the interaction between PorK and PorN and further revealed that they interact with the PG0189 outer membrane protein. Furthermore, we established that PorN was required for the stable expression of PorK, PorL and PorM. Collectively, these results suggest that the ring-shaped PorK/N complex may form part of the secretion channel of the T9SS. This is the first report showing the structural organization of any T9SS component.

  5. Structural Insights into the PorK and PorN Components of the Porphyromonas gingivalis Type IX Secretion System.

    Directory of Open Access Journals (Sweden)

    Dhana G Gorasia

    2016-08-01

    Full Text Available The type IX secretion system (T9SS has been recently discovered and is specific to Bacteroidetes species. Porphyromonas gingivalis, a keystone pathogen for periodontitis, utilizes the T9SS to transport many proteins including the gingipain virulence factors across the outer membrane and attach them to the cell surface via a sortase-like mechanism. At least 11 proteins have been identified as components of the T9SS including PorK, PorL, PorM, PorN and PorP, however the precise roles of most of these proteins have not been elucidated and the structural organization of these components is unknown. In this study, we purified PorK and PorN complexes from P. gingivalis and using electron microscopy we have shown that PorN and the PorK lipoprotein interact to form a 50 nm diameter ring-shaped structure containing approximately 32-36 subunits of each protein. The formation of these rings was dependent on both PorK and PorN, but was independent of PorL, PorM and PorP. PorL and PorM were found to form a separate stable complex. PorK and PorN were protected from proteinase K cleavage when present in undisrupted cells, but were rapidly degraded when the cells were lysed, which together with bioinformatic analyses suggests that these proteins are exposed in the periplasm and anchored to the outer membrane via the PorK lipid. Chemical cross-linking and mass spectrometry analyses confirmed the interaction between PorK and PorN and further revealed that they interact with the PG0189 outer membrane protein. Furthermore, we established that PorN was required for the stable expression of PorK, PorL and PorM. Collectively, these results suggest that the ring-shaped PorK/N complex may form part of the secretion channel of the T9SS. This is the first report showing the structural organization of any T9SS component.

  6. Simultaneous Detection of Brown Rot- and Soft Rot-Causing Bacterial Pathogens from Potato Tubers Through Multiplex PCR.

    Science.gov (United States)

    Ranjan, R K; Singh, Dinesh; Baranwal, V K

    2016-11-01

    Ralstonia solanacearum (Smith) Yabuuchi et al. and Erwinia carotovora subsp. carotovora (Jones) Bergey et al. (Pectobacterium carotovorum subsp. carotovorum) are the two major bacterial pathogens of potato causing brown rot (wilt) and soft rot diseases, respectively, in the field and during storage. Reliable and early detection of these pathogens are keys to avoid occurrence of these diseases in potato crops and reduce yield loss. In the present study, multiplex polymerase chain reaction (PCR) protocol was developed for simultaneous detection of R. solanacearum and E. carotovora subsp. carotovora from potato tubers. A set of oligos targeting the pectatelyase (pel) gene of E. carotovora subsp. carotovora and the universal primers based on 16S r RNA gene of R. solanacearum were used. The standardized multiplex PCR protocol could detect R. solanacearum and E. carotovora subsp. carotovora up to 0.01 and 1.0 ng of genomic DNA, respectively. The protocol was further validated on 96 stored potato tuber samples, collected from different potato-growing states of India, viz. Uttarakhand, Odisha, Meghalaya and Delhi. 53.1 % tuber samples were positive for R. solanacearum, and 15.1 % of samples were positive for E. carotovora subsp. carotovora, and both the pathogens were positive in 26.0 % samples when BIO-PCR was used. This method offers sensitive, specific, reliable and fast detection of two major bacterial pathogens from potato tubers simultaneously, particularly pathogen-free seed certification in large scale.

  7. Vasculitis inducida por metimazol: Reporte de caso

    Directory of Open Access Journals (Sweden)

    Miguel Pinto

    2011-07-01

    Full Text Available Se reporta el caso de una paciente con enfermedad de Graves, que presentó vasculitis asociada al uso de metimazol. Mujer de 14 años, que acudió a consulta por presentar intolerancia al calor, tremor distal y palpitaciones. El examen físico mostró bocio difuso, y el perfil tiroideo, TSH suprimida y hormonas tiroideas elevadas. Los anticuerpos antiperoxidasa tiroidea fueron positivos. Se inició tratamiento con metimazol y beta bloqueadores. Después de 20 días, la paciente regresó por presentar malestar general, fiebre, poliartralgia, lesiones cutáneas maculopapulares y edema de miembros inferiores. Los anticuerpos antinucleares fueron negativos y los anticuerpos anticitoplasma de los neutrófilos (ANCA, positivos. Se suspendió el metimazol y se inició prednisona. Después de 10 días de tratamiento, las molestias desaparecieron y la paciente recibió I 131.Las vasculitis asociadas al uso de tionamidas son poco frecuentes, no dependen de la dosis y están asociadas a la presencia de anticuerpos tipo ANCA. Clásicamente, afectan a los vasos pequeños de la piel; sin embargo, también pueden afectar los riñones y pulmones. El cuadro clínico se caracteriza por artralgias y mialgias. En algunos casos puede ocurrir insuficiencia renal de grado variable. En la mayoría de casos, el cuadro remite con la suspensión de la droga; pero, en algunos se requiere el uso de glucocorticoides o inmunosupresores.(Rev Med Hered 2011;22:147-150.

  8. Cefaleia por uso excessivo de medicamentos

    Directory of Open Access Journals (Sweden)

    Ariane Maria Fonseca MIRANDA

    2015-01-01

    Full Text Available Uma variante da cefaleia crônica diária, a cefaleia por uso excessivo de medicamentos é uma manifestação clínica de frequência ≥ 15 dias por mês, durante 3 meses. Possui um diagnóstico deficiente e um tratamento dividido em etapas, sendo a desintoxicação, a etapa de fundamental importância. Este artigo apresenta uma revisão sobre o tema, contribuindo para o esclarecimento das principais manifestações clínicas, principais teorias envolvendo sua fisiopatologia e a terapêutica farmacológica empregada. A metodologia utilizada foi uma revisão de publicações europeias e americanas, no período de 2001 a 2013, nos idiomas português, inglês e espanhol. Todos os medicamentos utilizados no tratamento sintomático das cefaleias são capazes de cronificar uma cefaleia preexistente, desde que sejam utilizados excessivamente, de forma regular e continuada. A suspensão de tais agentes terapêuticos resultará em melhoria na maioria dos pacientes, porém pode ser necessária a introdução de uma terapia de suporte de transição e/ou terapia profilática. Os tratamentos nao farmacológicos, quando associados ao farmacológico, ampliam a possibilidade de resultados satisfatórios, evitando recaídas.

  9. Intoxicación por Superwarfarinas

    OpenAIRE

    Patricia Crecente Otero; Jorge Luis Torres Triana; Ronald Macías Casanova; Luis Manuel Sánchez Rodríguez

    2012-01-01

    Las denominadas superwarfarinas se desarrollaron a partir de la década de 1970 como solución a las resistencias que habían desarrollado los roedores a los raticidas hasta entonces existentes1. Sus principales ventajas son su mayor potencia (hasta 100 veces más potentes que la warfarina)2 y el disponer de una semivida más larga (hasta 6-8 semanas). Presentamos el caso de un paciente varón que ingresa en nuestro servicio de Medicina Interna por otorragia y hematuria para estudio. Como único ant...

  10. Intoxicación ocupacional por mercurio

    OpenAIRE

    Augusto V Ramírez

    2008-01-01

    El mercurio, metal pesado ampliamente utilizado por el hombre, es muy tóxico; produce daño al sistema nervioso central, perturbaciones del comportamiento y lesiones renales. Se acumula en todos los seres vivos y no es esencial para ningún proceso biológico. La toxicidad del mercurio está directamente relacionada con su estado químico. El metilmercurio es la forma más dañina, con efectos neurotóxicos en adultos y en fetos de madres expuestas. El mercurio metálico no es menos tóxico. Las sales ...

  11. Refrigeración solar por eyector

    OpenAIRE

    Pizarro Romanillos, Raúl

    2014-01-01

    La finalidad de este trabajo es el estudio de un método de refrigeración que ayude a reducir el impacto medioambiental que producen otros sistemas de refrigeración más convencionales. Este método consiste en combinar la energía del Sol, que es renovable y gratuita, con un sistema de refrigeración por eyección que, a pesar de no tener alta eficiencia, tiene importantes ventajas como la de tener un bajo coste y una menor complejidad que otros sistemas. Para comenzar el estudio se hará un bre...

  12. Osteonecrosis de hueso maxilar inducida por bisfosfonatos

    OpenAIRE

    Vera Sempere, Francisco José

    2016-01-01

    Los bisfosfonatos son un grupo de fármacos, análogos de los pirofosfatos, utilizados en administración oral en el tratamiento de la osteoporosis, así como en formulaciones intravenosas para el tratamiento del dolor óseo y de la hipercalcemia ligada a la enfermedad tumoral metastasica (generalmente en el contexto de mieloma múltiple / cáncer de mama o próstata avanzados), actuando como un inhibidor de la reabsorción ósea, mediada por osteoclastos, así como de la apoptosis de los osteobl...

  13. Estudio del desgaste por deslizamiento en bronces

    OpenAIRE

    Carlos Holguín; John Coronado

    2007-01-01

    Se evaluaron tres bronces: SAE 67, nacional y americano usados típicamente como material de la chumacera en los molinos de caña de azúcar. Se realizaron pruebas desgaste por deslizamiento bajo la norma G77 usando bloques de bronce, anillos de acero SAE 1045 y aceite como lubricante. El tribómetro se calibró usando los anillos de acero SAE 4620 y se usó acero de herramienta SAE O1 para los bloques. Se realizaron metalografías, durezas y rugosidad de los materiales estudiados. El bronce naciona...

  14. Por uma arte no mundo da vida

    Directory of Open Access Journals (Sweden)

    Rachel Costa

    2016-12-01

    Full Text Available O artigo visa debater a análise colocada por Jacinto Lageira no texto “As razões do agir, contribuição a uma poética da ação”. O debate se estabelece no que concerne ao problema da autonomia da arte e suas consequências, tendo em vista a necessidade de pensar possibilidades contemporâneas para a experiência estética que pressuponham o mundo material. Isso é realizado a partir da teoria dos gestos do filósofo Vilém Flusser.

  15. Formação por ciclos

    OpenAIRE

    Nedbajluk,Lidia

    2006-01-01

    Artigo desenvolvido a partir dos estudos de Mestrado na Universidade Federal do Paraná, na linha de pesquisa Currículo, Conhecimento e Saberes nas Práticas Escolares, investigando a Formação por Ciclos. Analisa a diversidade de termos utilizados como complemento ao termo ciclos no ensino fundamental (Ciclos de Aprendizagem; Escola em Ciclos; Ensino em Ciclos; Ciclos de Desenvolvimento; Ciclos de Formação; Ciclo de Estudos) e esclarece a inadequação do uso dos mesmos indistintamente. Considera...

  16. Nodulose por Metotrexato Methotrexate Induced Nodulosis

    Directory of Open Access Journals (Sweden)

    Fernanda Guidolin

    2005-08-01

    Full Text Available A nodulose por metotrexato (MTX é um dos efeitos colaterais pouco conhecidos do uso desse medicamento em doses baixas. Embora classicamente descrita em casos de artrite reumatóide, tem aparecido, também, em outras doenças reumáticas. Descreve-se aqui um caso de nodulose por MTX em uma paciente com artrite reumatóide soropositiva, que utilizava esse medicamento há um ano, com bom controle do processo articular. Segue-se uma breve revisão sobre o assunto.Methotrexate-induced nodulosis is a rare side effect of this drug when it is used in low doses. Although classically described in rheumatoid arthritis patients, it may also appear in other rheumatic disorders. We describe a seropositive rheumatoid arthritis patient who developed methotrexate-induced nodulosis after using this drug for a year, with good control of articular symptoms. This case presentation is followed by a brief revision on the subject.

  17. Investigando o Consumo de Lazer por Idosos

    Directory of Open Access Journals (Sweden)

    Marcelo de Rezende Pinto

    2015-06-01

    Full Text Available A partir da constatação de que ainda são incipientes os estudos que buscam investigar a perspectiva cultural do consumo, atrelada à percepção de que pouco se pesquisou sobre o consumo de lazer de consumidores da terceira idade, o artigo tem por objetivo geral apresentar resultados de uma pesquisa empírica cujo objetivo foi investigar como as experiências de consumo nas atividades de lazer por indivíduos da terceira idade interagem com o sistema cultural e simbólico envolvido no fluxo da vida social cotidiana. Para se atingir esses objetivos, adotou-se uma perspectiva interpretativa de investigação, a partir de uma abordagem etnográfica. Os resultados parecem indicar que os processos sociais, desde a construção de relacionamentos entre familiares, amigos e vizinhos até a construção de redes de convivência com integrantes dos clubes de terceira constituem-se os principais processos presentes nas atividades de lazer desses indivíduos.

  18. Reacciones adversas por antiinflamatorios no esteroideos

    Directory of Open Access Journals (Sweden)

    Luisa Ivet Sánchez Ricardo

    2011-03-01

    Full Text Available Se realizó un estudio descriptivo y transversal en el Consultorio Médico de la Familia No. 28 perteneciente al Policlínico Universitario y Docente "Dr. Mario Muñoz Monroy" desde el 1ro. de junio al 31 de diciembre de 2008, con el objetivo de detectar las reacciones adversas más frecuentes provocadas por el consumo de antiinflamatorios no esteroideos. El universo estuvo constituido por 105 pacientes que asistieron a consulta en el tiempo de estudio y de estos se seleccionó una muestra de 60 pacientes, a quienes se les aplicó un cuestionario de preguntas donde se recogieron las variables de análisis. .Las mujeres resultaron las que más antiinflamatorios consumieron y en el rango de edades de 31-59 años. Las reacciones adversas que más se reportaron fueron la epigastralgia y la hipertensión arterial, así mismo se comprobó la automedicación en algunos pacientes.

  19. Hipotiroidismo inducido por Amiodarona: Reporte de caso

    Directory of Open Access Journals (Sweden)

    Jorge Luis Salinas Arce

    2012-03-01

    Full Text Available Se describe el caso de una mujer de 57 años de edad, con diagnóstico de síndrome de Wolf Parkinson White, en tratamiento con amiodarona 200 mg/día; que acudió por presentar palpitaciones, fatiga y aumento de sueño. Al examen físico no se encontró bocio, pero los reflejos osteotendinosos estaban prolongados. Los exámenes auxiliares mostraron TSH elevado, T4 libre disminuido y anticuerpos antiperoxidasa tiroidea negativos. Se suspendió la amiodarona y se inició levotiroxina. Después de dos meses; los niveles de TSH y T4 libre eran normales y la paciente no presentaba molestias. La amiodarona está asociada a diversos efectos adversos que pueden limitar su uso. Entre estos efectos adversos, se describe el hipotiroidismo inducido, que se caracteriza por TSH elevado, T4 libre disminuido y síntomas inespecíficos como fatiga, intolerancia al frío y piel seca. El tratamiento de elección es la levotiroxina.

  20. Lucro por ação

    Directory of Open Access Journals (Sweden)

    Gabriel Moreira Campos

    2001-08-01

    Full Text Available Este trabalho tem por objetivo demonstrar os principais conceitos acerca do Lucro por Ação (Earnings per Share, o qual se apresenta como um quociente de grande utilidade nas entidades. Serão demonstrados aspectos sobre o assunto presentes no Brasil, bem como as normas aplicáveis nos Estados Unidos, emanadas do Financial Accounting Standards Board (FASB, e as normas internacionais, emanadas do International Accounting Standards Committee (IASC. De forma a possibilitar uma visualização mais completa dos conceitos envolvidos, serão desenvolvidos exemplos de sua aplicação. O Lucro (Resultado por Ação pode ser calculado em sua forma básica e em sua forma diluída. Na forma básica, não são considerados os efeitos dos instrumentos potencialmente dilutivos, ao passo que, no cálculo do Lucro (Resultado por Ação Diluído, são. Como instrumentos financeiros potencialmente dilutivos temos as ações preferenciais conversíveis, as debêntures conversíveis e os bônus de subscrição, que podem ser convertidos em ações ordinárias, caracterizando, assim, o próprio potencial dilutivo desses instrumentos. Dessa forma, o trabalho em questão foi dividido em três partes principais, sendo que nas duas últimas constam os referidos exemplos de cálculo do Lucro por Ação em sua forma básica e em sua forma diluída: • aspectos observados no Brasil; • normas emanadas do FASB; • normas emanadas do IASC.The objective of this paper is to demonstrate the principal concepts about Earnings per Share, which is presented as a quotient of great usefulness for the companies. The subject is presented in three parts: in the first part, we will demonstrate relevant aspects that are present in Brazil. In the second part, the applicable standards in the United States will be discussed, which are issued by the Financial Accounting Standards Board (FASB. In the third part, the international standards are dealt with, which are issued by the

  1. La Violencia Latinoamericana vista por los Economistas

    Directory of Open Access Journals (Sweden)

    Salama Pierre

    2003-08-01

    Full Text Available

    Salama, Pierre. "La Violencia Lationoamericana vista por los Economistas", Cuadernos de Economía, V. XXII, n. 38, Bogotá, 2003 páginas 179-198.

    Este articulo sintetiza los estudios económicos publicados recientemente sobre la violencia en América Latina y analiza las causas suceptibles a acrecentarla: pobreza, desigualdad de los ingresos en nivel y variación, impunidad, diferencia entre la probabilidad de ser arrestado y la severidad de la pena impuesta, y narcotrafico. Sin embargo, la explicación de la violencia no se limitará a los factores económicos, puesto que el autor privilegia un enfoque inspirado en la antropología y la sociología.

  2. Toxicidad por óxido de etileno

    Directory of Open Access Journals (Sweden)

    Téllez M. Jairo A.

    1993-08-01

    Full Text Available

    El óxido de etileno, es un compuesto epóxido gaseoso, ampliamente utilizado en nuestro medio como agente esterilizante y de desinfección en instituciones hospitalarias. Los estudios realizados en varios países han demostrado efectos sobre la salud humana, caracterizados por  hipersensibilidad dérmica, irritación del tracto respiratorio, irritación ocular, excitación del S.N.C. y se asocia con presencia de abortos expontáneos, aberraciones cromosómicas e irritación crónica de laringe y tráquea en personal expuesto ocupacionalmente.

  3. Infeções alimentares por Campylobacter

    OpenAIRE

    Neto, Carlota Duarte Castro

    2017-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Após o isolamento bem-sucedido em fezes na década de setenta do século passado (1972), Campylobacter tornou-se rapidamente a espécie bacteriana mais comumente associada a doenças diarreicas em todo o mundo. A infeção por Campylobacter provoca um espectro de doenças, incluindo enterite aguda, infeções extra-gastrointestinais e complicações pós-infeciosas. A doença gastrointestinal autolimita...

  4. fluidizado por proceso autotérmico

    Directory of Open Access Journals (Sweden)

    ZULAMITA ZAPATA BENABITHE

    2005-01-01

    Full Text Available El presente trabajo se basa en el estudio de la producción de carbón activado a partir de carbón mineral subbituminoso en un reactor de lecho fluidizado por proceso autotérmico. El carbón utilizado provino de la región de Amagá (Antioquia - Colombia y fue activado en dos reactores de lecho fluidizado de diferente diámetro interno, 10 cm y 22 cm. Los valores del área superficial específica y el volumen de poro de las muestras activadas fueron determinados a partir de las isotermas de N2 y CO2. Los resultados experimentales mostraron que los valores de áreas superficiales BET y DR y del Índice de Yodo se encontraron alrededor de 460 m2/g (SBET, 490 m2/g (SDR y 460 mg I2/g carbón.

  5. Autoagresión por quemaduras

    Directory of Open Access Journals (Sweden)

    Iris Montes de Oca

    1996-04-01

    Full Text Available Se realizó un estudio epidemiológico transversal en los casos de autoagresión por quemaduras, que acudieron al Cuerpo de Guardia del Servicio de Quemados del Hospital "Dr. Ernesto Guevara de la Serna", durante el período comprendido entre los meses de febrero de 1993 y febrero de 1994, con la finalidad de determinar el comportamiento de algunas variables de interés en estos casos. El universo de estudio lo constituyeron 57 casos, cuya información se recolectó de la gráfica general del paciente quemado (Modelo 71-05 y de los registros estadísticos del Servicio de Quemados del Hospital. Como fundamentales resultados y conclusiones se obtienen las siguientes: la mayor frecuencia de casos se encontró en las edades comprendidas entre 15 y 24 años; el sexo femenino resultó ser el más afectado en todos los grupos de edades. La cocina fue el lugar donde se efectuó el acto con mayor frecuencia. Se encontró un alto grado de asociación entre la supervivencia y la presencia de antecedentes de intentos suicidas. Presentaron la mayor incidencia por municipios los de Puerto Padre y Jobabo; el alcohol y el kerosene fueron los agentes causales más utilizados. En la casuística predominaron los grandes quemados.A transversal epidemiological study of the cases of self-aggression by burns, who received medical attention at the Emergency Department of the Burns Service of the "Dr. Ernesto Guevara de la Serna" Hospital from February, 1993 to February, 1994, was carried out aimed at determining the behaviour of some variables of interest in these cases. Fifty seven cases were studied and the information was collected from the general graph of the burn patient (Model 71-05, and from the statistical records of the Burns Service of the hospital. The main results and conclusions reached are the following: the highest frequency of cases was found in ages between 15 and 24; women were the most affected in all age groups; and kitchen was the place where the

  6. Nefrectomía simple por puerto único (LESS) asistida por robot (da Vinci)

    OpenAIRE

    CASTILLO C,OCTAVIO A; VIDAL M,IVAR; SEPÚLVEDA T,FRANCISCO

    2011-01-01

    Introducción: La cirugía mínimamente invasiva en urología avanza rápidamente y la cirugía laparo-endoscópica a través de puerto único (LESS) no es la excepción. Esta técnica por vía laparoscópica presenta mucha dificultad y requiere de un cirujano laparoscópico experimentado debido a la falta de triangulación y el cruce de los instrumentos. Los beneficios del sistema quirúrgico da Vinci® han sido introducidos recientemente en LESS. Presentamos dos casos de nefrectomía LESS asistida por robot....

  7. Consumo Voluntario de Forraje por Rumiantes en Pastoreo Consumo Voluntario de Forraje por Rumiantes en Pastoreo

    Directory of Open Access Journals (Sweden)

    José Mejía Haro

    2012-02-01

    Full Text Available The variation in voluntary forage intake is undoubtedly the major dietary factor determining level and efficiency of ruminant production. This variation is bigger and least predictable for grazing ruminants. Range ruminant productivity and efficiency is relatively low due, partly, to intake limitations; productivity could probably be increased most by increasing intake. Distension of the reticulo-rumen wall is the primary intake regulation mechanism of low-quality roughages in range ruminants, digestibility and rate of ingest passage also affect voluntary intake. Body size and metabolic bodysize as well affect intake of grazing animals. Kind and amount of supplementation, forage availability, and grazing intensity have been related to voluntary forage intake. La variación en el consumo voluntario de forraje es indudablemente el principal factor dietario que determina el nivel y eficiencia de producción en un rumiante. Esta variación es mayor y muy difícil de predecir bajo condiciones de pastoreo. La productividad y eficiencia de rumiantes en pastoreo es relativamente baja debido, en parte, a las limitaciones en el consumo; la productividad probablemente se podrá incrementar si se incrementa el consumo. La distensión de la pared del rumenretículo es el principal mecanismo de regulación del consumo de forrajes de baja calidad en rumiantes en pastoreo, aunque la digestibilidad y la tasa de pasaje también afectan el consumo voluntario. Igualmente, el consumo se ve afectado por el tamaño corporal y peso metabólico del animal, por la cantidad y tipo de suplemento ofrecido, por la disponibilidad de forraje y por la intensidad del pastoreo.

  8. Intoxicación ocupacional por mercurio

    Directory of Open Access Journals (Sweden)

    Augusto V Ramírez

    2008-03-01

    Full Text Available El mercurio, metal pesado ampliamente utilizado por el hombre, es muy tóxico; produce daño al sistema nervioso central, perturbaciones del comportamiento y lesiones renales. Se acumula en todos los seres vivos y no es esencial para ningún proceso biológico. La toxicidad del mercurio está directamente relacionada con su estado químico. El metilmercurio es la forma más dañina, con efectos neurotóxicos en adultos y en fetos de madres expuestas. El mercurio metálico no es menos tóxico. Las sales de mercurio inorgánico afectan directamente al riñón. Clínicamente, en la exposición ocupacional a mercurio se encuentra la triada clásica: temblor, alteración de la personalidad y estomatitis. En los últimos años se ha demostrado también alteración en la visión cromática. La exposición aguda se evalúa midiendo el mercurio en la sangre, mientras que la exposición crónica y ocupacional se determina mejor dosándolo en orina homogenizada de 24 horas. Los quelantes del metal -BAL, sus derivados o la D-penicilamina- son usados para tratar la intoxicación aguda o crónica.

  9. Histeria ainda hoje, por quê?

    Directory of Open Access Journals (Sweden)

    Dayse Santos Costa

    2016-04-01

    Full Text Available Resumo Estudo teórico que teve o propósito de discutir a histeria na contemporaneidade, considerando as mudanças culturais que podem ter acorrido desde a fundação da psicanálise até hoje. A discussão teve como cerne os apontamentos de Charles Melman, posto que seja um psicanalista que vem pensando a posição do sujeito nas condições da cultura ocidental atual. Foram destacados aspectos que nos conduziram a elaborar um pensamento em torno de como a neurose histérica aparece no contexto contemporâneo. Partimos do princípio de que sofremos uma mutação cultural, na qual passamos de uma cultura propensa à neurose para uma propensa à perversão. Tal concepção determina que lidamos com sujeitos que funcionam sob a ordem de uma nova economia psíquica e que em decorrência assistimos a expressão de uma histeria coletiva que, por sua vez, seria espaço de reivindicação dos sujeitos, a fim de requisitar um paradeiro e reinventar um pai que já esteja destituído.

  10. Identidad e interculturalidad: un horizonte por visitar

    Directory of Open Access Journals (Sweden)

    Marian Pérez Bernal

    2016-01-01

    Full Text Available En el presente trabajo mantenemos que el concepto de identidad defendido por Amin Maalouf puede ser una interesante vía para conseguir una aproximación entre las distintas culturas capaz de conducirnos a un diálogo fructífero que nos permitan gestionar la multiculturalidad actual. Defendemos que las culturas sean vistas como escenas de debate y contestación en constante proceso de construcción y reconstrucción y en las que siempre primen unos valores que nos conciernen a todos y que han de ser irrenunciables.In this paper, it is stated that the concept of identity defended by Amin Maalouf could be an interesting way to achieve a rapprochement amongst different cultures. This could lead to a fruitful dialog allowing to manage today’s multiculturalism. It is also defended that cultures should be considered as instruments of debate and reply on a continuous process of construction and reconstruction. However, cultures should not prevail over a series of values that concern to all of us and that should be inalienable.

  11. Libertad, igualdad, sostenibilidad. Por un ecofeminismo ilustrado

    Directory of Open Access Journals (Sweden)

    Puleo, Alicia H.

    2008-06-01

    Full Text Available This article presents the proposal of an enlightened Ecofeminism and defines it as an ethic-political thinking about human relations to Nature. It aims at ecojustice and sustainability, which are characterized through the criticism of prejudice, through the principles of equality and autonomy, and through the nominalist conceptualization of gender, intercultural dialogue and the sensible acceptance of science and technique. The enlightened Ecofeminism universalizes virtues such as caring for the human and non-human Nature, and defends a compassionate moral towards the radical finitude of the world.

    En este artículo se presenta la propuesta de un ecofeminismo ilustrado entendido como reflexión ético-política sobre las relaciones de los humanos con la Naturaleza. Orientado a la ecojusticia y la sostenibilidad, el ecofeminismo ilustrado se caracterizaría por la crítica al prejuicio, la defensa de los principios de igualdad y autonomía, la conceptualización nominalista del género, el diálogo intercultural, la aceptación prudente de la ciencia y la técnica, la universalización de las virtudes del cuidado aplicadas a los humanos y al resto de la Naturaleza, y una moral de la compasión frente a la radical finitud del mundo.

  12. Estudio electrofisiologico en la neuropatia por Vincristina

    Directory of Open Access Journals (Sweden)

    Olga P. Sanz

    1975-12-01

    Full Text Available Diez pacientes afectados por diversas patologías que requerían tratamiento crónico con Vincristina, fueron sometidos a estudios electrofisiológicos en los que se valoró: el número de unidades motoras (UM funcionantes en los músculos de la eminencia tenar, los valores de los incrementos medios de UM, velocidad de conducción motora y su latencia residual en el nervio mediano, la velocidad de conducción sensitiva del mismo nervio y el estado de la transmisión neuromuscular. Los valores obtenidos fueron comparados con grupos controles. Los resultados mostraron disminución del número de UM; las UM remanentes presentaron amplitud reducida junto a otras cuyo tamaño no superaba el del grupo control, hecho que sugiere la incapacidad de lograr una reinervación adecuada. Las velocidades de conducción motora y sensitiva mostraron valores diminuídos, con mayor compromiso en los segmentos distales. Junto a estos datos se halló respuesta miasteniforme al estímulo repetitivo. Todos estos resultados permiten postular la existencia de un compromiso de la unidad motora, abarcando todos sus segmentos, en pacientes intoxicados con Vincristina.

  13. Itinerarios Didácticos por la isla de Lanzarote

    OpenAIRE

    Becerra-Ramírez, Rafael; González Cárdenas, Elena; Gosálvez, Rafael U.; Escobar Lahoz, Estela; Dóniz-Páez, Javier

    2013-01-01

    Con la confección de esta guía de itinerarios didácticos por la isla de Lanzarote pretendemos contribuir a un mayor conocimiento de las características geográficas de este espacio dominado por las formas volcánicas que caracterizan un paisaje modificado por la mano del hombre que convive con los volcanes y los usa, tradicionalmente como soporte de sus cultivos, y modernamente como base de la industria turística. Los itinerarios didácticos por la isla de Lanzarote son la adaptación de los t...

  14. Conserved Responses in a War of Small Molecules between a Plant-Pathogenic Bacterium and Fungi.

    Science.gov (United States)

    Spraker, Joseph E; Wiemann, Philipp; Baccile, Joshua A; Venkatesh, Nandhitha; Schumacher, Julia; Schroeder, Frank C; Sanchez, Laura M; Keller, Nancy P

    2018-05-22

    Small-molecule signaling is one major mode of communication within the polymicrobial consortium of soil and rhizosphere. While microbial secondary metabolite (SM) production and responses of individual species have been studied extensively, little is known about potentially conserved roles of SM signals in multilayered symbiotic or antagonistic relationships. Here, we characterize the SM-mediated interaction between the plant-pathogenic bacterium Ralstonia solanacearum and the two plant-pathogenic fungi Fusarium fujikuroi and Botrytis cinerea We show that cellular differentiation and SM biosynthesis in F. fujikuroi are induced by the bacterially produced lipopeptide ralsolamycin (synonym ralstonin A). In particular, fungal bikaverin production is induced and preferentially accumulates in fungal survival spores (chlamydospores) only when exposed to supernatants of ralsolamycin-producing strains of R. solanacearum Although inactivation of bikaverin biosynthesis moderately increases chlamydospore invasion by R. solanacearum , we show that other metabolites such as beauvericin are also induced by ralsolamycin and contribute to suppression of R. solanacearum growth in vitro Based on our findings that bikaverin antagonizes R. solanacearum and that ralsolamycin induces bikaverin biosynthesis in F. fujikuroi , we asked whether other bikaverin-producing fungi show similar responses to ralsolamycin. Examining a strain of B. cinerea that horizontally acquired the bikaverin gene cluster from Fusarium , we found that ralsolamycin induced bikaverin biosynthesis in this fungus. Our results suggest that conservation of microbial SM responses across distantly related fungi may arise from horizontal transfer of protective gene clusters that are activated by conserved regulatory cues, e.g., a bacterial lipopeptide, providing consistent fitness advantages in dynamic polymicrobial networks. IMPORTANCE Bacteria and fungi are ubiquitous neighbors in many environments, including

  15. Desinfestação de substratos para produção de mudas, utilizando vapor de água Disinfesting substrate for transplants production employing hot water steam

    Directory of Open Access Journals (Sweden)

    João Bosco C. Silva

    2001-07-01

    Full Text Available O tratamento sanitário de substratos é uma operação importante no processo de produção de mudas e no cultivo de plantas em vasos ou outros contentores. Tradicionalmente tem-se utilizado o gás brometo de metila como agente desinfetante. Entretanto, a produção deste gás deverá ser abolida até o ano 2010, forçando-se a busca de novas opções. Desenvolveu-se na Embrapa Hortaliças um equipamento que utiliza o vapor de água à baixa pressão, produzido por uma caldeira industrial, com capacidade para evaporar 30 L/h de água, para aquecer o substrato contido em uma caixa metálica cilíndrica com capacidade de 2000 L. O vapor é aplicado no fundo da caixa que contém uma camada de brita coberta com uma tela metálica de malha de 2 mm, que favorece a distribuição uniforme do vapor por toda a massa de substrato. O tempo de aquecimento é de aproximadamente 3 horas e o calor armazenado durante este período mantém a massa de substrato aquecida a temperaturas pasteurizantes, por até 4 horas após a aplicação do vapor. Para testar a eficácia do sistema avaliou-se a sobrevivência dos patógenos Ralstonia solanacearum, Fusarium oxysporum, Sclerotinia sclerotiorum e Rhizoctonia solani. Aplicou-se vapor por uma hora, não considerando o período de aquecimento, e coletaram-se as amostras após uma, duas, três ou quatro horas o início da aplicação de vapor. O tratamento por uma hora, em adição ao período de aquecimento, resultou na eliminação dos patógenos.The disinfestation of substrate is an important process for transplanting production and for plant cultivation in pots or boxes. Traditionally, metyl bromide gas has been employed to eliminate microorganisms. However the production of bromide gas in Brazil will be interrupted by the year 2010 and it is necessary to search for new options. We have devised an equipment that utilizes hot steam water at low pressure produced into a boiler machine with the capacity of evaporating

  16. Úlceras por presión causadas por dispositivos clínicos

    OpenAIRE

    Iglesias Ruisánchez, Sandra

    2017-01-01

    Las úlceras por presión (UPP) son lesiones comunes en los pacientes hospitalizados, especialmente en las unidades de cuidados intensivos (UCI). Los enfermos críticos tienen un riesgo elevado de desarrollar UPP, debido principalmente a la limitación de la movilidad, disminuyendo su capacidad para cambiar activamente su posición en la cama o asiento. Además, el efecto de fármacos anestésicos y sedantes, puede causar una pérdida de la percepción sensorial cutánea. Los diferentes dispositivos clí...

  17. Mujeres por la utilidad de la virtud

    Directory of Open Access Journals (Sweden)

    Nancy Rodríguez Pupo

    2014-08-01

    Full Text Available La mujer cubana ostenta una vasta tradición combativa y es ejemplo de entereza, abnegación, sacrificio y compromiso social. Quien se acerque a la historia de nuestro proceso nacional-liberador a todo lo largo de su devenir, constatará su presencia como forjadoras de la nación. Integrante fundamental de la sociedad, la mujer hizo suyas las ansias libertadoras y desempeñó un rol importante en aras de crear una patria común. Se trata de entender que en lo más mínimo su papel fue de “retaguardia”, sino todo lo contrario, su trabajo fue necesario y en no pocas ocasiones empuñó las armas y con valentía gritó ¡viva Cuba libre!, incluso a cambio de su vida, como lo protagonizó la tunera Mercedes Varona. El ejemplo de la mujer cubana y particularmente tunera, es imperecedero en su doble función de ser social y generadora de nuevas vidas, con amplias posibilidades de realización personal y profesional luego de 1959. Su actuación se manifiesta en cada actividad del sector de la salud pública como médica, enfermera, técnica, profesora y estomatóloga, así como también en otros puestos de trabajo no menos necesarios. Ellas con altruismo, solidaridad, responsabilidad y humanismo, son continuadoras de las mejores tradiciones científicas, patrióticas y revolucionarias de nuestro pueblo. Esta edición se dedica al 8 de marzo, día internacional de la mujer, las homenajeamos y recordamos la obra de Laura Martínez Carvajal, primera médica cubana, quien desafió los prejuicios de su época o Isabel Rubio que puso sus conocimientos de medicina farmacéutica al servicio del Ejército Libertador, en el que alcanzó los grados de capitana de sanidad; por citar dos entre las grandes. Otras féminas de la localidad ejercieron en la manigua sus dotes de parteras o enfermeras, tal el caso de Anita Cruz, magnífica artillera, quien estuvo al frente de un hospital de campaña durante la guerra. Allí curó heridas, infecciones, disenter

  18. Impacto do manejo da água na toxidez por ferro no arroz irrigado por alagamento

    Directory of Open Access Journals (Sweden)

    Fabiana Schmidt

    2013-10-01

    Full Text Available A toxidez por ferro é o distúrbio nutricional de maior ocorrência em arroz (Oryza sativa L. cultivado em sistemas alagados, derivada da quantidade excessiva de íons ferrosos (Fe2+ gerados pela redução de óxidos de ferro em solos alagados. Em experimento conduzido em casa de vegetação, foram avaliados os efeitos de manejos da água de irrigação na dinâmica de redução de um Planossolo e na manifestação da toxidez por ferro em arroz. Os tratamentos dispostos em blocos completos ao acaso com quatro repetições constaram de cinco manejos da água: T1- início do alagamento no estádio V2-V3 do arroz; T2- início do alagamento no estádio V6-V7; T3- T1 e drenagem no estádio V10-V11; T4- T2 e drenagem no estádio V10-V11; e T5- T1 e drenagens nos estádios V7-V8 e V10-V11. O atraso do início do alagamento para o estádio V6-V7 do arroz manteve os valores do Eh da solução do solo mais elevados, promovendo menor disponibilidade de Fe2+ na solução do solo e deslocando a máxima liberação de Fe2+ na solução do solo para estádios fenológicos mais avançados do arroz. A realização de drenagens ao longo do ciclo vegetativo do arroz promoveu a reoxidação do solo, que ocasionou o aumento dos valores de Eh e redução da concentração de Fe2+ na solução do solo. O uso de drenagens durante o período vegetativo do arroz foi eficiente no controle da toxidez por excesso de ferro, em arroz cultivado em solo alagado.

  19. Ansiedad percibida por los pacientes hospitalizados por quemaduras, en una Unidad de Quemados

    Directory of Open Access Journals (Sweden)

    M. Alcázar-Gabás

    2014-06-01

    Full Text Available El presente trabajo, pretende describir el estado de ansiedad que experimentan los pacientes ingresados en una Unidad de Quemados. Uno de los factores clave en los cuidados del paciente quemado es una buena atención psicológica. La realidad demuestra que es el profesional de enfermería quien observa los síntomas emocionales durante los primeros días de ingreso y trata de responder a esa demanda de cuidado. Pretendemos, a través de la medición del nivel de ansiedad que perciben los pacientes ingresados en la Unidad de Quemados elegida para nuestro estudio durante el primer semestre del año 2009, identificar a aquellos que estén en riesgo de padecer mayores niveles de ansiedad durante su hospitalización, para así poder establecer un plan de cuidados adaptado a las necesidades emocionales de cada uno. Los resultados obtenidos nos permiten concluir que los pacientes quemados ingresados en la Unidad de Quemados presentaron niveles elevados de ansiedad que son superiores entre la población femenina, así como en aquellos pacientes con lesiones de mayor extensión. Determinamos también que los pacientes ingresados por quemaduras en la Unidad de Quemados a estudio fueron mayoritariamente varones, de nacionalidad española, residentes en medio urbano con una media de edad de 50 años, siendo las quemaduras producidas por llama en accidentes domésticos la causa más frecuente.

  20. Escenarios de costos generados por el uso del costeo variable

    OpenAIRE

    Zea Lourido, Felipe

    2013-01-01

    Este trabajo demuestra cómo el costeo absorbente, considerado por expertos en la materia, uno de los métodos de costeo usado frecuentemente por las organizaciones, con el propósito de determinar el valor de los inventarios y del costo de productos vendidos que intervienen en el estado de resultados para usuarios externos (stakeholders), al compararlo con el costeo variable, preferido por algunos administradores para toma de decisiones internas y usado en la preparación del estado de resultado...

  1. Itinerarios didácticos por la isla de Tenerife

    OpenAIRE

    Becerra Ramírez, María Carmen; Javier Dóniz-Páez; González Cárdenas, Elena; Gosálvez, Rafael U.; Becerra-Ramírez, Rafael; Escobar Lahoz, Estela

    2013-01-01

    Con la elaboración de esta guía de Itinerarios Didácticos por la isla de Tenerife pretendemos contribuir a un mayor conocimiento de las características geográficas de un espacio dominado por las formas y formaciones volcánicas que caracterizan un paisaje fuertemente modificado por la actividad humana. El hombre convive y usa lo que los volcanes le ofrecen, tradicionalmente como soporte de sus cultivos o de su actividad ganadera,y modernamente como base de la industria turística. Los itiner...

  2. Topoplastia de Cvintal assistida por laser de femtossegundo

    Directory of Open Access Journals (Sweden)

    Alexandre Takayoshi Ishizaki

    2013-06-01

    Full Text Available Apresentamos um relato de astigmatismo tardio progressivo pós-transplante de córnea para ceratocone, associado à afinamento periférico na junção doador-receptor, o que presumidamente pode ser considerado como recorrência da ectasia. O caso foi tratado por meio de Topoplastia de Cvintal assistida por laser de femtossegundo para a confecção da incisão com geometria "top hat", seguido de sutura com ajuste per-operatório guiado por ceratoscopia.

  3. Selección de Recursos Humanos por Competencias

    OpenAIRE

    Sánchez Domingo, Cristina

    2013-01-01

    Los objetivos de este trabajo son, por un lado conocer en qué consisten los procesos de valoración y selección de personas desde el enfoque de las competencias laborales. Para ello, ha sido preciso profundizar en el estudio del concepto de “competencia laboral”, y comprender qué es la Gestión de Recursos Humanos por Competencias, en cuyo seno se encuentra la propia Selección de Recursos Humanos. Por otra parte, un segundo objetivo del trabajo es conocer el grado de implantación de la Selecció...

  4. Orlando Castellanos. La pasión por la radio

    OpenAIRE

    Castellanos Molina, Orlando, 1930-1998

    2004-01-01

    Documento sonoro en el que se recogen entrevistas realizadas a Orlando Castellanos por Miguel Ángel de la Guardia, Miladys Ochoa, Fernando Rodríguez Sánchez (Ciego de Ávila), Ángel Ferrera, Boshmonar, Jaime Almiral, Radio Umbral de Santiago de Chile, Franco Carbón, Luis Toledo Sande y Estrella Díaz. Esta grabación pertenece a la colección Palabra Viva, desarrollada por el Centro Cultural Pablo de la Torriente Brau, a partir de las entrevistas realizadas por el periodista Orlando Castellanos. ...

  5. Anaerobic digestion in mesophilic and room temperature conditions: Digestion performance and soil-borne pathogen survival.

    Science.gov (United States)

    Chen, Le; Jian, Shanshan; Bi, Jinhua; Li, Yunlong; Chang, Zhizhou; He, Jian; Ye, Xiaomei

    2016-05-01

    Tomato plant waste (TPW) was used as the feedstock of a batch anaerobic reactor to evaluate the effect of anaerobic digestion on Ralstonia solanacearum and Phytophthora capsici survival. Batch experiments were carried out for TS (total solid) concentrations of 2%, 4% and 6% respectively, at mesophilic (37±1°C) and room (20-25°C) temperatures. Results showed that higher digestion performance was achieved under mesophilic digestion temperature and lower TS concentration conditions. The biogas production ranged from 71 to 416L/kg VS (volatile solids). The inactivation of anaerobic digestion tended to increase as digestion performance improved. The maximum log copies reduction of R. solanacearum and P. capsici detected by quantitative PCR (polymerase chain reaction) were 3.80 and 4.08 respectively in reactors with 4% TS concentration at mesophilic temperatures. However, both in mesophilic and room temperature conditions, the lowest reduction of R. solanacearum was found in the reactors with 6% TS concentration, which possessed the highest VFA (volatile fatty acid) concentration. These findings indicated that simple accumulation of VFAs failed to restrain R. solanacearum effectively, although the VFAs were considered poisonous. P. capsici was nearly completely dead under all conditions. Based on the digestion performance and the pathogen survival rate, a model was established to evaluate the digestate biosafety. Copyright © 2015. Published by Elsevier B.V.

  6. Elasticidad precio de la demanda por autopistas interurbanas en Chile

    Directory of Open Access Journals (Sweden)

    Rodrigo Sanes

    2013-01-01

    transporte depende de la información que se disponga respecto a la elasticidad precio de la demanda por el uso de puentes, túneles y carreteras. El objetivo de este trabajo es estimar la elasticidad precio de la demanda por el uso de autopistas interurbanas en Chile utilizando el método de regresiones aparentemente no relacionadas (SUR y un panel de 48 datos mensuales obtenidos a partir de 21 plazas de peajes (48 x 21. Nuestros resultados muestran que, aún controlando por el precio de la gasolina y el nivel de actividad económica, la demanda por el uso de carreteras resulta ser muy inelástica al precio del peaje, con valores que oscilan entre -0,17 para automóviles y -0,05 para camiones.

  7. Elasticidad precio de la demanda por autopistas interurbanas en Chile

    Directory of Open Access Journals (Sweden)

    Rodrigo Saens

    2013-07-01

    Full Text Available La efectividad de un esquema de tarificación vial para optimizar el uso de infraestructura de transporte depende de la información que se disponga respecto a la elasticidad precio de la demanda por el uso de puentes, túneles y carreteras. El objetivo de este trabajo es estimar la elasticidad precio de la demanda por el uso de autopistas interurbanas en Chile utilizando el método de regresiones aparentemente no relacionadas (SUR y un panel de 48 datos mensuales obtenidos a partir de 21 plazas de peajes (48 x 21. Nuestros resultados muestran que, aún controlando por el precio de la gasolina y el nivel de actividad económica, la demanda por el uso de carreteras resulta ser muy inelástica al precio del peaje, con valores que oscilan entre -0,17 para automóviles y -0,05 para camiones.

  8. Osteoporosis secundaria y Osteoporosis inducida por glucocorticoides (OIG

    Directory of Open Access Journals (Sweden)

    Elías Forero Illera

    2006-01-01

    Full Text Available La osteoporosis es un problema de salud pública importante a nivel mundial, y su prevalencia está aumentando. La osteoporosis secundaria se puede producir por varias patologías y el uso de ciertos medicamentos. Los glucocorticoides son un grupo de fármacos usados extensamente en la práctica médica debido a su indiscutible utilidad. La osteoporosis inducida por glucocorticoides es un problema de salud pública. Aunque la patogénesis de la pérdida producida por los glucocorticoides en el hueso no se conoce totalmente, investigaciones recientes han proporcionado nuevas conocimientos en los mecanismos de estos fármacos a nivel celular y molecular. Diversas guías han sido propuestas por diversos grupos para el tratamiento de la OIG; desafortunadamente, las guías del tratamiento no se utilizan adecuadamente en los pacientes.

  9. Higiene mental: conferencia dictada por la Radiodifusora Nacional

    Directory of Open Access Journals (Sweden)

    Francisco Gómez Pinzón

    1941-01-01

    tiene extraordinaria trascendencia para el país por sus vastas repercusiones sobre el futuro de nuestro pueblo, y que, sin embargo ha sido negligentemente olvidado por las autoridades y deliberadamente ignorado por los sectores cultos e ilustrados de nuestra sociedad. Me refería entonces a la curva ascendente que, no sólo entre nosotros sino en todos los países civilizados, han seguido en su propagación las enfermedades nerviosas y mentales, y que hace contraste con la disminución progresiva de las demás afecciones y en especial de las infecto-contagiosas, que están a punto de ser dominadas por la técnica cada día más perfecta de la medicina preventiva. Hoy quiero ocuparme de algunos aspectos de este mismo tema que apenas alcanzaron a ser esbozados en mi conferencia anterior.

  10. San Sebastian, vista por Paret y Alcázar

    Directory of Open Access Journals (Sweden)

    María Castilla Albisu

    2013-07-01

    Full Text Available Luis Paret y Alcázar pintó una serie de vistas panorámicas de puertos del litoral Cantábrico, por encargo del rey Carlos III. El objetivo de este trabajo es ahondar en la vida de este pintor para así comprender mejor su obra. A pesar de los estudios realizados por algunos historiadores quedan todavía incógnitas por descubrir relativas a la vida y al trabajo de este artista. Al acercarse a la figura de Paret y Alcázar hay que preguntarse por qué habiendo sido uno de los pintores más prometedores de su tiempo, su figura ha caído en un triste olvido.

  11. Polución por material particulado fino (PM 2,5) incrementa las hospitalizaciones por insuficiencia cardiaca

    OpenAIRE

    Castro, Pablo; Vera, Jeanette; Cifuentes, Luis; Wellenius, Gregory; Verdejo, Hugo; Sepúlveda, Luis; Vukasovic, José Luis; Llevaneras, Silvana

    2010-01-01

    Antecedentes: Estudios recientes han reportado una asociación entre la contaminación ambiental por material particulado (PM) y el riesgo de hospitalizaciones de pacientes con insuficiencia cardiaca (IC). La región metropolitana de nuestro país constituye un área geográfica en la cual la contaminación es especialmente relevante, asociándose a incrementos periódicos en la morbimortalidad por causa respiratoria. Sin embargo el efecto de la polución por PM en la morbilidad de pacientes con IC no ...

  12. CARACTERÍSTICAS DA VIOLÊNCIA SEXUAL SOFRIDA POR CRIANÇAS ASSISTIDAS POR UM PROGRAMA DE APOIO

    OpenAIRE

    KELLY LINHARES VASCONCELOS; ADRIANA GOMES NOGUEIRA FERREIRA; ELIANY NAZARÉ OLIVEIRA; DANIELLE D\\u2019ÁVILA SIQUEIRA; PATRÍCIA NEYVA DA COSTA PINHEIRO

    2010-01-01

    En Brasil, las estadísticas de la violencia sexual contra niños están lejos de reflejar la verdadera realidad actual debido a la baja notificación de los casos. La finalidad de este estudio fue caracterizar el abuso sexual sufrido por niños asistidos por el Programa Sentinela y el perfil del agresor, en Sobral-Ceará, en el periodo que va del 2002 al 2006. La muestra no probabilística intencional fue compuesta por 50 víctimas de abuso sexual y de las mismas, el 66% es del sexo femenino, con pr...

  13. Biological Control Of The Egyptian Brown Rot In Potato (Solanum Tuberosum L.)

    International Nuclear Information System (INIS)

    Salem, E.A.; Askora, A. M.

    2012-01-01

    Pseudomonas fluorescence, P. aeruginosa, Bacillus subtillus and streptomyces spp. Were used in control of Ralstonia solanacearum, the casual agent of brown rot in potato. In vitro, antagonistic activities showed that streptomyces spp. was the most antagonistic followed by P. fluorescence, Bacillus subtilus and P. aeruginosa respectively. Also, in vivo, biological control of R. solanacearum showed that Streptomyces spp. was found to reduce the percentage of brown rot infection to 5% followed by P. fluorescence, Bacillus subtilus and P. aeruginosa reducing the percentage of infection to 15 , 25 and 40%, respectively. Also, the disease severity when using Streptomyces spp. and P. fluorescence was reduced from 5 to 1 and reduced from 5 to 2 when using Bacillus subtilus and P. aeruginosa.

  14. PHYTOPATHOLOGICAL ASSESMENT OF CAPSICUM ANNUUM L. (SWEET PEPPER AND CHILLI GERMPLASM FROM THE GENE POOL OF THE WORLD VEGETABLE CENTER (AVRDC UNDER THE CONDITIONS OF ARARAT VALLEY IN ARMENIA

    Directory of Open Access Journals (Sweden)

    K. M. Sarikyan

    2015-01-01

    Full Text Available On an experimental basis of the Scientific Center of vegetable, melon and industrial crops (Republic of Armenia 20 accessions of the world germplasm of Capsicum annuum L. (sweet pepper, chili provided by the World Vegetable Center (AVRDC have been studied. The accessions resistant to such diseases as verticillium wilt (Verticillium albo-atrum Reincke, bacterial wilt (Ralstonia solanacearum (= Pseudomonas solanacearum, tobacco mosaic virus (TMV and cucumber mosaic virus (CMV, blossom end rot of fruit, and tip-burn have been selected. These genotypes of chili and sweet pepper are the promising initial material in breeding for resistance to common diseases. In collaboration with other breeders, five varieties of peppers were developed and released: sweet pepper cultivars Natalie, Emily, Miles, and chili cultivars Zita and Gita.

  15. Pronóstico de la diarrea por rotavirus

    Directory of Open Access Journals (Sweden)

    Mota-Hernández Felipe

    2001-01-01

    Full Text Available Objetivo. Comparar la gravedad de la diarrea por rotavirus (RV y por no rotavirus. Material y métodos. Estudio transversal en 520 lactantes con diarrea aguda, efectuado entre octubre de 1994 y marzo de 1995 en siete centros del primer nivel de atención en cinco estados de México. El diagnóstico de RV se realizó con ensayo inmunoenzimático o por electroforesis. El análisis se hizo a través de medidas de tendencia central. Los resultados se presentan como promedio y desviación estándar o mediana o variación. Resultados. Se aisló RV en 264 lactantes (50.7% con predominio en varones de 6 meses a un año. Las manifestaciones clínicas fueron significativamente diferentes entre el grupo rotavirus positivo y el grupo rotavirus negativo en mediana de evacuaciones por 24 horas, frecuencia de vómitos, temperatura > 38° C, deshidratación y calificación de gravedad, respectivamente. Conclusiones. Estos resultados mostraron peor pronóstico por mayor gravedad de la diarrea por RV en lactantes, con relación a otra etiología. El texto completo en inglés de este artículo está disponible en: http://www.insp.mx/salud/index.html

  16. Control of tomato bacterial wilt through the incorporation of aerial part of pigeon pea and crotalaria to soil Controle da murcha bacteriana do tomateiro pela incorporação da parte aérea de guandu e crotalária no solo

    Directory of Open Access Journals (Sweden)

    Suane C. Cardoso

    2006-03-01

    Full Text Available The use of organic matter that improves the physical, chemical and biological soil properties has been studied as an inducer of suppressiveness to soilborne plant pathogens. The objective of this work was to evaluate the effect of different sources and concentrations of organic matter on tomato bacterial wilt control. Two commercially available organic composts and freshly cut aerial parts of pigeon pea (Cajanus cajan and crotalaria (Crotalaria juncea were incorporated, in concentrations of 10, 20 and 30 % (v/v, into soil infested with Ralstonia solanacearum. The soil with the fresh organic matter of pigeon pea and crotalaria was incubated for 30 and 60 days before planting. Tomato seedlings of cv. Santa Clara were transplanted into polyethylene bags with 3 kg of the planting substrate (infested soil + organic matter. The wilting symptoms and percentage of flowering plants were evaluated for 45 days. All evaluated concentrations with incorporation and incubation for 30 days of aerial parts of pigeon pea and crotalaria controlled 100% tomato bacterial wilt. With 60 days of incubation, only the 10 % concentration of pigeon pea and crotalaria did not control the disease. These results suggest that soil incorporation of fresh aerial parts of pigeon pea and crotalaria is an effective method for bacterial wilt control.A utilização de materiais orgânicos que melhoram as características físicas, químicas e biológicas do solo vem sendo estudada como indutora de supressividade a fitopatógenos habitantes do solo. Este trabalho teve como objetivo avaliar o efeito de diferentes fontes e concentrações de matéria orgânica no controle da murcha bacteriana do tomateiro. Foram avaliados dois compostos orgânicos comerciais e a matéria fresca cortada da parte aérea de guandu (Cajanus cajan e de crotalária (Crotalaria juncea, nas concentrações 10, 20 e 30 % (v/v, incorporados no solo infestado com Ralstonia solanacearum. O solo que recebeu a parte

  17. The PorX response regulator of the Porphyromonas gingivalis PorXY two-component system does not directly regulate the Type IX secretion genes but binds the PorL subunit.

    Directory of Open Access Journals (Sweden)

    Maxence S Vincent

    2016-08-01

    Full Text Available The Type IX secretion system (T9SS is a versatile multi-protein complex restricted to bacteria of the Bacteriodetes phylum and responsible for the secretion of surface attachment of diverse proteins that participate to S-layer formation, gliding motility or pathogenesis. The T9SS is poorly characterized but a number of proteins involved in the assembly of the secretion apparatus in the oral pathogen Porphyromonas gingivalis have been identified based on genome substractive analyses. Among these proteins, PorY and PorX encode typical two-component system (TCS sensor and CheY-like response regulator respectively. Although the porX and porY genes do not localize at the same genetic locus, it has been proposed that PorXY form a bona fide TCS. Deletion of the porX in P. gingivalis causes a slight decrease of the expression of a number of other T9SS genes, including sov, porT, porP, porK, porL, porM, porN and porY. Here, we show that PorX and the soluble cytoplasmic domain of PorY interact. Using electrophoretic mobility shift, DNA-protein co-purification and heterologous host expression assays, we showed that PorX does not bind and does not directly regulate expression of the T9SS genes. Finally, we show that PorX interacts with the cytoplasmic domain of PorL, a component of the T9SS membrane core complex and propose that the CheY-like PorX protein might be involved in the dynamics of the T9SS.

  18. The PorX Response Regulator of the Porphyromonas gingivalis PorXY Two-Component System Does Not Directly Regulate the Type IX Secretion Genes but Binds the PorL Subunit

    Science.gov (United States)

    Vincent, Maxence S.; Durand, Eric; Cascales, Eric

    2016-01-01

    The Type IX secretion system (T9SS) is a versatile multi-protein complex restricted to bacteria of the Bacteriodetes phylum and responsible for the secretion or cell surface exposition of diverse proteins that participate to S-layer formation, gliding motility or pathogenesis. The T9SS is poorly characterized but a number of proteins involved in the assembly of the secretion apparatus in the oral pathogen Porphyromonas gingivalis have been identified based on genome substractive analyses. Among these proteins, PorY, and PorX encode typical two-component system (TCS) sensor and CheY-like response regulator respectively. Although the porX and porY genes do not localize at the same genetic locus, it has been proposed that PorXY form a bona fide TCS. Deletion of porX in P. gingivalis causes a slight decrease of the expression of a number of other T9SS genes, including sov, porT, porP, porK, porL, porM, porN, and porY. Here, we show that PorX and the soluble cytoplasmic domain of PorY interact. Using electrophoretic mobility shift, DNA-protein co-purification and heterologous host expression assays, we demonstrate that PorX does not bind T9SS gene promoters and does not directly regulate expression of the T9SS genes. Finally, we show that PorX interacts with the cytoplasmic domain of PorL, a component of the T9SS membrane core complex and propose that the CheY-like PorX protein might be involved in the dynamics of the T9SS. PMID:27630829

  19. Desenvolvimento de um kit de irrigação por microtubos com moto-bomba propulsionada por energia solar

    OpenAIRE

    Luiz Ricardo Sobenko

    2016-01-01

    O bombeamento de água por meio da energia solar vem se mostrando uma alternativa para localidades onde outras fontes de energia não estão disponíveis ou são limitadas. Torna-se interessante aliar essa alternativa a um sistema de irrigação que opera com vazão e pressão relativamente baixas, como a irrigação localizada por microtubos, possibilitando assim a obtenção de alta eficiência. No presente trabalho teve-se por objetivo dimensionar e avaliar um kit de irrigação por microtubos, alimentado...

  20. [Induction of polygalacturonases important in pathogenicity of Pseudomonas solanacearum

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-31

    Recent studies on the importance of hydroxyproline-rich glycoproteins (HPRG`s) in the nature and function of plant cell walls have led to the question as to whether proteolytic enzymes are also involved in tissue maceration and act in concert with other cell wall degrading enzymes in the process. The primary objective of this research was to determine whether proteolytic enzymes, in combination with other enzymes, are involved in the degradation of plant cell walls and thus may be essential for pathogenesis by certain soft rot bacteria. The proteolytic enzymes of Erwinia carotovora subsp.carotovora (Ecc) grown on various media were examined by isoelectrofocusing in polyacrylamide gels over a pH range of 3-10. In addition to the main protease present in culture filtrates, low concentrations of several other proteases were present in extracts from potato tubers infected by Ecc. These enzymes degraded gelatin, soluble collagen, and Hide Powder Azure, and showed weak activity on casein, but did not degrade insoluble collagen or elastin. Ecc proteases appear capable of degrading at least one type of cell wall protein in vitro, but we were unable to obtain evidence that these proteases can attack cell wall proteins in muro. The results indicate that some glycosidic alkali- labile bonds have to be broken befor Ecc proteases can degrade cell wall proteins. Thus, these proteases may play a role in cell wall degradation only when acting in concert with other enzymes that split glycosidic bonds.

  1. [Induction of polygalacturonases important in pathogenicity of Pseudomonas solanacearum

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    Recent studies on the importance of hydroxyproline-rich glycoproteins (HPRG's) in the nature and function of plant cell walls have led to the question as to whether proteolytic enzymes are also involved in tissue maceration and act in concert with other cell wall degrading enzymes in the process. The primary objective of this research was to determine whether proteolytic enzymes, in combination with other enzymes, are involved in the degradation of plant cell walls and thus may be essential for pathogenesis by certain soft rot bacteria. The proteolytic enzymes of Erwinia carotovora subsp.carotovora (Ecc) grown on various media were examined by isoelectrofocusing in polyacrylamide gels over a pH range of 3-10. In addition to the main protease present in culture filtrates, low concentrations of several other proteases were present in extracts from potato tubers infected by Ecc. These enzymes degraded gelatin, soluble collagen, and Hide Powder Azure, and showed weak activity on casein, but did not degrade insoluble collagen or elastin. Ecc proteases appear capable of degrading at least one type of cell wall protein in vitro, but we were unable to obtain evidence that these proteases can attack cell wall proteins in muro. The results indicate that some glycosidic alkali- labile bonds have to be broken befor Ecc proteases can degrade cell wall proteins. Thus, these proteases may play a role in cell wall degradation only when acting in concert with other enzymes that split glycosidic bonds.

  2. First report of "Candidatus Liberibacter solanacearum" infecting eggplant in Honduras

    Science.gov (United States)

    In May of 2012, eggplant (Solanum melongena) plants in an experimental research plot located at Zamorano in the Department of Francisco Morazán, Honduras, were observed with symptoms that included leaf chlorosis and cupping, overall stunting, and production of small and malformed fruits. The researc...

  3. First report of "Candidatus Liberibacter solanacearum" on pepper in Honduras

    Science.gov (United States)

    In 2012, bell pepper (Capsicum annuum) plants exhibiting symptoms that resembled those of the bacterium “Candidatus Liberibacter solanacearum” infection were observed in commercial pepper fields in several departments in Honduras, including Francisco Morazán, Ocotepeque, El Paraíso, and Olancho. Man...

  4. First report of 'Candidatus Liberibacter solanacearum' on tomato in Honduras

    Science.gov (United States)

    In April of 2012, tomato plants grown in several departments of Honduras, were observed with symptoms resembling those of “Candidatus Liberibacter solanacearum” (Lso) infection. The symptoms include overall chlorosis, severe stunting, leaf cupping, excessive branching of axillary shoots, and leaf pu...

  5. Neuropatia experimental por DDT: análise de nervo por microdissecção de fibras

    Directory of Open Access Journals (Sweden)

    Edison Matos Nóvak

    1984-09-01

    Full Text Available Estudou-se o nervo gênito-femural do rato albino submetido a intoxicação crônica por DDT, administrado por 180 dias na dose de 5 mg/kg de peso via oral. Os resultados mostraram proporção anormal de fibras tipo C, sendo sugerido ocorrer degeneração tipo axonal determinada pelo DDT.

  6. Por y para en los manuales de ELE

    Directory of Open Access Journals (Sweden)

    Sidoti, Rossana

    2008-12-01

    Full Text Available La oposición por / para es una de las cuestiones gramaticales que comportan mayor dificultad a la hora de acercarse al estudio del español como L2 sobre todo cuando remiten a conceptos lingüísticos difíciles de entender por no tener ésta referente alguno en el mundo extralingüístico. Si, por un lado, nos resulta fácil entender lo que tiene un referente en el mundo concreto; por otro, no podemos advertir el referente extralingüístico de preposiciones como por / para, si este no existe. Si las preposiciones son elementos abstractos, difíciles de aferrar de por sí, podemos sólo examinar los elementos que éstas ponen en relación y en qué contextos esta relación se determina. Para poder utilizar con precisión las dos preposiciones, es importante no reducirlas a una sola preposición como ocurre en otros idiomas, y sobre todo no relacionarlas sólo a los conceptos de causa y finalidad. Este trabajo se propone individualizar los manuales de español como lengua extranjera más utilizados en las universidades italianas para luego comparar las distintas fuentes de información sobre por / para y exponer comentarios, reflexiones y sugerencias sobre el tema con el fin de precisar en qué medida se puede mejorar lo que los manuales reducen o generalizan, puesto que para los estudiantes de ELE estos representan una herramienta valiosa a la que acudir.

  7. Evaluation of antimicrobial activity of silver nanoparticles synthesized from Piper betle leaves against human and plant pathogens

    Science.gov (United States)

    Jha, Babita; Rao, Mugdha; Prasad, K.; Jha, Anal K.

    2018-05-01

    The present work encompasses the fabrication of biocompatible silver nanoparticles from the leaves of the medicinal plant Piper betle using green chemistry approach. The synthesized nanoparticles were characterized by different standard techniques like: UV-visible spectroscopy, X-ray diffraction, scanning electron microscopy and Fourier transformed infrared spectroscopy. The antimicrobial efficacy of the silver nanoparticles was assessed against human and plant pathogens namely Ralstonia solanacearum, Burkholderia gladioli, Escherichia coli and Sacchromyces cerevisiae by agar well diffusion method. The obtained results clearly indicate its possible use as an alternative to antibiotics and pesticides in near future.

  8. Actinomicetos aislados del compost y su actividad antagonista a fitopatógenos de la papa (Solanum tuberosum spp. andigena Hawkes)

    OpenAIRE

    Pérez-Rojas, Fernanda; León-Quispe, Jorge; Galindo-Cabello, Nadia

    2015-01-01

    Una de las formas de control de fitopatógenos es a través del uso de microorganismos antagonistas. El compost, un producto orgánico es fuente de microorganismos capaces de producir metabolitos secundarios de interés agrícola. Se aislaron y evaluaron mediante cultivos in vitro la capacidad antagonista de 85 actinomicetos frente a fitopatógenos que afectan a Solanum tuberosum. De los aislados, 23.5% tuvieron actividad antagonista a Ralstonia solanacearum, 16.4% a Pectobacterium carotovorum, 43....

  9. Riesgos antrópicos generados por la actividad minera

    Directory of Open Access Journals (Sweden)

    Ana Violeta Argüello Mejía

    2013-10-01

    Full Text Available Las actividades productivas generan riesgos antrópicos [1] a mediano y largo plazo. La zona de estudio se ubica en las Parroquias de Pomasqui, San Antonio y Calacalí, donde se han producido riesgos debido a las actividades humanas, en este caso, por la explotación de las canteras para abastecer el mercado de la construcción del Distrito Metropolitano de Quito. La investigación propone determinar los riesgos antrópicos generados por la actividad minera. Los pobladores de la zona identifican que la minería artesanal en sus inicios constituyó una fuente de trabajo, donde sus familias también se involucraban. Actualmente, se observa que en la mayoría de las canteras se utiliza maquinaria especializada y no participan los trabajadores de la zona. Los taludes de las canteras son de 80o y 90o grados, generando amenazas para los trabajadores y moradores de las viviendas aledañas. Uno de los mayores impactos es la contaminación del aire, sin embargo, el suelo y los cursos de agua están siendo afectados por los desperdicios que produce la actividad minera. La población, que está expuesta permanentemente al polvo ocasionado por las canteras y al transporte de material, acusa enfermedades de tipo respiratorio. Así mismo, el ruido ocasionado por el transporte constituye una molestia constante para los pobladores.

  10. Itinerario de la Patria: por tierras del golfo lejano

    Directory of Open Access Journals (Sweden)

    Adel López Gómez

    1965-06-01

    Full Text Available Veinticinco años atrás solo primaba en estas infinitudes el imperio de la selva. Desde Dabeiba tórrido hasta Turbo sudoroso y lacustre se empleaba casi una semana a lomo de mula o a quimba de peatón, por una sombría trocha de miasmas y de lodo, abierta a machete por entre la áspera e interminable manigua. Por allí pasaron una y otra vez los pálidos hombres de nuestros enganches, cuando en 1939 iniciamos, a la orilla del Golfo de Urabá, la ingente tarea de construír una carretera hacia el interior para poner al alcance de las llantas antioqueñas la orilla salvaje del Atlántico maicero.

  11. Micetoma pulmonar por Scedosporium sp, reporte de dos casos

    Directory of Open Access Journals (Sweden)

    José G. Somocurcio

    2009-07-01

    Full Text Available Se reporta los dos primeros casos de micetoma pulmonar por Scedosporium sp, en el Perú, tratados quirúrgicamente en el Hospital Nacional Hipólito Unanue. Se practicó resección pulmonar debido a micetoma pulmonar de donde se tomó muestras que fueron enviadas a microbiología y anatomía patológica para cultivo y estudio histopatológico. Se identificó el moho Scedosporium sp en dos pacientes con secuelas cavitarias por tuberculosis, quienes presentaron tos y hemoptisis de dos meses y tres años de evolución, respectivamente. Radiológicamente las cavidades estaban ocupadas por una "bola fúngica". La histopatología indicó presencia de abundantes hifas, indistinguibles de las de Aspergillus sp, mientras que la inmunodifusión para Aspergillus fue negativa.

  12. Retinitis por citomegalovirus en un paciente con VIH

    Directory of Open Access Journals (Sweden)

    Alena de los Ángeles Vejerano Duany

    Full Text Available La retinitis por citomegalovirus es la infección ocular más frecuente en pacientes con un recuento de linfocitos CD4 inferior a 200 por µL. El aspecto oftalmoscópico de las lesiones se caracteriza, en la mayoría de los casos, por infiltrados retinianos resultados de la necrosis retiniana producida por citomegalovirus y el edema en asociación con hemorragias. Estas lesiones se disponen, por lo general, siguiendo las arcadas vasculares temporales con invasión hacia la mácula. Se presentó una paciente de 24 años de edad, femenina, blanca, ama de casa, con antecedentes patológicos personales oculares sin datos de interés, y antecedentes patológicos personales generales de ser diagnosticadas con VIH. Hace cuatro años que comenzó con tratamiento antirretroviral, y tuvo cambios de tratamiento en dos ocasiones. El último fue impuesto en mayo del año 2011, con el cual presentó mala adherencia terapéutica, y comenzó desde entonces a presentar disminución de su peso corporal de forma marcada en breve período de tiempo. Refiere que desde hace unos meses comenzó a presentar una disminución progresiva de la agudeza visual en el ojo derecho, acompañado de visión borrosa. Adquiere gran importancia este caso, ya que ante la supervivencia de los pacientes con sida, va a ser cada vez más frecuente la aparición de las afecciones oculares relacionadas con esta enfermedad. Dentro de ellas se encuentran las infecciones oportunistas mayores como la retinitis por citomegalovirus.

  13. ¿Por qué hay canciones que perduran?

    Directory of Open Access Journals (Sweden)

    Josune Albisu Barandiaran

    2015-11-01

    Full Text Available El principal objetivo de este artículo es analizar una canción, Txoria txori, para deducir cuales han sido las principales características que la han convertido en “Himno popular”, permitiéndola perdurar en el tiempo. Dentro de las principales características, dos han sido verdaderamente reseñables: por una parte, la plasticidad, y por otra, la sencillez y estructura clara de la canción.

  14. Responsabilidad civil por accidentes en espectáculos taurinos

    OpenAIRE

    Caballero Moreno, María Araceli

    2016-01-01

    El trabajo versa sobre la responsabilidad civil aplicada al campo de los espectáculos taurinos, explicando el régimen de responsabilidad aplicable, regulado en el art. 1.902 de nuestro Código Civil, centrándose especialmente en quién debe asumir la responsabilidad en caso de producirse daños a los espectadores del festejo por los propios animales, si la propia víctima por haber llevado a cabo una conducta imprudente aplicando la teoría de la asunción del riesgo o los organizadores del festejo...

  15. Mortalidad por paludismo en Colombia, 1979-2008

    OpenAIRE

    Pablo Chaparro; Julio Padilla

    2012-01-01

    Introducción. En Colombia, el paludismo representa un grave problema de salud pública. Se estima que, aproximadamente, 60 % de la población se encuentra en riesgo de enfermar o de morir por esta causa. Objetivo. Describir la tendencia de la mortalidad por paludismo en Colombia desde 1979 hasta 2008. Materiales y métodos. Se llevó a cabo un estudio descriptivo para determinar la tendencia de las tasas de mortalidad. Las fuentes de información fueron las bases de datos de las defunciones...

  16. Por qué todas las cuentas son falsas

    OpenAIRE

    Aerde, Michel van

    1994-01-01

    Los principales criterios para evaluación y decisión, en la sociedad actual, son inspirados por cálculos económicos. Mucho nos preocupamos de cuentas pero muy poco nos preguntamos de lo que es el dinero. Muy poco reflexionamos filosóficamente, ontológicamente, sobre la naturaleza misma del dinero. ¿Qué es esto que pretende ser la base de nuestra sociedad? El dinero es mentiroso por naturaleza. Es una representación de mucha vida, que no puede ser representada. El dinero es peligroso, se convi...

  17. Riesgos antrópicos generados por la actividad minera

    OpenAIRE

    Ana Violeta Argüello Mejía; Enriqueta Cantos Aguirre; Jorge Vitery Moya

    2013-01-01

    Las actividades productivas generan riesgos antrópicos [1] a mediano y largo plazo. La zona de estudio se ubica en las Parroquias de Pomasqui, San Antonio y Calacalí, donde se han producido riesgos debido a las actividades humanas, en este caso, por la explotación de las canteras para abastecer el mercado de la construcción del Distrito Metropolitano de Quito. La investigación propone determinar los riesgos antrópicos generados por la actividad minera. Los pobladores de la zona identifican qu...

  18. Elasticidad precio de la demanda por autopistas interurbanas en Chile

    OpenAIRE

    Rodrigo Sanes; German Lobos

    2013-01-01

    La efectividad de un esquema de tarificación vial para optimizar el uso de infraestructura de transporte depende de la información que se disponga respecto a la elasticidad precio de la demanda por el uso de puentes, túneles y carreteras. El objetivo de este trabajo es estimar la elasticidad precio de la demanda por el uso de autopistas interurbanas en Chile utilizando el método de regresiones aparentemente no relacionadas (SUR) y un panel de 48 datos mensuales obtenidos a partir de 21 plazas...

  19. Contractura axilar por quemadura tratada con Integra®

    OpenAIRE

    Roa G,Ricardo; Las Heras F,Rocío; Piñeros B,José L; Correa S,Gerardo; Norambuena B,Hernán; Marré N,Diego

    2011-01-01

    Las quemaduras axilares severas son un accidente infrecuente que evolucionan a la retracción generando deficiencias cosméticas y funcionales. Estas cicatrices son difíciles de tratar por las características anatómicas del área, donde la corrección de un vector de movimiento puede alterar otro. Objetivo: Mostrar nuestros resultados utilizando el sustituto cutáneo Integra® en el tratamiento de cicatrices retráctiles axilares por quemadura. Pacientes y Métodos: Se recolectaron antecedentes médic...

  20. Síndrome oculoglandular de Parinaud causada por esporotricose

    OpenAIRE

    Ribeiro,Alexandre Sampaio de Abreu; Bisol,Tiago; Menezes,Marcela Sant'Ana

    2010-01-01

    A síndrome oculoglandular de Parinaud é uma doença ocular rara causada por diferentes agentes etiológicos, entre eles bactérias, vírus e fungos. É caracterizada por uma conjuntivite granulomatosa, acompanhada de linfadenopatia pré-auricular adjacente e pode trazer sequelas caso não seja prontamente tratada. Neste artigo é relatado o caso de uma jovem técnica de enfermagem e estudante de medicina veterinária apresentando a síndrome oculoglandular de Parinaud causada pelo fungo Sporothrix schen...

  1. Mastitis bovina causada por Staphylococcus coagulasa negativos

    OpenAIRE

    Bonetto, César C.

    2014-01-01

    El presente Trabajo de Tesis se desprende como una línea de investigación del grupo de la UNRC dedicado al estudio de la problemática de la mastitis bovina tanto en aspectos básicos como aplicados con estudios genéticos, epidemiológicos y de virulencia de los principales microorganismos involucrados en la mastitis bovina. Staphylococccus coagulasa negativo (SCN) es un grupo bacteriano formado por varias especies que por lo general eran considerados flora oportunista de la piel y age...

  2. Una vuelta al mundo por la educación

    OpenAIRE

    Francisco Amat, Andrea; Molins, María

    2008-01-01

    La Barcelona World Race es una nueva regata vuelta al mundo con dos tripulantes por embarcación y sin escalas en ningún puerto. El pisto letazo de salida se dio el pasado 11 de noviem bre en el Port Olimpic de Barcelona, lugar a donde regresarán los navegantes tras recorrer 25.000 millas, es decir 47.000 kilómetros, por los océanos más hostiles y desafiantes del mundo en monocascos de última generación de la clase IMOCA Open 60. En esta primera edición, participan nueve equipos y uno de ellos...

  3. Neumonitis por hipersensibilidad en la ciudad de México

    Directory of Open Access Journals (Sweden)

    Carrillo-Rodríguez José G.

    2000-01-01

    Full Text Available OBJETIVO: Determinar la asociación entre la zona urbana de origen del paciente en la ciudad de México y la prevalencia de neumonitis por hipersensibilidad inducida por antígeno aviario. MATERIAL Y MÉTODOS: Se trata de un estudio de casos y controles realizado en el Instituto Nacional de Enfermedades Respiratorias, en la ciudad de México, en el año de 1999. Se estudiaron 109 casos con neumonitis por hipersensibilidad y 184 controles: de éstos, 39, con fibrosis pulmonar idiopática; 63, con tuberculosis pulmonar, y 82, con asma. La ciudad de México y las zonas conurbadas se dividieron en cinco zonas geográficas: centro, noreste, sureste, noroeste y el suroeste. Se calcularon las prevalencias de las diferentes enfermedades por zona urbana de los pacientes que participaron en el estudio; como medida de asociación, se estimó la razón de momios, con un intervalo de confianza al 95%. Asimismo, se realizó regresión logística múltiple ajustando por edad, sexo y estrato socioeconómico. RESULTADOS: Ochenta casos de neumonitis por hipersensibilidad se concentraron en el sur del noreste de las zonas conurbadas y la parte norte del sureste de la ciudad de México, 48 y 32, respectivamente (RM= 3.86, IC 95% 2.17-6.96. Treinta y seis controles de asma se localizaron en el suroeste de la ciudad de México, zona donde se ubica el Intituto Nacional de Enfermedades Respiratorias (p<0.05 y cuatro en la zona conurbada. Los controles de tuberculosis pulmonar y fibrosis pulmonar idiopática estuvieron dispersos en la ciudad de México y en las zonas conurbadas. CONCLUSIONES: La zona sur del noreste y el norte de la sureste están asociadas a la neumonitis por hipersensibilidad. Las causas de esta asociación no parece ser geográfica, pero existe el antecedente de que esa zona fue basurero de la ciudad, por lo que partículas orgánicas en el ambiente pudieran coadyuvar a la aparición de esta enfermedad.

  4. To be or not to be a poly(3-hydroxybutyrate) (PHB) depolymerase: PhaZd1 (PhaZ6) and PhaZd2 (PhaZ7) of Ralstonia eutropha, highly active PHB depolymerases with no detectable role in mobilization of accumulated PHB.

    Science.gov (United States)

    Sznajder, Anna; Jendrossek, Dieter

    2014-08-01

    The putative physiological functions of two related intracellular poly(3-hydroxybutyrate) (PHB) depolymerases, PhaZd1 and PhaZd2, of Ralstonia eutropha H16 were investigated. Purified PhaZd1 and PhaZd2 were active with native PHB granules in vitro. Partial removal of the proteinaceous surface layer of native PHB granules by trypsin treatment or the use of PHB granules isolated from ΔphaP1 or ΔphaP1-phaP5 mutant strains resulted in increased specific PHB depolymerase activity, especially for PhaZd2. Constitutive expression of PhaZd1 or PhaZd2 reduced or even prevented the accumulation of PHB under PHB-permissive conditions in vivo. Expression of translational fusions of enhanced yellow fluorescent protein (EYFP) with PhaZd1 and PhaZd2 in which the active-site serines (S190 and Ser193) were replaced with alanine resulted in the colocalization of only PhaZd1 fusions with PHB granules. C-terminal fusions of inactive PhaZd2(S193A) with EYFP revealed the presence of spindle-like structures, and no colocalization with PHB granules was observed. Chromosomal deletion of phaZd1, phaZd2, or both depolymerase genes had no significant effect on PHB accumulation and mobilization during growth in nutrient broth (NB) or NB-gluconate medium. Moreover, neither proteome analysis of purified native PHB granules nor lacZ fusion studies gave any indication that PhaZd1 or PhaZd2 was detectably present in the PHB granule fraction or expressed at all during growth on NB-gluconate medium. In conclusion, PhaZd1 and PhaZd2 are two PHB depolymerases with a high capacity to degrade PHB when artificially expressed but are apparently not involved in PHB mobilization in the wild type. The true in vivo functions of PhaZd1 and PhaZd2 remain obscure. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

  5. Uso das diretrizes para tratamento da úlcera por pressão por enfermeiros de um hospital geral

    Directory of Open Access Journals (Sweden)

    Elaine Maria Leite Rangel

    2009-03-01

    Full Text Available Este estudo objetivou identificar a freqüência do uso das diretrizes para o tratamento da úlcera por pressão(UP por enfermeiros de um hospital geral no interior do estado de São Paulo. É transversal de caráterdescritivo com análise quantitativa de dados. Amostra de 25 enfermeiros. Para a coleta de dados utilizou-se uminstrumento, construído a partir das diretrizes para o tratamento da UP. As questões foram relacionadas aostipos de intervenções usadas pelos enfermeiros para o tratamento da UP em estágio I, II, com necrose e comtecido de granulação. Para UP em estágio I, 24 (96% enfermeiros sempre realizavam a mudança de decúbito.Nas úlceras em estágio II a utilização de óleos vegetais na ferida era realizada sempre por 10 (40%enfermeiros e o curativo de hidrocolóide nunca era utilizado por 12 (57,1% enfermeiros. Em UP com necrose alimpeza com povidine era realizada por 4 (17,4% enfermeiros às vezes. Para o desbridamento, 16 (64% àsvezes utilizavam papaína e 15 (71,4% às vezes utilizavam colagenase. Em úlceras com tecido de granulaçãosempre era utilizado o soro fisiológico por 25 (100% enfermeiros. Houve variação nas práticas para otratamento da UP e falta de adesão às diretrizes.

  6. System design description for portable 1,000 CFM exhauster Skids POR-007/Skid E and POR-008/Skid F

    International Nuclear Information System (INIS)

    Nelson, O.D.

    1998-01-01

    The primary purpose of the two 1,000 CFM Exhauster Skids, POR-007-SKID E and POR-008-SKID F, is to provide backup to the waste tank primary ventilation systems for tanks 241-C-106 and 241-AY-102, and the AY-102 annulus in the event of a failure during the sluicing of tank 241-C-106 and subsequent transfer of sluiced waste to 241-AY-102. This redundancy is required since both of the tank ventilation systems have been declared as Safety Class systems

  7. Del significado responsabilidad de los socios en las compañías mercantiles por acciones y por cuotas.

    Directory of Open Access Journals (Sweden)

    Jorge Payome Suárez

    2003-01-01

    Full Text Available El comentario presentado, además de constituir una guía útil para los socios de compañías mercantiles por acciones y por cuotas, en un aspecto de indudable importancia para ellos, cual es el de su eventual responsabilidad, se erige como una herramienta provechosa para estudiantes y profesionales interesados en el tema. La experiencia académica y docente del autor del ensayo aseguran un análisis autorizado de la materia.

  8. La mortalidad por enfermedades del corazón y por reumatismo en la ciudad de bogotá

    OpenAIRE

    Bejarano, Jorge

    2012-01-01

    La alta cifra de mortalidad por enfermedades cardio-vasculares está indicando la urgencia de una campana para contener sus avances. De todas las adquisiciones sanitarias, ninguna ha tenido el alcance y los resultados admirables de los centros o dispensarios destinados al tratamiento de una enfermedad y a la educación del enfermo. Nadie podrá pues, dudar que los dispensarios o consultorios de enfermedades cardio-vasculares, sea una de las armas más eficaces en la lucha contra la mortalidad por...

  9. Signos Vitales de los CDC-Muertes por intoxicación por alcohol (Alcohol Poisoning Deaths)

    Centers for Disease Control (CDC) Podcasts

    2015-01-06

    Este podcast se basa en la edición de enero del 2015 del informe Signos Vitales de los CDC. En los Estados Unidos, mueren en promedio seis personas cada día debido a la intoxicación por alcohol. Infórmese sobre lo que puede hacer para prevenir los atracones de alcohol y las intoxicaciones por alcohol.  Created: 1/6/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 1/6/2015.

  10. Levantamiento del proceso de registros contables por causación de las cuentas por cobrar a clientes

    OpenAIRE

    Mayele-Rodríguez, Luz

    2013-01-01

    De igual forma el Proyecto de Mejora de Procesos a elaborar, desarrollar e implementar en el Área Administrativa y Financiera del Centro de Pinturas Automotriz “LMS”, es realizar el levantamiento del Proceso de Registros Contables por Causación de las cuentas por cobrar a clientes. Lo anterior se puede desarrollar a partir de un poder de negociación con proveedores que incluye entre otros los siguientes factores : El plazo alcanzado en la negociación de compras de insumos, materias primas, co...

  11. "Efecto del ingreso obtenido por el socio industrial por concepto de alimentos en la sociedad en nombre colectivo"

    OpenAIRE

    Adame Alba, Nayzeth

    2011-01-01

    Hoy en día la excesiva carga tributaria en nuestro país, nos obliga a buscar alternativas factibles y seguras, en el cumplimiento de las obligaciones fiscales, por ello, debemos aprovechar la existencia de figuras jurídicas útiles para la optimización de recursos financieros dentro del marco de ley, es el caso de la sociedad en nombre colectivo, que nos permite la existencia de socios industriales que a su vez, el ingreso que perciben por concepto de alimentos se encuentra exento de impuestos...

  12. La discapacidad entre poblaciones refugiadas y afectadas por conflictos

    OpenAIRE

    Reilly, Rachael

    2010-01-01

    La Comisión de Mujeres Refugiadas lanzó en el año 2007 un importante proyecto de investigación para evaluar la situación de las personas con discapacidad entre las poblaciones desplazadas o afectadas por conflictos.

  13. Rotura neumática de colon por aire comprimido

    OpenAIRE

    VITÓN H,REBECA; QUADROS B,PEDRO; RODRÍGUEZ M,JOSÉ ANTONIO

    2010-01-01

    La ruptura del colon causada por aire comprimido a alta presión es rara. A propósito de un caso se revisan los mecanismos de producción, tipos de roturas, clínica, diagnóstico y tratamiento de estos traumatismos.

  14. Endoftalmitis poscirugía de catarata por Sphingomonas paucimobilis

    Directory of Open Access Journals (Sweden)

    Omar Mauri Garrido

    Full Text Available Se presenta la caracterización y manejo terapéutico de un caso de endoftalmitis bacteriana posoperatoria causada por el germen Sphingomonas paucimobilis. La endoftalmitis es la inflamación de los tejidos intraoculares, considerada como la más devastadora de las complicaciones posoperatorias; posee pronóstico visual muy reservado y un elevado riesgo de secuela. Las Sphingomonas paucimobilis son bacterias gramnegativas con forma de bacilo, quimioheterótrofa y estrictamente aerobias que causan enfermedades en los seres humanos, principalmente infecciones hospitalarias que típicamente son tratadas fácilmente con antibióticos. Por sus capacidades biodegradantes y biosintéticas, son pocos los reportes hallados de infección intraocular por este germen. El pronóstico visual es favorable con un diagnóstico precoz y la aplicación del tratamiento adecuado. En este artículo se presentan un caso de endoftalmitis poscirugía de catarata por Sphingomonas paucimobilis reportado en Cuba en el mes de septiembre de 2009.

  15. Principais gestos esportivos executados por jogadores de handebol

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Hespanhol Junior

    2012-09-01

    Full Text Available Este estudo teve como objetivo quantificar os principais gestos esportivos executados por jogadores profissionais de handebol. Para a mensuração quantitativa dos principais movimentos executados por cada jogador de handebol avaliado foram realizadas gravações de vídeo em todos os jogos. Foram realizados em média 1288,0 (DP = 190,7 gestos esportivos por jogo. Os armadores centrais realizaram em média 375,0 (DP = 83,7 gestos esportivos, e a posição de pivô 63,3 (DP = 21,2 gestos por jogo. As recepções e os passes foram os gestos mais executados, e a posição que mais realizou gestos esportivos na equipe de handebol avaliada foi o armador central, seguido do armador esquerdo e direito. O pivô foi a posição que menos realizou gestos esportivos.

  16. Algunos aspectos relacionados con las enfermedades tropicales transmitidas por moluscos

    Directory of Open Access Journals (Sweden)

    A. Mijail Pérez

    1999-12-01

    Full Text Available Muchas especies de moluscos son hospedantes de diversos parásitos que provocan infecciones muy serias e incluso mortales en seres humanos y ganado. La esquistosomiasis extendida por 74 países, infecta a unos 200 millones de personas y está en segundo lugar, después de la malaria, como causa de la mortalidad humana originada por parásitos. La infección es causada por un platelminto que se desarrolla en caracoles de agua dulce y que desde el agua puede penetrar en la piel de un ser humano y desarrollarse dentro de sus órganos, produciendo distintos grados de infección, hasta provocar la muerte. Distintas especies de esos caracoles están extendidas por Centro América. El cólera, otra enfermedad que también es mortal, se ha encontrado en moluscos bivalvos comestibles colectados en el Golfo de Nicoya, que bordea Nicaragua y Costa Rica Estas epidemias se pueden combatir con diversos métodos de control de los caracoles hospedantes de parásitos.

  17. Relatos cortos escritos por mujeres en el siglo XIX

    Directory of Open Access Journals (Sweden)

    Marta Giné

    2014-04-01

    Full Text Available A propósito de la obra editada por Concepción Palacios y Pedro Méndez, Femmes nouvellistes françaises du XIXesiècle(Berna, Peter Lang, coll. « Espacios literarios en contacto », vol. 4, 2013, 366 p. ISBN: 978-3-0343-1409-1.

  18. Immunogenicity of meningococcal PorA antigens in OMV vaccines

    NARCIS (Netherlands)

    Luijkx, T.A.

    2006-01-01

    For the prevention of meningococcal infection caused by group B meningococci, the Netherlands Vaccine Institute (NVI) has developed a hexavalent Porin A (PorA) based Outer Membrane Vesicle (OMV) vaccine (Hexamen). In various clinical studies with HexaMen, differences in the immune responses to the

  19. Celulitis por Microascus trigonosporus(anamorfo Scopulariopsis trigonospora

    Directory of Open Access Journals (Sweden)

    DELIA CANLE CORTIÑAS

    2013-06-01

    Full Text Available Resumen: Microascus trigonosporus ( anamorfo Scopulariopsis trigonospora es un hongo filamentoso ubicuo que se encuentra en el suelo , plumas de aves, material vegetal e insectos. Aunque Scopulariopsis spp se consideran comúnmente hongos contaminantes , pueden causar ocasionalmente infecciones en humanos, en especial onicomicosis . Excepcionalmente se han descrito infecciones de piel, abscesos cerebrales, endocarditis ,sinusitis e infecciones diseminadas por Scopulariopsis spp , casi siempre en pacientes inmunodeprimidos . En los últimos años se han publicado un mayor número de casos de infecciones oportunistas por Scopulariopsis spp y otros hialohifomicetos multiresistentes. Todavía no está establecido cuál es el mejor régimen de tratamiento para las infecciones por Scopulariopsis spp. Presentamos un caso excepcional de celulitis por Microascus trigonosporus en un paciente con tratamiento prolongado con corticoides. Abstract: Microascus trigonosporus ( Anamorph Scopulariopsis trigonospora is a cosmopolitan filamentous fungus that inhabits soil, feathers ,plant material and insects. While Scopulariopsis is commonly considered as a contaminat fungus it may cause occasionally infections in humans ,especially onychomycosis .Skin lesions, brain abscess , endocarditis, sinusitis and disseminated infections due to Scopulariopsis species have been rarely reported , usually in immunocompromised patients . Over the last few years opportunistic infections by Scopulariopsis species and others multi-resistant hyalohyphomycetes have been increasingly reported . No clear treatment regimen for Scopulariopsis species infections has been established yet. We present a exceptional case of cellulitis due to Microascus trigonosporus in a patient with prolonged steroid therapy.

  20. Analisis cualitativo asistido por computadora Computer-assisted qualitative analysis

    Directory of Open Access Journals (Sweden)

    César A. Cisneros Puebla

    2003-01-01

    Full Text Available Los objetivos de este ensayo son: por un lado, presentar una aproximación a la experiencia hispanoamericana en el Análisis Cualitativo Asistido por Computadora (ACAC al agrupar mediante un ejercicio de sistematización los trabajos realizados por diversos colegas provenientes de disciplinas afines. Aunque hubiese querido ser exhaustivo y minucioso, como cualquier intento de sistematización de experiencias, en este ejercicio son notables las ausencias y las omisiones. Introducir algunas reflexiones teóricas en torno al papel del ACAC en el desarrollo de la investigación cualitativa a partir de esa sistematización y con particular énfasis en la producción del dato es, por otro lado, objetivo central de esta primera aproximación.The aims of this article are: on the one hand, to present an approximation to the Hispano-American experience on Computer-Assisted Qualitative Data Analysis (CAQDAS, grouping as a systematization exercise the works carried out by several colleagues from related disciplines. Although attempting to be exhaustive and thorough - as in any attempt at systematizing experiences - this exercise presents clear lacks and omissions. On the other hand, to introduce some theoretical reflections about the role played by CAQDAS in the development of qualitative investigation after that systematization, with a specific focus on data generation.

  1. Muerte cerebral causada por consumo de psicofármacos

    OpenAIRE

    Iglesias Rozas, José Rafael, 1942-

    1987-01-01

    Tres imágenes de una biopsia de un cerebro en estado de muerte cerebral causada por consumo de psicofármacos. Three pictures of a biopsy of a brain that has died because of consumption of psychoactive drugs.

  2. Violência e mortes por causas externas

    Directory of Open Access Journals (Sweden)

    Graciete Oliveira Vieira

    2003-02-01

    Full Text Available Através de um estudo ecológico caracterizou-se a violência e as mortes por causas externas em Salvador e Bahia utilizando-se dados da Fundação Nacional de Saúde-Ministério da Saúde, dos registros de mortalidade e das estimativas populacionais do IBGE. O risco de morrer por homicídio no Brasil é 3 vezes o do Estados Unidos, chegando a ser 40 vezes superior ao do Japão. Homicídio foi a primeira causa de anos potenciais de vidas perdidos (13,4% no Brasil (1997, seguido por acidentes de trânsito (10,6%. Causas externas foi a segunda causa de morte em Salvador e Bahia (1996. A violência tem raízes sócio-culturais e político-ideológicas e pode ser prevenida por ações intersetoriais e multidisciplinares.

  3. Mortalidad por envenenamiento en niños

    Directory of Open Access Journals (Sweden)

    Híjar Martha

    1998-01-01

    Full Text Available Objetivo. Conocer el panorama de las muertes por envenenamiento en niños de 0-14 años ocurridas en la República mexicana, entre 1979 y 1994. Material y métodos. Se utilizaron fuentes secundarias. Las variables analizadas fueron: edad, sexo, año, causa externa de traumatismos y envenenamientos, de la IX Clasificación Internacional de Enfermedades: E850-E858, E860-E869 y E905. Mediante un modelo de regresión Poisson se analizaron tendencias por causa específica y se obtuvieron riesgos relativos según edad, sexo y entidad federativa. Resultados. Hubo un total de 11 272 defunciones en menores de 15 años; las principales causas fueron el envenenamiento y las reacciones tóxicas causadas por plantas y animales venenosos (E905, el envenenamiento accidental por gas de uso doméstico y por monóxido de carbono (E868 y el envenenamiento accidental por otras drogas (E858. El grupo de edad que presentó los mayores riesgos, para las causas mencionadas, fue el de menores de un año con un riesgo relativo (RR de 29.6, IC95% 29.2-33.4; RR 3.47, IC95% 2.86-4.22, y RR 31.86, IC95% 24.8-40.9. El riesgo fue similar en ambos sexos, salvo para la causa E905. El estado de Aguascalientes se situó sistemáticamente entre los de mayor riesgo para todas las causas analizadas, mientras que Nuevo León siempre se ubicó entre los de riesgo más bajo. Conclusiones. El envenenamiento constituye una importante causa de muerte en los niños; el riesgo se incrementa al disminuir la edad. Considerando que esas muertes son potencialmente evitables y que la mayor parte de los envenenamientos ocurren en el hogar, para prevenirlos, se recomienda a los familiares vigilar y mantener fuera de peligro al niño. Por otra parte, la multicausalidad del fenómeno requiere que su prevención se realice desde una perspectiva multidisciplinaria que genere una cultura y un ambiente de seguridad en la sociedad.

  4. Mortalidade por leucemias relacionada à industrialização

    Directory of Open Access Journals (Sweden)

    Leal Carmen Helena Seoane

    2002-01-01

    Full Text Available OBJETIVO: Analisar a distribuição espacial da mortalidade por leucemia na população, buscando identificar agregados e estabelecer sua relação com os níveis de industrialização. MÉTODOS: O estudo foi realizado nas 43 regiões de governo do Estado de São Paulo, no qüinqüênio 1991-1995. Foi construído um "índice de industrialização relativo à leucemia" (IIRL baseado no número de indústrias e empregos industriais por 100.000 habitantes, valor adicionado fiscal, variedade de ramos industriais e indústrias com potenciais exposições de risco para a leucemia. O IIRL foi distribuído em cinco categorias. Verificaram-se os coeficientes padronizados de mortalidade por leucemia em cada uma das regiões, também distribuídos em cinco categorias e comparados ao mapa IIRL. RESULTADOS: As regiões mais industrializadas em ordem decrescente foram Campinas, Piracicaba, Jundiaí, Sorocaba e São Paulo. Não foi encontrada associação entre mortalidade, por nenhum tipo de leucemia, e industrialização. A região de Jales foi a que apresentou o mais alto coeficiente padronizado de mortalidade por leucemia. CONCLUSÕES: A distribuição da mortalidade por leucemia ocorreu de forma homogênea no Estado de São Paulo, não apresentando correlação com o nível de industrialização. Entretanto, aspectos relacionados ao método epidemiológico adotado -- estudo ecológico -- e ao uso do parâmetro "mortalidade por leucemia", doença cujo prognóstico tem mudado muito nas últimas décadas, limitaram a interpretação dos resultados.

  5. Transmisión de Anaplasma marginale por garrapatas

    Directory of Open Access Journals (Sweden)

    Kelly A. Brayton

    2012-01-01

    Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.

  6. Morbilidad oculta por parasitismo intestinal en Lagunita, municipio Girardot, Venezuela

    Directory of Open Access Journals (Sweden)

    Yanelis Núñez Gómez

    2014-08-01

    Full Text Available Se realizó un estudio epidemiológico descriptivo de corte transversal, con el objetivo de determinar la morbilidad oculta por parasitismo intestinal en Lagunita, municipio Girardot, Venezuela; en el período de enero a octubre de 2009. El universo fue de 286 niños, lo que se corresponde con la población total del grupo de edad de menores de 15 años. De estos se seleccionaron por muestreo aleatorio simple 43 pacientes, a los que se les aplicó un cuestionario y se confeccionó una guía de observación, para describir los factores epidemiológicos que influyen en la infestación por parasitismo intestinal. Además, se les realizaron análisis de las heces fecales seriadas para el diagnóstico del parasitismo. El método estadístico fue el cálculo de las frecuencias absolutas y relativas. A través del estudio de las heces fecales seriadas se obtuvo que 27 pacientes tenían parasitosis intestinal, para una morbilidad de 62,79%, con una mayor incidencia en los niños de cinco a nueve años de edad. El sexo femenino fue el más afectado. Los factores epidemiológicos que más influyeron fueron: los malos hábitos higiénicos personales, el entorno desfavorable y el consumo de agua no potable; existió relación entre el nivel socioeconómico, los factores epidemiológicos y la morbilidad por parasitismo intestinal. Predominó la parasitosis por Entamoeba Histolytica, con 11 casos, para un 40,74%. La diarrea, las molestias abdominales y la pérdida de apetito constituyeron los principales síntomas

  7. LUCHA POR LA TIERRA EN EL NORTE DE URUGUAY

    Directory of Open Access Journals (Sweden)

    Gabriel Oyhantçabal Benelli

    2011-12-01

    Full Text Available Este artículo analiza la trayectoria de la lucha por la tierra en Bella Unión, una región característica en Uruguay por la producción de caña de azúcar, a través de los movimientos de clase de sus principales protagonistas: los cortadores de caña sindicalizados en la Unión de Trabajadores Azucareros de Artigas (UTAA. El recorrido histórico hace énfasis en dos períodos históricos diferentes: 1961-1973 y 2005-presente. El primero va desde la fundación del sindicato hasta el golpe militar. Se da en un contexto de auge de la lucha de masas en Uruguay en el cual los trabajadores rurales se organizan en la UTAA levantando, entre otras, la bandera de la Reforma Agraria. El segundo período está marcado por la llegada al gobierno nacional del Frente Amplio, una coalición social-demócrata que reactiva la producción de caña de azúcar en Bella Unión. Este cambio supone una oportunidad para las luchas sociales que la UTAA aprovecha con ocupaciones de tierra favoreciendo un proceso de colonización para los trabajadores rurales. Sin embargo el acceso a la tierra genera nuevas contradicciones, y por tanto nuevos desafíos, por los cambios en la forma de subsunción del trabajo al capital.

  8. 161. Necrosis por presión del septo de salida ventricular causado por dos implantes adyacentes

    Directory of Open Access Journals (Sweden)

    A. González Calle

    2012-04-01

    Conclusiones: Esta complicación ilustra que los tejidos entre dos dispositivos duros y con movimiento uno conrespecto al otro pueden desarrollar necrosis por presión y fricción y, consecuentemente, perforación. Probablemente, hubiera sido preferible sustituir el homoinjerto pulmonar con stent en el momento de la sustitución valvular aórtica.

  9. CARACTERÍSTICAS DA VIOLÊNCIA SEXUAL SOFRIDA POR CRIANÇAS ASSISTIDAS POR UM PROGRAMA DE APOIO

    Directory of Open Access Journals (Sweden)

    KELLY LINHARES VASCONCELOS

    2010-01-01

    Full Text Available En Brasil, las estadísticas de la violencia sexual contra niños están lejos de reflejar la verdadera realidad actual debido a la baja notificación de los casos. La finalidad de este estudio fue caracterizar el abuso sexual sufrido por niños asistidos por el Programa Sentinela y el perfil del agresor, en Sobral-Ceará, en el periodo que va del 2002 al 2006. La muestra no probabilística intencional fue compuesta por 50 víctimas de abuso sexual y de las mismas, el 66% es del sexo femenino, con predominio de rango de edad entre 8-12 años incompletos, (58%; en el 36% de los casos los padres están separados, siendo la madre la principal responsable por la familia (62%. La mayoría de los agresores es del sexo masculino (78%. En el ambiente fuera de la familia los agresores son conocidos o amigos de la familia (14%; dentro del seno familiar el padrastro es identificado como siendo el agresor más frecuente (18%. Los datos destacan características similares a las de otros estudios, definiendo una cierta igualdad en este tipo de violencia.

  10. Comparison of the Transcriptomes of Ginger (Zingiber officinale Rosc.) and Mango Ginger (Curcuma amada Roxb.) in Response to the Bacterial Wilt Infection

    Science.gov (United States)

    Prasath, Duraisamy; Karthika, Raveendran; Habeeba, Naduva Thadath; Suraby, Erinjery Jose; Rosana, Ottakandathil Babu; Shaji, Avaroth; Eapen, Santhosh Joseph; Deshpande, Uday; Anandaraj, Muthuswamy

    2014-01-01

    Bacterial wilt in ginger (Zingiber officinale Rosc.) caused by Ralstonia solanacearum is one of the most important production constraints in tropical, sub-tropical and warm temperature regions of the world. Lack of resistant genotype adds constraints to the crop management. However, mango ginger (Curcuma amada Roxb.), which is resistant to R. solanacearum, is a potential donor, if the exact mechanism of resistance is understood. To identify genes involved in resistance to R. solanacearum, we have sequenced the transcriptome from wilt-sensitive ginger and wilt-resistant mango ginger using Illumina sequencing technology. A total of 26387032 and 22268804 paired-end reads were obtained after quality filtering for C. amada and Z. officinale, respectively. A total of 36359 and 32312 assembled transcript sequences were obtained from both the species. The functions of the unigenes cover a diverse set of molecular functions and biological processes, among which we identified a large number of genes associated with resistance to stresses and response to biotic stimuli. Large scale expression profiling showed that many of the disease resistance related genes were expressed more in C. amada. Comparative analysis also identified genes belonging to different pathways of plant defense against biotic stresses that are differentially expressed in either ginger or mango ginger. The identification of many defense related genes differentially expressed provides many insights to the resistance mechanism to R. solanacearum and for studying potential pathways involved in responses to pathogen. Also, several candidate genes that may underline the difference in resistance to R. solanacearum between ginger and mango ginger were identified. Finally, we have developed a web resource, ginger transcriptome database, which provides public access to the data. Our study is among the first to demonstrate the use of Illumina short read sequencing for de novo transcriptome assembly and comparison in

  11. Comparison of the transcriptomes of ginger (Zingiber officinale Rosc.) and mango ginger (Curcuma amada Roxb.) in response to the bacterial wilt infection.

    Science.gov (United States)

    Prasath, Duraisamy; Karthika, Raveendran; Habeeba, Naduva Thadath; Suraby, Erinjery Jose; Rosana, Ottakandathil Babu; Shaji, Avaroth; Eapen, Santhosh Joseph; Deshpande, Uday; Anandaraj, Muthuswamy

    2014-01-01

    Bacterial wilt in ginger (Zingiber officinale Rosc.) caused by Ralstonia solanacearum is one of the most important production constraints in tropical, sub-tropical and warm temperature regions of the world. Lack of resistant genotype adds constraints to the crop management. However, mango ginger (Curcuma amada Roxb.), which is resistant to R. solanacearum, is a potential donor, if the exact mechanism of resistance is understood. To identify genes involved in resistance to R. solanacearum, we have sequenced the transcriptome from wilt-sensitive ginger and wilt-resistant mango ginger using Illumina sequencing technology. A total of 26387032 and 22268804 paired-end reads were obtained after quality filtering for C. amada and Z. officinale, respectively. A total of 36359 and 32312 assembled transcript sequences were obtained from both the species. The functions of the unigenes cover a diverse set of molecular functions and biological processes, among which we identified a large number of genes associated with resistance to stresses and response to biotic stimuli. Large scale expression profiling showed that many of the disease resistance related genes were expressed more in C. amada. Comparative analysis also identified genes belonging to different pathways of plant defense against biotic stresses that are differentially expressed in either ginger or mango ginger. The identification of many defense related genes differentially expressed provides many insights to the resistance mechanism to R. solanacearum and for studying potential pathways involved in responses to pathogen. Also, several candidate genes that may underline the difference in resistance to R. solanacearum between ginger and mango ginger were identified. Finally, we have developed a web resource, ginger transcriptome database, which provides public access to the data. Our study is among the first to demonstrate the use of Illumina short read sequencing for de novo transcriptome assembly and comparison in

  12. Vivencias psicosociales reveladas por niños que reciben tratamiento con quimioterapia por cáncer

    Directory of Open Access Journals (Sweden)

    BLANCA CECILIA VANEGAS DE AHOGADO

    2009-12-01

    Full Text Available Se realizó un estudio cualitativo con el propósito de descubrir las vivencias psicosociales de niños y niñas de 9 a 12 años que recibían tratamiento con quimioterapia por cáncer. La recolección de la información se hizo mediante encuentros lúdicos con el apoyo de algunas preguntas básicas que facilitaron las revelaciones narrativas. Tres aspectos se destacan en los hallazgos del estudio: vivencias desfavorables, vivencias relacionadas con la autoestima y vivencias favorables; las dos primeras, de diversa manera, afectan en estos niños su vida personal, familiar, escolar y, en general, todo su entorno. Es de resaltar que, como consecuencia de la caída del cabello, con frecuencia han sido objeto de burla y de rechazo por sus compañeros de estudio, lo que produce el más notorio efecto sobre su autoimagen; por otra parte, el ausentismo escolar conlleva dificultades académicas y sentimientos de tristeza en estos niños, situación que empeora cuando, por motivos de tratamiento, su lugar de residencia está alejado de la ciudad, viéndose sometidos a largos periodos de separación, no solo de su familia sino de sus pares. Se concluye que la mayor parte de las revelaciones son impactantes por su gran contenido de sufrimiento y dolor para estos niños, lo que demuestra la urgencia de retomar los hallazgos del estudio para orientar el cuidado de enfermería de manera más integral y apoyar para que se haga lo propio en el hogar y en las instituciones educativas.

  13. Trisegmentectomia hepática direita por videolaparoscopia

    Directory of Open Access Journals (Sweden)

    Marcel Autran C. Machado

    Full Text Available INTRODUÇÃO: Em 2007 os autores descreveram a primeira hepatectomia direita por videolaparoscopia realizada no Brasil. Hepatectomia direita ampliada, também conhecida como trisegmentectomia direita, é procedimento altamente complexo e implica em grande retirada do volume hepático. Os autores descrevem a primeira trisegmentectomia direita por videolaparoscopia realizada no Brasil. TÉCNICA: O paciente é colocado em posição supina em decúbito lateral esquerdo. O cirurgião se coloca entre as pernas da paciente. Utilizamos cinco trocartes, três de 12 mm e dois de 5 mm. Devido à embolização prévia da veia porta direita, o hilo hepático não é dissecado. O pedículo portal direito é seccionado com grampeador laparoscópico de carga vascular por meio de acesso intra-hepático, segundo técnica previamente descrita pelos autores. A seguir procede-se a mobilização do fígado direito seguido de dissecção da veia cava retro-hepática e secção da veia hepática direita. Estes passos são realizados sem manobra de Pringle. O fígado é seccionado com combinação de bisturi harmônico e grampeador endoscópico. O pedículo do segmento 4 é seccionado dentro do fígado. O espécime é retirado por meio de incisão supra-púbica e a área cruenta é revista para verificar hemostasia. O procedimento é encerrado e dreno de sistema fechado é posicionado junto à área cruenta. CONCLUSÃO: Trisegmentectomia hepática direita por videolaparoscopia é procedimento factível e seguro e deve ser considerado para pacientes selecionados. Este procedimento deve ser realizado em centros especializados e por cirurgiões com experiência tanto em cirurgia hepática como cirurgia laparoscópica avançada.

  14. Percepción por un modelo de fachada vegetada

    Directory of Open Access Journals (Sweden)

    Jazmin Carbajal-Avila

    2016-07-01

    Full Text Available El presente estudio tuvo por objetivo mostrar la percepción sobre un sistema de fachada vegetada ubicada en Acapulco, México; para lo cual se aplicó un sondeo a estudiantes de nivel superior. Los resultados muestran las sensaciones y los beneficios que fueron percibidos por el modelo, así como los inmuebles más convenientes para su aplicación, su apreciación económica y los colores preferentes en las flores de la vegetación. Las conclusiones indicaron que en un clima cálido-húmedo el modelo tiene una sensación visual refrescante de la temperatura ambiente. También se encontró su efecto reparador en ambientes estresantes. CC BY-NC-SA Gestión y Ambiente (2016.

  15. LA HISTORIA DE LA INFANCIA, UNA HISTORIA POR HACER

    Directory of Open Access Journals (Sweden)

    René Salinas Meza

    2011-10-01

    Full Text Available En nuestros días, el niño se ha convertido en un sujeto activo de derechos. Tanto los cambios sociales y políticos experimentados por la sociedad como la aceptación de una nueva representación social de la infancia por parte del mundo adulto han determinado la difusión de una especial sensibilidad sobre la niñez, en la cual se enfatiza el mejoramiento de sus condiciones de vida y se favorece el desarrollo de soluciones a sus problemas. A nivel mundial, ello se ha hecho sentir en los foros de Naciones Unidas, organización que ya en 1989 aprobó un texto vinculante para todos sus Estados miembros con el compromiso de reconocer y respetar todos su derechos.

  16. Incertidumbre y ajuste por las cantidades en the General Theory

    Directory of Open Access Journals (Sweden)

    Adolfo Rodríguez Herrera

    2009-06-01

    Full Text Available Robert Clower desarrolla una interpretación de la crítica de Keynes al funcionamiento de la economía capitalista en la cual la incertidumbre explica la incapacidad del sistema para alcanzar un equilibrio en todos los mercados, y en particular en el mercado de trabajo. El incumplimiento del principal supuesto de la economía neoclásica, la información perfecta, hace que la tasa de interés pierda su papel regulador y el sistema la capacidad de ajustarse instantáneamente a través de movimientos de los precios: en presencia de desempleo el ingreso individual deja de ser objeto de optimización por parte de los agentes y cualquier shock externo desencadena un ajuste por las cantidades que Keynes denomina efecto multiplicador y que deja al mercado de empleo sin instrumentos para alcanzar su equilibrio.

  17. Infección por Clostridium tetani: sospecharla para diagnosticarla

    Directory of Open Access Journals (Sweden)

    Mónica Ríos Prego

    2016-12-01

    Full Text Available La infección por Clostridium tetani es una patología con un amplio periodo de incubación, que posee diversos modos de presentación clínica. Este hecho, junto con la baja incidencia de esta infección en los países industrializados , así como no poseer una técnica diagnóstica precisa que podamos obtener en un corto período de tiempo, dificultan el diagnóstico. Por tanto, es importante no olvidarnos de esta patología ante un paciente con espasmos musculares y ausencia o historia incompleta de vacunación.

  18. Por uma nova concepção de universal

    Directory of Open Access Journals (Sweden)

    Oswaldo França Neto

    2009-12-01

    Full Text Available A civilização ocidental baseia-se na concepção de um universal que faça corpo único de todos os elementos, o que só se mostrou possível por meio da produção de restos inassimiláveis, e a consequente tentativa de eliminá-los por meio de perseguições ou terror. Fazendo uso do objeto a de Lacan, do personagem Bartleby de Melville e de considerações de autores como Viveiros de Castro, Agamben e Badiou, este texto se propõe a explorar outras possíveis formas de se pensar a universalidade.

  19. Calidad percibida por el espectador de fútbol

    Directory of Open Access Journals (Sweden)

    Isabel Mar\\u00EDa Rosa D\\u00EDaz

    2012-01-01

    Full Text Available Para lograr competitividad, las organizaciones se esfuerzan por comprender las necesidades de sus clientes, con el fin de satisfacerlas adecuadamente. En esta línea, en el ámbito de la gestión deportiva se ha iniciado un caminocuyo objetivo consiste en crear medidas específicas de la calidad del servicio y la satisfacción del cliente. Este es el contexto en el que se enmarca la presente investigación, cuyo objetivo fundamental consisteen determinar las dimensiones de la calidad del servicio deportivo ofrecido por los clubes de fútbol. Para ello se ha aplicado un cuestionario a través del método de la encuesta personal. Los datos obtenidos han sido tratados mediante un análisis factorial exploratorio. Los resultados permiten identificar diez dimensiones básicas de la calidad del servicio deportivo analizado.

  20. 2015. 2. Por qué celebrar primarias

    OpenAIRE

    Sanz Díaz, Benito

    2015-01-01

    ¿Por qué celebrar primarias? ¿Beneficia o perjudica a las organizaciones y partidos que las promueven?, ¿Mejora la participación?, ¿La elección de los dirigentes evita la oligarquización y la Ley de Hierro de los partidos políticos que enunció Robert Michels? Un sistema de selección de candidatos con origen en la política norteamericana, fue adaptado por el PSOE, y a continuación iría extendiéndose su práctica a los todos los partidos políticos. Ignacio Urquizu señalaba sobre l...

  1. Queratitis causada por Paecilomyces lilacinus. Reporte de un caso

    Directory of Open Access Journals (Sweden)

    Alejandro del Castillo Ruiz

    2016-01-01

    Conclusiones: La queratitis micótica es una infección corneal muy seria, de evolución tórpida, que puede causar ceguera. Comúnmente se desarrolla en pacientes después de un trauma o en aquellos con una superficie corneal comprometida. Voriconazol se ha referido como un fármaco útil para el tratamiento de úlceras corneales causadas por Paecilomyces lilacinus con muy buena penetración a estroma, acuoso y vítreo por vía oral y tópica. Un diagnóstico y tratamiento oportunos fueron esenciales en este caso de queratitis micótica para su resolución.

  2. HOSPITALIZACIONES EVITABLES POR INSUFICIENCIA CARDÍACA. VARIABLES RELACIONADAS

    Directory of Open Access Journals (Sweden)

    Victoria Ruiz-Romero

    2016-01-01

    Full Text Available Los ingresos hospitalarios evitables por insuficiencia cardiaca (IC son un problema para los sistemas de salud, consumen recursos, generan morbilidades adicionales y alta mortalidad. El objetivo del estudio fue conocer los factores de riesgo de las personas hospitalizadas por insuficiencia cardiaca. Métodos: Se constituyó un grupo con médicos de atención primaria y hospitalaria. Se realizaron auditorías de las historias clínicas de 110 pacien - tes de la poblacion de la comarca del Aljarafe con mayores tasas de ingreso por insuficiencia cardiaca y estudio descriptivo y comparativo con T-Student y U-Mann Whitney para cuantitativas y λ 2 y Fisher para cualitativas. Resultados: Los pacientes que ingresaron por IC tenían 78,1 años (SD: 9,56 de media; 73 (66,4% fueron mujeres; un Índice Barthel de 45,0 de media; un 53,5% con grado III de la NYHA y 17 (15,5% institucionaliza - dos. El 70% presentaban 3-5 comorbilidades, hipertensión (87,3%, dislipe - mia (60,0% diabetes (57,3%, enfermedad renal crónica (56,4%, anemia (53,2% o fibrilación auricular (52,7%. Fallecieron al ingreso 23 (20,9% pacientes. Conclusiones: Los ingresos se dieron en personas mayores con múl - tiples enfermedades (hipertensión, diabetes, EPOC, enfermedad renal y escasa capacidad para actividades básicas de la vida diaria. El fallecimiento hospitalario se asoció a edad avanzada, ser mujer, menor uso de betabloqueantes y la no inclusión del paciente en el proceso asistencial.

  3. Interpolaci??n por recurrencia en varias variables

    OpenAIRE

    L??pez Carmona, Antonio

    1981-01-01

    Se hace un estudio a fondo de la interpolaci??n por recurrencia bajo una formulaci??n algebraica muy general que deja a las conocidas f??rmulas de interpolaci??n de Lagrange Newton Aitken y Neville como casos particulares de esta formulaci??n. Todos los resultados obtenidos los aplicamos a la interpolaci??n en varias variables de la que hacemos un importante estudio

  4. Interpolación por recurrencia en varias variables

    OpenAIRE

    López Carmona, Antonio

    2013-01-01

    Se hace un estudio a fondo de la interpolación por recurrencia bajo una formulación algebraica muy general que deja a las conocidas fórmulas de interpolación de Lagrange Newton Aitken y Neville como casos particulares de esta formulación. Todos los resultados obtenidos los aplicamos a la interpolación en varias variables de la que hacemos un importante estudio

  5. EL MODELO LIBERAL COMO UN MODELO DEPREDADOR POR NATURALEZA

    Directory of Open Access Journals (Sweden)

    Julián Sabogal Tamayo

    2003-07-01

    Full Text Available Tuve la oportunidad de participar, por gentil invitación de la profesora Gertrudis Quijano, en el Diplomado de Geografía, lo cual me permitió acercarme un poco a quines estudian esta disciplina y me animó luego a participar en este Congreso, sobre una temática aparentemente lejana de mi formación de Economista. Mi contribución en esta conferencia se encamina al área del Medio Ambiente, que es uno de los componentes del Congreso que nos convoca. Espero hacerme entender y que mis reflexiones sean de alguna utilidad para ustedes, no necesariamente que estén de acuerdo conmigo, sino que mis planteamientos merezcan su atención y se puedan convertir para ustedes en objeto de discusión y ser involucrados en sus actividades académicas particulares. Creo que es necesario que los profesionales de las ciencias sociales, incluida la Geografía, vuelvan a pensar en los temas trascendentes y reversar la tendencia de los últimos lustros que invita solamente a preocuparse por temas llamados prácticos, por el día a día. Yo suelo preguntarles a mis estudiantes, cuando me expresan sus deseos de adquirir saberes prácticos, que les permitan ganarse la vida, y..., ¿quién pensará por ustedes? Recordemos al gran Oscar Wilde quien afirmaba que el medio seguro de no saber nada de la vida es intentar hacerse útil.

  6. Enfoque por competencias, ¿una respuesta al fracaso escolar?

    Directory of Open Access Journals (Sweden)

    Philippe Perrenooud

    2009-01-01

    Full Text Available Son tiempos de reflexión sobre las competencias. Queda mucho por investigar acerca de sus posibilidades pero es cierto que, desde el punto de vista teórico, el enfoque por competencias se presenta como potente al complementar una pedagogía que, tradicionalmente, se ha centrado en las disciplinas y en los saberes. Pero también este enfoque aparece fuerte en el campo de la formación en la medida en que viene vinculado a las prácticas sociales y educativas, al trabajo pedagógico de los problemas educativos en las diferentes situaciones, a los proyectos que los educadores desean materializar en sus lugares de trabajo. Están por demostrar las expectativas puestas en el enfoque por competencias y este texto trata de pensar toda una serie de cuestiones relacionadas con su puesta en marcha en los contextos formativos.---------------------------------------------------------------------These are times for reflection on skills. There is much left to investigate on their possibilities but it is true that, from the theoretical point of view, the skill approach appears to be powerful by complementing a pedagogy which, tradicionally, has focused on the knowledge and disciplines. But this approach appears strongly in the training field as it is linked to the social and educational practices, to the pedagogic work on educative problems, to the different situations, to the project that teachers wish to materialize in the labor places. Still to be demonstrated are the expectations on the skills approach, and this text tries to think on a series of matters related with its set in motion in the learning contexts.

  7. La desigualdad por motivos de sexo y familia

    OpenAIRE

    Durán Heras, María Angeles

    1985-01-01

    Su origen fue una ponencia presentada en un congreso hispano-mexicano sobre desigualdad social. La autora analiza la evolución histórica de la desigualdad por motivos de sexo y familia en España. El estudio termina con una propuesta de innovación en las ciencias sociales, incorporando el análisis de la situación social de las mujeres.

  8. El riego por chorro intermitente: un sistema prometedor

    Directory of Open Access Journals (Sweden)

    Hernando Buriticá

    1981-07-01

    Full Text Available A través de la historia el hombre se ha ingeniado varios sistemas para suplir las deficiencias de agua que las condiciones naturales de clima han impuesto para el desarrollo de la agricultura: desvió ríos, construyó canales y reservorios y entregó el agua a los cultivos empleando variados sistemas de riego. En este caso haremos referencia al riego por chorro intermitente.

  9. Estrategias de mercadeo verde utilizadas por empresas a nivel mundial

    Directory of Open Access Journals (Sweden)

    Castellano, Susie

    2015-09-01

    Full Text Available La preocupación por el medio ambiente se ha convertido en una temática que inquieta a toda la colectividad actual, desde los más pequeños hasta los más grandes, desde la pequeña empresa hasta la gran industria. Sumado a esto, el auge de normativas ambientales que establecen regulaciones al empresario, los obliga a tener una mayor conciencia de los daños que pueden causar sus acciones al medio ambiente. Es por esto, que paulatinamente ha comenzado, por parte de las empresas, la adopción de estrategias en el área de mercadeo verde que les permita comercializar sus productos y servicios de forma que los mismos sean ambientalmente compatibles. En el presente trabajo, se abordaron las diferentes estrategias que han venido asumiendo empresas de diferente índole para hacer frente a tan importante filosofía en el ámbito mundial. Para tal fin, se hizo la revisión y contrastación de artículos escritos en el marco del mercadeo verde por Rivera y Molero (2006, Chamorro (2001, Samper y Echeverri (2008 principalmente, encontrándose que cada vez son más las empresas que se suman a esta forma de mercadear sus procesos y productos y más los consumidores que anteponen criterios ecológicos ante variables de otra índole, modificando sus hábitos de consumo.

  10. Miopia aguda induzida por topiramato: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Kathy Dadam Sgrott

    2011-06-01

    Full Text Available RESUMO A miopia aguda pode ser desencadeada pelo uso de medicações sistêmicas, dentre elas, o anticonvulsivante topiramato. Este trabalho descreve dois casos de pacientes jovens com quadro agudo bilateral de miopia induzida por terapia com topiramato para controle de síndrome depressiva, fazendo relação com casos semelhantes descritos na literatura e revisão bibliográfica pertinente.

  11. Riesgos por Legionella, Prevención y Control

    OpenAIRE

    Martín Romero, Magdalena

    2014-01-01

    Para un buen control de riesgos por Legionella pneumophila, es importante conocer con detalle esta bacteria, los efectos que causa en el hombre, las principales fuentes de contagio y los medios para evitarlo. Este es el objetivo del presente trabajo. La legionelosis a pesar de ser percibida como una enfermedad infecciosa potencialmente erradicable, se puede controlar con medidas higiénico- sanitarias en las instalaciones implicadas.

  12. Fitodefensivos em plantas medicinais: macromoléculas hidrofílicas de folhas de mil folhas (Achillea millefolium L. inibem o crescimento in vitro de bactérias fitopatogênicas Agrochemicals in medicinal plants: hydrophilic macromolecules from leaves of "mil folhas" (Achillea millefolium L. inhibit in vitro growth of phytopathogenic bacteria

    Directory of Open Access Journals (Sweden)

    N.G. Tessarollo

    2013-01-01

    Full Text Available Extratos aquosos da planta medicinal Achillea millefolium contêm macromoléculas de interesse para desenvolver fitodefensivos para a agricultura. Duas frações de mil folhas foram obtidas por ultrafiltração, E1 (contendo moléculas maiores que 30 kDa, e E3 (peptídeos entre 1 e 10 kDa que inibiram o crescimento das bactérias fitopatogênicas Ralstonia solanacearum, gram-negativa, e Clavibacter michiganensis subsp. michiganensis, gram-positiva, com dependência de concentração. Os valores de concentração inibitória mínima (CIM para ambos os extratos e bactérias foram baixos, entre 20 e 80µM. A CIM relativa à proteína total evidenciou a presença de macromoléculas muito ativas em E3, embora com baixa concentração proteica. E3 se aplica à prospecção de peptídeos antimicrobianos. Estimar a CIM relativa à quantidade de amostra vegetal valorizou o potencial antimicrobiano natural de E1, que contém alta concentração proteica. E1e E3 se aplicam ao desenvolvimento de fitodefensivos para uso biotecnológico. A ultrafiltração fracionou as amostras de forma nativa, rápida, e com baixo custo; além de dessalinizar, clarificar, purificar, e concentrar E1 e E3. Esse estudo inédito sobre a separômica e a ação antimicrobiana de extratos macromoleculares aquosos de mil folhas sugere que plantas cicatrizantes podem apresentar grande potencial para desenvolver fitodefensivos agrícolas naturais não danosos, à semelhança de medicamentos fitoterápicos.Aqueous extracts from the medicinal plant Achillea millefolium contain macromolecules of interest to develop agrochemicals for agriculture. Two fractions of "mil folhas" were obtained by ultrafiltration, E1 (containing molecules larger than 30 kDa and E3 (peptides between 1 and 10 kDa, which inhibited the growth of phytopathogenic bacteria Ralstonia solanacearum, gram-negative, and Clavibacter michiganensis subsp. michiganensis, gram-positive, concentration-dependent. The values of

  13. Desenvolvimento de protocolo para microenxertia do tomateiro Lycopersicon esculentum Mill = Developmental of protocol for micrograffiting to tomato Lycopersicon esculentum Mill

    Directory of Open Access Journals (Sweden)

    Luciano Façanha Marques

    2010-01-01

    Full Text Available A murcha bacteriana, causada por Ralstonia solanacearum, é a principal doença vascular de plantas em todo o mundo. O agente causal é uma bactéria que ocorre em todas as regiões do Brasil, predominando em condições de umidade e temperatura elevadas, fatores propícios aodesenvolvimento do patógeno. Este agente causal é de difícil controle, pois sobrevive nos mais diversos hospedeiros, especialmente Solanaceas, além de outras famílias de importância alimentar, condimentar e medicinal. O uso de espécies do gênero Solanum na enxertia convencional e minienxertia em tomateiro Lycopersicon esculentum é limitada em função da incompatibilidade. Neste trabalho, utilizou-se o método da microenxertia para obtenção de plantas resistentes a doenças como a murcha bacteriana, tendo como cavalo a espécie Solanum palinacanthum Dun. Utilizaram-se dois métodos de microenxertia: convencional em T-invertido e corte em bisel. Foram testados meios de culturas para execução das duas práticas demicropropagação; para isso, realizou-se experimento em diferentes condições ambientais, com presença e ausência de luminosidade e diferentes tratamentos correspondentes a teores de açúcares e sais, submetidos a cinco avaliações com intervalos semanais. Melhor resultado foi encontrado quando se utilizou microenxertia em T-invertido e meio de cultura constituído de sais de MS1/8 de força acrescido de 30 g L-1 de sacarose.The bacterial wilt, caused by Ralstonia solanacearum, is the most important vascular disease among plants in the world. The causal agent is a strain of bacteria found in all regions of Brazil, mainly in places with high humidity and temperature. This bacterium is difficult to control with chemical products, being able to survive in diverse hosts, especially in species of Solanaceae as well as other families of great food, condimental, or medicinal importance. The use of species of the genus Solanum has been attempted, but the

  14. Parotiditis por Streptococcus Pyogenes: Presentacion de un caso

    Directory of Open Access Journals (Sweden)

    Zoila del S. López-Díaz

    1995-08-01

    Full Text Available La glándula parótida es generalmente afectada por procesos inflamatorios. Su etiología se debe a infecciones primarias de la glándula o como complicación de infecciones sistémicas. Se reporta el Stafilococcus aureus como el agente causal más frecuente de parotiditis aguda supurada, y se señalan además otras bacterias y virus. Se presenta un niño de 9 años de edad con un proceso supurativo agudo de la parótida izquierda de un mes de evolución, con salida de abundante pus por el conducto de Stenon. Se realizó cultivo de la secreción e identificación de Streptococcus B hemolítico grupo A, a pesar de haber recibido antibioticoterapia previa. Se utilizó ampicillina y se tuvo en cuenta la sensibilidad in vitro; no presentó mejoría clínica, por lo que se decidió el empleo de la sialografía como alternativa terapéutica en este caso. Se obtuvo la resolución del proceso supurativo infeccioso y además se evidenció en este estudio la pérdida del estroma parotídeo.

  15. Eficiencia en el uso del agua por las plantas

    Directory of Open Access Journals (Sweden)

    Hipólito Medrano

    2007-01-01

    Full Text Available La disponibilidad de agua es el principal factor limitante de la producción agrícola y ganadera en ambientes de clima mediterráneo. Limitación que, ante las previsiones de Cambio Climático Global realizadas por organismo internacionales, serán mucho mayores en los próximos años. En este escenario, la eficiencia en el uso de los recursos hídricos debe ser un aspecto transversal de las políticas públicas que debe, por tanto, ser afrontado desde diversos puntos de vista. En este sentido, uno de los temas claves a considerar es la eficiencia con la que las plantas usan el agua. El objetivo de este trabajo es hacer una revisión de los diferentes aspectos relacionados con este tema, considerando las diferentes escalas a las que se estudia la eficiencia en el uso del agua por las plantas (EUA, desde la hoja hasta el cultivo o el ecosistema. Así, se abordan las dificultades técnicas que existen para medir, de una forma precisa, la EUA de un cultivo o de un ecosistema, la importancia del ambiente y de las prácticas agronómicas como determinantes de la EUA, la diversidad genética inter e intraespecífica, y las implicaciones prácticas de estos factores a la hora de incrementar la EUA.

  16. GRAVIDADE DE INTOXICAÇÕES POR SANEANTES CLANDESTINOS

    Directory of Open Access Journals (Sweden)

    Jessica Adrielle Teixeira Santos

    2011-01-01

    Full Text Available El presente estudio tuvo como objetivo analizar las intoxicaciones por saneantes comercializados clandestinamente, reportadas en el Centro de Control de Intoxicaciones del Hospital Universitario Regional de Maringá. Es un estudio cuantitativo, con análisis retrospectivo de registros epidemiológicos de personas intoxicadas por estos agentes, en el período de enero de 2005 a diciembre de 2009. De los 118 casos reportados, la mayoría (74-62,7% se produjeron en varones, 105 (88,9% necesitaron de asistencia en unidades de atención de emergencia y hospitalización de alta complejidad, en 14 casos (11,8% requirieron de Cuidados Intensivos, y se reportaron cinco óbitos, todos por intoxicación intencional. Los resultados demuestran la gravedad y la letalidad de este tipo de intoxicación, sugieren la necesidad de medidas urgentes de fiscalización y control de la Vigilancia Sanitaria, así como de medidas para la educación de los consumidores, haciendo hincapié en el papel educativo de la Enfermería

  17. DE ACUMULACIÓN POR DESPOSESIÓN

    Directory of Open Access Journals (Sweden)

    Sebastián Gómez Lende

    2015-01-01

    Full Text Available Omnipresente, la acumulación por desposesión es uno de los elementos centrales del orden global contemporáneo. Observados desde una perspectiva crítica, los usos extractivos del territorio constituyen una de las principales expresiones de ese proceso. A la luz de ese sistema de ideas, este artículo procura demostrar que el modelo sojero actualmente vigente en la Argentina es una de las formas más completas, exhaustivas, actuales y sofisticadas, de acumulación por desposesión en el país. En ese sentido, el artículo analiza el boom de la soja transgénica y sus vínculos con las formas tanto seculares (endeudamiento financiero, concentración de la propiedad rural, usurpación de la tierra y actuales de desposesión (degradación de la naturaleza, despojo del derecho a la salud, pillaje de recursos genéticos efectuadas por los grandes agricultores, el capital financiero, las agroindustrias y las corporaciones biotecnológicas, en detrimento de los pequeños productores, los campesinos, los pueblos aborígenes y la población en general.

  18. positivismo por su reduccionismo epistemológico

    Directory of Open Access Journals (Sweden)

    Ignacio M. Ibarzábal

    2007-01-01

    Full Text Available A lo largo de la historia humana puede observarse la constante oscilación entre diversas teorías científicas. Esto puede demostrarse, por ejemplo, a partir de una reflexión sobre la evolución de las ideas filosóficas desde fines de la edad Media hasta la actualidad. este fenómeno no hace más que poner de relieve cierta inseguridad connatural al hombre, que genera la opción por soluciones simplistas, y “puras”, lo que culmina en muchos casos en una aproximación reduccionista a la realidad. El problema científico que plantea el reduccionismo epistemológico es que éste, al desentenderse de la realidad existencial del hombre, es incapaz de darle respuestas satisfactorias para resolver conflictos. Este inconveniente lo sufre el positivismo jurídico –así como también lo ha padecido el iusnaturalismo ingenuo–, por su imposibilidad de resolver conflictos jurídicos reales; y esto, a causa de su pretendida aproximación avalorativa que da lugar a dos especies de reduccionismos: el que desconoce tajantemente las valoraciones, y aquél que, reconociéndolas, escoge de manera arbitraria los valores objeto de su conocimiento.

  19. Por que rir da Filosofia Política?: Abertura

    Directory of Open Access Journals (Sweden)

    Lessa Renato

    1998-01-01

    Full Text Available As diferentes intervenções que compuseram este debate têm como referência comum uma reflexão sobre os lugares da Filosofia Política na tradição disciplinar que designamos como Ciência Política. Recusando a perspectiva que dissocia a Filosofia Política da dimensão empiricamente orientada da disciplina, os argumentos apresentados destacam o papel de fertilização de formas de vida cumprido pela primeira. A agenda dos pesquisadores devotados à boa faina da investigação empírica foi, e segue sendo, em grande medida definida e configurada por exercícios prévios de invenção social e política e por decisões de ordem ontológica, epistemológica e retórica. Neste sentido, a distinção entre ciência e filosofia é, além de obscurantista e marcada por enorme otimismo epistemológico, sintoma de um desconhecimento forte com relação à história do conhecimento político.

  20. Diagnostico por PCR del complejo Sigatoka en Colombia.

    Directory of Open Access Journals (Sweden)

    Romero Magally

    1999-06-01

    Full Text Available Las Sigatokas negra y amarilla son enfermedades causadas por Mycosphaerella fijiensis y Mycosphaerella musicola respectivamente. Estas dos especies de hongos estrechamente relacionadas y morfológicamente similares, causan necrosis severa en las hojas de banano y plátano disminuyendo el área de tejido fotosintético y acelerando la maduración del fruto. Las enfermedades producidas por estos hongos afectan la mayoría de las áreas cultivadas de banano y plátano a nivel mundial, generando un gran problema económico y ambiental. Los síntomas que produce cada uno de estos patógenos en el cultivo son similares, por lo que su correcta identificación en campo se hace difícil. Con el fin de hacer una identificación precisa de cada uno de ellos decidimos estandarizar una prueba diagnóstica basada en la reacción en cadena de la polimerasa (PCR utilizando dos oligonucleótidos de 21 bases (MF 137 y MM 137 específicos para cada una de las especies M. fijiensis y M. musicola respectivamente. MF 137 y MM 137 codifican regiones variables identificadas en las secuencias interespaciadoras (ITS del DNA ribosomal.

  1. Extracción de sustancias asistida por ultrasonido (EUA

    Directory of Open Access Journals (Sweden)

    Rocío Azuola

    2007-11-01

    Full Text Available Compuestos presentes en los vegetales con propiedades funcionales o tecnológicas, han cobrado gran importancia en los mercados de alimentos, farmacéuticos y cosméticos. Se buscan métodos eficientes, económicos y favorables al ambiente para la extracción de estas sustancias. Se ha realizado un estudio bibliográfico de las publicaciones recientes sobre diferentes métodos de extracción y su comparación a las extracciones asistidas por ultrasonido (EAU con el fin de evaluar su eficacia y viabilidad industrial. Se ha encontrado que la EAU es más eficiente que los métodos de extracción tradicionales, y más económica y sencilla que los métodos de extracción no tradicionales como la extracción asistida por microondas, por lo cual se comprueba su viabilidad industrial.

  2. Uso de contraceptivos por puérperas adolescentes

    Directory of Open Access Journals (Sweden)

    Fernanda Schulz da Rosa

    2014-07-01

    Full Text Available Objetivo: Indagar el uso de métodos contraceptivos por las puérperas adolescentes a fin de relacionar su (desuso con el embarazo en la adolescencia. Método: Estudio transversal, descriptivo, realizado por medio de un instrumento estructurado con 181 puérperas adolescentes que tuvieron sus partos en el hospital participante de la investigación. Los datos fueron recolectados en el período de diciembre de 2008 a diciembre de 2009. Resultados: El 64,1% de las puérperas usaba algún método contraceptivo antes del embarazo; los métodos más utilizados fueron el anticoncepcional oral (51% y el preservativo masculino (29%. Para el 75% de las adolescentes el embarazo fue planeado y justificado por el deseo y la voluntad propia de experimentar la maternidad. Conclusión: Considerando que casi la mitad de las adolescentes entrevistadas deseaba el embarazo, se deduce que investigar y discutir apenas el uso o no de los métodos contraceptivos no es adecuado. Es necesario profundizar las investigaciones acerca de los significados de ser madre en la adolescencia.

  3. Enfermedad por Mycobacterium simiae y "Mycobacterium sherrisii" en la Argentina

    Directory of Open Access Journals (Sweden)

    Lucía Barrera

    2010-08-01

    Full Text Available Se presenta información reunida retrospectivamente sobre casos de micobacteriosis originados por Mycobacterium simiae (n = 4 y "M. sherrisii" (n = 6. Los casos ocurrieron entre pacientes con sida (n = 6, historia de silicosis (n = 2 o tuberculosis previa (n = 1. Un caso se perdió luego de diagnosticado y nueve fueron tratados con esquemas terapéuticos basados en claritromicina, etambutol y quinolonas. La respuesta fue muy pobre: cinco pacientes fallecieron (cuatro eran HIV positivos, tres permanecieron crónicos y sólo uno curó. Estas micobacterias originaron 2.1% de los casos de micobacteriosis registrados en un período de ocho años. La distinción de estas micobacterias raras de otras más frecuentes por métodos moleculares rápidos, parece ser clínicamente útil para advertir sobre la dificultad que puede presentar el tratamiento. Sin embargo, la diferenciación genotípica entre M. simiae y "M. sherrisii" parecería no ser clínicamente relevante, dado que no quedaron expuestas características que distingan a los pacientes afectados por los dos microorganismos tan estrechamente relacionados.

  4. Agranulocitosis inducida por metimazol en pacientes con enfermedad de Graves

    Directory of Open Access Journals (Sweden)

    Helard Manrique-Hurtado

    2013-04-01

    Full Text Available Objetivo: Describir las características clínicas y epidemiológicas de los pacientes con enfermedad de Graves que presentaron agranulocitosis inducida por metimazol. Material y métodos: Estudio retrospectivo, tipo serie de casos. Se revisaron las historias clínicas de todos los pacientes con diagnóstico de agranulocitosis inducida por metimazol, atendidos en el Hospital Nacional Arzobispo Loayza, entre enero 2002 y diciembre 2008. Se buscó asociación entre las variables demográficas y clínicas con la mortalidad y el tiempo de recuperación. Resultados: Treinta (0,60% pacientes con enfermedad de Graves fueron hospitalizados con el diagnóstico de agranulocitosis inducida por metimazol. La mediana de la edad fue 33,5 años y 86,67% fueron mujeres. Al ingreso, todos los pacientes presentaron fiebre y dolor de garganta. El manejo incluyó aislamiento invertido, suspensión del metimazol, administración de antibióticos y glucocorticoides. Doce (40% pacientes recibieron GM-CSF. El número de granulocitos se normalizó después de 10,59 días y cuatro (13,33% pacientes murieron por infecciones bacterianas y sepsis. En todos los casos, el tratamiento definitivo fue yodo radioactivo. No hubo diferencia significativa en la edad, sexo, dosis de metimazol, duración del tratamiento y uso de factor estimulante colonia, entre los pacientes fallecidos y los sobrevivientes. Además, el uso de factor estimulante de colonia no redujo el tiempo de recuperación de la agranulocitosis. Conclusión: La agranulocitosis inducida por metimazol es un evento adverso serio y potencialmente mortal. En este grupo de pacientes, la mortalidad fue elevada y el uso de factor estimulante de colonia no disminuyó el tiempo de recuperación.

  5. Intoxicação por monofluoroacetato em animais

    Directory of Open Access Journals (Sweden)

    Vivian Assunção Nogueira

    2011-10-01

    Full Text Available O monofluoroacetato (MF ou ácido monofluoroacético é utilizado na Austrália e Nova Zelândia no controle populacional de mamíferos nativos ou exóticos. O uso desse composto é proibido no Brasil, devido ao risco de intoxicação de seres humanos e de animais, uma vez que a substância permanece estável por décadas. No Brasil casos recentes de intoxicação criminosa ou acidental têm sido registrados. MF foi identificado em diversas plantas tóxicas, cuja ingestão determina "morte súbita"; de bovinos na África do Sul, Austrália e no Brasil. O modo de ação dessa substância baseia-se na formação do fluorocitrato, seu metabólito ativo, que bloqueia competitivamente a aconitase e o ciclo de Krebs, o que reduz produção de ATP. As espécies animais têm sido classificadas nas quatro Categorias em função do efeito provocado por MF: (I no coração, (II no sistema nervoso central (III sobre o coração e sistema nervoso central ou (IV com sintomatologia atípica. Neste trabalho, apresenta-se uma revisão crítica atualizada sobre essa substância. O diagnóstico da intoxicação por MF é realizado pelo histórico de ingestão do tóxico, pelos achados clínicos e confirmado por exame toxicológico. Uma forma peculiar de degeneração hidrópico-vacuolar das células epiteliais dos túbulos uriníferos contorcidos distais tem sido considerada como característica dessa intoxicação em algumas espécies. O tratamento da intoxicação por MF é um desafio, pois ainda não se conhece um agente capaz de reverte-la de maneira eficaz; o desfecho geralmente é fatal

  6. VENTAJAS ARANCELARIAS OTORGADAS POR ESTADOS UNIDOS POR MEDIO DEL ATPDEA, APROVECHABLES PARA LAS PyMES DE BOGOTA Y CUNDINAMARCA

    Directory of Open Access Journals (Sweden)

    Mario Ernesto

    2003-07-01

    Full Text Available En medio de la crisis de desempleo, pobreza y desigualdad que afronta Colombia, las pequeñas y medianas empresas se han convertido en una alternativa importante de generación de trabajo y valor agregado. Sin embargo, éstas deben aprovechar las ventajas que se otorgaron al país en el marco del ATPDEA, por medio del cual los Estados Unidos concedió preferencias arancelarias a más de cinco mil seiscientos productos que estuvieron vigentes durante más de diez años, y que luego, a partir de septiembre del 2002, se ampliaron en más de seiscientos productos. En este trabajo se presentan los rubros de la lista adicional, que presentan posibilidades de exportación a los Estados Unidos por parte de las PyMES de Bogotá y Cundinamarca.

  7. Tallado de hélices por el método de copiado por proyección

    Directory of Open Access Journals (Sweden)

    José Vicente Fierro Vasco

    1983-01-01

    Full Text Available Este dispositivo fue diseñado como parte de la investigación sobre Aerogeneradores que se está llevando a cabo en el Departamento de Ingeniería Mecánica, cuyo investigador principal es el Ing. Julio Mario Rodríguez Devis. Como parte inicial de la investigación se adecuó un túnel situado en el Laboratorio de Hidráulica para hacer las pruebas de modelos. En la construcción de dichos modelos se requiere una buena precisión en la hechura de las aspas del molino, en especial por el tamaño reducido de liste. Se debe garantizar que el perfil aerodinámico se conserve a lo largo del aspa, por lo que se requiere de un dispositivo capaz de tallar los álabes con la precisión y rapidez necesarias. Los resultados del trabajo fueron presentados al concurso del premio Worthington de la Ingeniería Colombiana 1982 (Categoría estudiantes, por los estudiantes que trabajaron en el proyecto, siendo acreedores al primer puesto.

  8. Predominant porB1A and porB1B genotypes and correlation of gene mutations with drug resistance in Neisseria gonorrhoeae isolates in Eastern China

    Directory of Open Access Journals (Sweden)

    Tang Renxian

    2010-11-01

    Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.

  9. Early detection of plant disease using close range sensing system for input into digital earth environment

    International Nuclear Information System (INIS)

    Chew, W C; Lau, A M S; Kang, C S; Hashim, M; Battay, A E

    2014-01-01

    A case study on pre-symptom stage of plant disease infection using ground based hyperspectral remote sensing was conducted. The objectives of the study are: (1) to validate the existence of pre-symptom stage of Ralstonia Solanacearum infection in Solanum Melongena L. (eggplant), and (2) to determine the induced electromagnetic spectral response for infected eggplant. From the experiment, the pre-symptom duration of Ralstonia Solanacearum infection in the case of eggplant was estimated (with the artificial photosynthetic stress conditions were adopted in the experiment to induce measurable changes in daily hyperspectral measurement of disease infected eggplant samples during the pre-symptom stage) as four days which is the critical period for practicing effective treatments. Vegetation indices namely, (1) Chlorophyll Absorption Integral (CAI), (2) Photochemical Radiation Index (PRI), and (3) Normalized Difference Vegetation Index (NDVI) have successfully shown noticeable progress of index value from the infected sample plant (with 100% light stress condition) throughout the study. Yet, other infected sample plants with moderate light stress conditions (50% or 75%) did not result any similar progress of index value from the daily leaf scale hyperspectral measurements. Apparently, extreme light stress can induce significant changes at visible portion in hyperspectral measurements for a disease infected eggplant during the pre-symptom stage

  10. Mechanism of host substrate acetylation by a YopJ family effector.

    Science.gov (United States)

    Zhang, Zhi-Min; Ma, Ka-Wai; Gao, Linfeng; Hu, Zhenquan; Schwizer, Simon; Ma, Wenbo; Song, Jikui

    2017-07-24

    The Yersinia outer protein J (YopJ) family of bacterial effectors depends on a novel acetyltransferase domain to acetylate signalling proteins from plant and animal hosts. However, the underlying mechanism is unclear. Here, we report the crystal structures of PopP2, a YopJ effector produced by the plant pathogen Ralstonia solanacearum, in complex with inositol hexaphosphate (InsP 6 ), acetyl-coenzyme A (AcCoA) and/or substrate Resistance to Ralstonia solanacearum 1 (RRS1-R) WRKY . PopP2 recognizes the WRKYGQK motif of RRS1-R WRKY to position a targeted lysine in the active site for acetylation. Importantly, the PopP2-RRS1-R WRKY association is allosterically regulated by InsP 6 binding, suggesting a previously unidentified role of the eukaryote-specific cofactor in substrate interaction. Furthermore, we provide evidence for the reaction intermediate of PopP2-mediated acetylation, an acetyl-cysteine covalent adduct, lending direct support to the 'ping-pong'-like catalytic mechanism proposed for YopJ effectors. Our study provides critical mechanistic insights into the virulence activity of YopJ class of acetyltransferases.

  11. Mortalidad por causas externas en Medellín, 1999-2006

    Directory of Open Access Journals (Sweden)

    Doris Cardona Arango

    2008-01-01

    Full Text Available Caracterizar el comportamiento de la mortalidad por causas externas en la ciudad de Medellín, Colombia, entre 1999-2006, según sexo, edad y causa básica de muerte fue el objetivo de este estudio descriptivo longitudinal, con fuente de información secundaria de 22 128 registros de defunción por causas externas. El análisis realizado es univariado y bivariado por sexo, grupos de edad y causa de muerte. Las causas externas registradas en el periodo fueron: 72.9 por ciento por homicidio; 15.3 por ciento, accidente de transporte; 7.3 por ciento, traumatismos; 4.2 por ciento, por suicidio, y por otras causas, 0.4 por ciento. La mayor tasa de mortalidad se presentó en el grupo de edad de 20 a 24 años (27.6 por cien mil habitantes, hecho que merece especial consideración por las implicaciones sociales, familiares y laborales que representa el fallecimiento de una persona en su etapa productiva.

  12. Rabia transmitida por murciélagos en Brasil

    Directory of Open Access Journals (Sweden)

    Willian Oliveira Fahl

    2015-09-01

    Full Text Available Frente al desafío que la rabia representa para la industria pecuaria y la salud pública en América Latina, el presente artículo tiene como objetivo hacer una revisión de literatura amplia y crítica sobre la epidemiología de la rabia transmitida por murciélagos en Brasil. El tema es abordado inicialmente desde una perspectiva histórica hasta la caracterización molecular de aislamientos del virus, para finalmente contrastar con la situación de otros países de las Américas. La información referente a Brasil es presentada de manera separada debido a la gran abundancia de especies de murciélagos de diversos hábitos alimenticios, implicadas en la transmisión del virus de la rabia y las complejas relaciones entre los ciclos epidemiológicos revelados por estudios de tipificación antigénica y análisis filogenético, lo  cual ha permitido reconocer con más nitidez, la importancia de los quirópteros como reservorios y transmisores de esta enfermedad.  Este nuevo escenario epidemiológico exige reexaminar las medidas de control aplicadas hasta el momento, desde un abordaje multidisciplinar, así como cooperación intersectorial y participación por parte de la comunidad.

  13. Estudio del modelo de desgaste propuesto por Archard

    Directory of Open Access Journals (Sweden)

    FABIO ALEXANDER SUÁREZ BUSTAMANTE

    2005-01-01

    Full Text Available El comportamiento de componentes de máquinas y de materiales necesita ser optimizado para reducir los costos de operación en las plantas industriales. Este hecho ha impulsado la Tribología, un área relacionada con el estudio de la fricción, la lubricación y el desgaste. Uno de los principales objetivos de esta área del conocimiento es elaborar modelos matemáticos para expresar la variación del desgaste durante el contacto de superficies en movimiento, con el fin de predecir la vida útil de los elementos de máquinas. El modelo de Archard para desgaste por deslizamiento en seco, formulado en 1953, es un modelo clásico que plantea una variación del desgaste inversamente proporcional a la dureza del material y directamente proporcional a la carga aplicada. En el presente trabajo, se ha utilizado el método de modelamiento de problemas físicos, propuesto por Asbhy, para analizar los modelos propuestos por Archard (Modelo de contactos múltiples en superficies rugosas y modelo de desgaste mecánico. Con base en él se ha podido realizar un análisis profundo a dichos modelos, mostrando un panorama más amplio del modelo de Archard; se discuten aspectos no mostrados en los textos y artículos de tribología, donde el tratamiento dado a este modelo resulta ser superficial, desconociendo las limitaciones y la perspectiva que tuvo Archard sobre los aspectos que deberían considerarse en un modelo de desgaste.

  14. Abortos por Neosporacaninum em bovinos do sul de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Débora R. Orlando

    2013-11-01

    Full Text Available Este estudo avaliou a participação de Neospora caninum em casos de abortos em bovinos provenientes de propriedades rurais da região sul de Minas Gerais por meio de análises histopatológicas, imuno-histoquímicas (IHQ e pela reação em Cadeia de Polimerase (PCR. O material utilizado foi obtido de um estudo retrospectivo de casos de aborto recebidos pelo Setor de Patologia Veterinária da Universidade Federal de Lavras e de fetos necropsiados durante os anos de 2011 a 2013. De 60 fetos estudados, 30 (50% tinham lesões microscópicas. Destes, 19 (63% apresentaram lesões compatíveis com aborto por N. caninum, caracterizadas principalmente por encefalite não supurativa multifocal, necrose e gliose multifocal, assim como, miocardite e miosite não supurativa. Em 14 fetos chegou-se ao diagnóstico definitivo. Destes, cinco tiveram sua confirmação somente pela marcação IHQ e cinco foram positivos somente na PCR. Quatro fetos foram positivos tanto na IHQ quanto na PCR. Cinco fetos, provenientes do estudo retrospectivo apresentaram lesões compatíveis com N. caninum, mas a presença do protozoário não foi confirmada pela marcação IHQ. Os achados demonstram que o N. caninum é um importante agente associado ao aborto em bovinos na região sul de Minas Gerais. Para tanto, além das lesões microscópicas a associação entre a IHQ e a técnica de PCR foi essencial para a confirmação do diagnóstico.

  15. Tratamiento de desechos del cianuro por biorremediación

    Directory of Open Access Journals (Sweden)

    Alma Deloya Martínez

    2012-08-01

    Full Text Available Se presentan los resultados de una investigación en la que se desarrolló un consorcio autóctono de microorganismos degradadores del cianuro para aplicarlo en el tratamiento biológico de los desechos peligrosos del cianuro. Los microorganismos autóctonos obtenidos se liofilizaron en diferentes medios protectores, como la gelatina y caldo lactosado a diferentes temperaturas (-35,-45,-55 y -65. Para el tratamiento preliminar de los desechos del cianuro se aplicó un método de pretratamiento en lechada: para la lixiviación preliminar del desecho, con periodos de 3-5 días y un tratamiento posterior, por lagunas aireadas, aplicando el consorcio de microorganismos liofilizados.Se obtuvieron ocho diferentes liofilizados bajo diferentes condiciones de temperatura y con dos medios protectores de liofilización que presentaron excelentes recuperaciones a los seis meses de la liofilización.El consorcio de microorganismos liofilizados presentó, viabilidad del 70 al 80%, con porcentajes de remoción del cianuro mayores al 95% y puede conservarse activo por tiempos prolongados (por años.Los microorganismos liofilizados pueden aplicarse en la biodegradación de los desechos del cianuro procedentes de las minas de oro o cualquier otro desecho de cianuro como los baños de electrodeposición de metales, además de aquellos procedentes de la industria manufacturera de joyas.

  16. Darwin por Manoel Bomfim Darwin by Manoel Bomfim

    Directory of Open Access Journals (Sweden)

    Celso Noboru Uemori

    2008-01-01

    Full Text Available A noção de "luta pela existência" de Charles Darwin foi apropriada por diversas tendências intelectuais e serviu a vários propósitos políticos. Ela deu suporte para aqueles que queriam legitimar o capitalismo, fazer apologia do individualismo, do mercado, do fim dos monopólios e da competição. Ensejou concepções conservadoras como a prática da eugenia, a justificação do elitismo, da conquista e da colonização dos europeus sobre as populações asiáticas e africanas e o racismo. A idéia de luta pela existência foi trabalhada, também, por intelectuais que defendiam a idéia de que lutar pela vida relacionava-se à solidariedade e à cooperação. Manoel Bomfim sofreu influência de Darwin e beneficiou-se de suas idéias para elaborar argumentos, graças aos quais foi visto por seus intérpretes como um autor "radical" e original.Charles Darwin's notion of a 'struggle for existence' has been appropriated by several intellectual currents of opinion, and used for various political purposes. It has served to support free market capitalism, as an apologia of individualism, the market, the end of monopolies, and competition. Conservative conceptions have been based on it: the practice of eugenics, the justification of elitism, of the conquest and colonization of Asian and African peoples by the European, and of racism. On the other hand, the idea of a struggle for existence has been worked on by intellectuals who argued that it was related to solidarity and cooperation. Manoel Bomfim was influenced by Darwin and used his ideas to form arguments which have led his interpreters to see him as a 'radical' and original author.

  17. Encefalitis del tallo cerebral y mielitis por Listeria monocytogenes

    Directory of Open Access Journals (Sweden)

    Aracelly Castro

    2013-09-01

    Full Text Available La romboencefalitis por Listeria monocytogenes es una presentación poco común de la listeriosis del sistema nervioso central; sin embargo, es la presentación más común en personas inmunocompetentes. Aun más rara es la combinación de romboencefalitis con mielitis causada por L. monocytogenes; no obstante, en este artículo se reporta un caso de encefalitis del tallo y mielitis grave en un paciente sin compromiso del sistema inmunitario. Se presenta un paciente de 21 años de edad, sin deficiencias del sistema inmunitario, que consumió productos lácteos no pasteurizados y, posteriormente, presentó un cuadro de cefalea, vómito, deterioro de su estado general y, finalmente, alteración del estado de conciencia y muerte. Consultó al Instituto Neurológico de Colombia y se hizo diagnóstico de encefalitis del tallo y mielitis por L. monocytogenes. Se discuten las diferencias entre el caso presentado y los reportados en la literatura científica. Ante un paciente con signos de compromiso del tallo cerebral, de posible origen infeccioso, es prudente iniciar tratamiento antibiótico para L. monocytogenes y, en caso de poca respuesta, escalar rápidamente en dicho tratamiento. También lo es extender el estudio radiológico hacia la columna vertebral, con el fin de descartar compromiso de la médula espinal.   doi: http://dx.doi.org/10.7705/biomedica.v33i3.1482

  18. La Criatura de Frankenstein y la lucha por el reconocimiento

    Directory of Open Access Journals (Sweden)

    Hardisson Rumeu, Ana

    2002-06-01

    Full Text Available This text of Mary Shelley permits the possibility of considering the character of the «Creature» from the Axel Honneth`s perspective of the Ethics of reconnaissance. From this point of view, the dramatic sense of this novel moves round identity´s problem. The essential condition to build identity is the recognition from each to other. That is why identity can not be obtain in the sense of solitarious consciousness, but requires of intersubjetivity. The Creature becomes deprived of recognition, even by Frankenstein who has created him. This Creature becomes perverse because this privation, when the most elemental right of human being so as being someone and having an identity, is denied to him. His wickedness is the secondary effect of exclusion and suffering.

    Este texto de Mary Shelley, permite la posibilidad de considerar el personaje de la «Criatura» desde la perspectiva de la Ética del reconocimiento, de Axel Honneth. Desde este punto de vista, la carga dramática de esta novela gira en torno al problema de la identidad. La condición imprescindible para construir la identidad es el reconocimiento por parte del otro. Por eso la identidad no se puede adquirir en el plano subjetivo de la conciencia solitaria sino que precisa de la intersubjetividad . La criatura se ve privada de reconocimiento, incluso por parte de Frankenstein, que lo ha engendrado. Esa privación, al negarle el derecho más elemental del ser humano, que es ser alguien y tener una identidad, lo vuelve perverso. Su maldad es el efecto secundario de la marginación y el sufrimiento.

  19. HIPERINFECCIÓN POR STRONGYLOIDES EN ANCIANO CON EPOC

    Directory of Open Access Journals (Sweden)

    Análida Elizabeth Pinilla Roa

    2011-01-01

    Full Text Available Se presenta un caso de un hombre de 81 años natural de zona rural, agricultor, recolector de café 50 años atrás y jardinero por 22 años en Bogotá. Consultó por dolor abdominal de 10 días de evolución, localizado hacia mesogastrio y epigastrio. Además, disnea, tos productiva. Antecedentes: enfermedad pulmonar obstructiva crónica, cor pulmonale, fumador de 25 paquetes /año, había recibido prednisona oral y beclometasona inhalada en diversas ocasiones incluso en la última hospitalización. En el examen físico presentó signos de desnutrición, taquicardia, taquipnea; estertores en base del hemitórax derecho; abdomen: blando, depresible con dolor a la palpación profunda en epigastrio e hipocondrio derecho. Ingresó con síndrome de respuesta inflamatoria sistémica por taquicardia, taquipnea, leucocitosis 37.600 y eosinofilia 52-60%, Ig E: 180 UI/ ml. Se evidenciaron larvas rabditiformes de Strongyloides stercoralis en esputo y materia fecal. La radiografía de tórax mostró derrame pleural derecho, la ecografía hepática fue normal, la endoscopia de vías digestivas altas evidenció gastritis y duodenitis. Se inició tratamiento con ivermectina 200 mg/Kg/dosis, con seguimiento clínico y de laboratorio con evolución clínica satisfactoria.

  20. Neurocriptococose por Cryptococcus neoformans não capsulado

    OpenAIRE

    Lacaz, C.S.; Heins-Vaccari, Elisabeth M.; Melo, Natalina T.; Moreno-Carvalho, O.A.; Sampaio, M.L.S.; Nogueira, L.S.; Badaró, R.J.S.; Livramento, J.A.

    1993-01-01

    Os autores registram um caso de neurocriptococose em paciente HIV-negativo, por Cryptococcus neoformans acapsulado ou deficiente em cápsula. O quadro neurológico era de meningoencefalite subaguda, compatível ao diagnóstico de neurotuberculose, pelo exame do líquido cefalorraqueano (LCR), Estruturas leveduriformes foram encontradas no interior de macrófagos, ao exame citomorfológico do LCR. Cultivo do sedimento do LCR revelou a presença de Cryptococcus neoformans não capsulado (identificação b...

  1. Didactopatogenia (Enfermedades generadas por la mala enseñanza

    Directory of Open Access Journals (Sweden)

    José Cukier

    1996-12-01

    Full Text Available Se plantea el desarrollo de enfermedades generadas por la mala enseñanza. Se cuestiona el papel que cumplen las instituciones educativas al avalar a educadores con personalidad narcisista que inducen a estas enfermedades. Se describen las características de estos educadores, sus principales defensas y las interacciones didactopatogénicas que se establecen entre el educador y el educando, generando transformación pasivo/activo, tabú del pensamiento, saber enciclopédico, recuerdos póstumos, trastornos de conducta, distracción, y agresividad marcada. Se discute, también, el concepto del educador y sus dobles.

  2. Posibilidad de cobro de derechos universitarios por actividades de posgrado

    Directory of Open Access Journals (Sweden)

    Alberto Pérez Pérez

    2014-04-01

    Full Text Available Paso a emitir mi dictamen sobre la eventual incidencia de la Ley N° 18.437 en la posibilidad de cobro de derechos universitarios por actividades de posgrado1. Desde ya me adelanto a decir que la citada Ley no ha alterado el marco legislativo dentro del cual fue adoptada la Ordenanza de Carreras de Posgrado de 25-IX-2001 (cuyo art. 10 prevé la mencionada posibilidad y que el referido cobro de derechos universitarios no infringe ninguna norma constitucional ni de los instrumentos internacionales de derechos humanos vigentes para nuestro país.

  3. Mastite micótica em ruminantes causada por leveduras

    OpenAIRE

    Spanamberg,Andréia; Sanches,Edna Maria Cavallini; Santurio,Janio Morais; Ferreiro,Laerte

    2009-01-01

    A ocorrência de casos esporádicos de mastite causados por microrganismos de origem ambiental pode ser considerada como emergente e as leveduras, os fungos leveduriformes e os filamentosos são alguns dos principais agentes envolvidos. Em relação à mastite micótica, as leveduras são freqüentemente causas de infecções da glândula mamária em animais produtores de leite. A maior parte dos casos ocorre sob a forma de surtos localizados e/ou após tratamento com antimicrobianos. Os principais gêneros...

  4. Brechas en bordos de arcilla formadas por desbordamiento

    OpenAIRE

    Orozco Rivas, Ricardo; Berezowsky, Moisés

    2000-01-01

    Se describe un método para calcular el mecanismo de formación de una brecha en un bordo o dique de tierra como consecuencia de su falla por desbordamiento. La brecha se va formando conforme el flujo erosiona el bordo; este proceso, sumamente complejo, se incluye en el modelo numérico que aquí se describe mediante una relación empírica entre el esfuerzo cortante actuante y la tasa de erosión en un suelo cohesivo. Con la metodología propuesta se obtiene simultáneamente el hidrograma que sale po...

  5. Detenga las infecciones por C. difficile (Stop C. difficile Infections)

    Centers for Disease Control (CDC) Podcasts

    2012-03-06

    Este podcast se basa en la edición de marzo del 2012 del informe Vital Signs de los CDC. La Clostridium difficile es una bacteria que causa diarrea y está asociada a 14,000 muertes anuales en los Estados Unidos. Este podcast ayuda a los profesionales de la salud a saber cómo prevenir las infecciones por C. difficile.  Created: 3/6/2012 by Centers for Disease Control and Prevention (CDC).   Date Released: 3/6/2012.

  6. Brote por Salmonella enteritidis en trabajadores de un hospital

    OpenAIRE

    Chávez-de la Peña Ma. Eugenia; Higuera-Iglesias Anjarath L.; Huertas-Jiménez Martha A.; Báez-Martínez Rosa; Morales-de León Josefina; Arteaga-Cabello Fernando; Rangel-Frausto Sigfrido; Ponce de León-Rosales Samuel

    2001-01-01

    Objetivo. Describir y determinar las causas de un brote de enfermedad gastrointestinal por Salmonella enteritidis, ocurrido en junio de 1998, entre el personal trabajador de la salud (TS) que labora en un hospital de tercer nivel de atención, en la ciudad de México. Material y métodos. Se incluyó a todo aquel empleado que presentó diarrea o fiebre asociada a síntomas gastrointestinales, a partir del día 8 de junio de ese año, posterior a la ingestión de alimentos en el comedor del hospital (c...

  7. CONSERVACION DE MANZANAS GRANNY SMITH MINIMAMENTE PROCESADAS POR METODOS COMBINADOS

    OpenAIRE

    GALLEGUILLOS CANALES, PAMELA CRISTINA; GALLEGUILLOS CANALES, PAMELA CRISTINA

    2011-01-01

    Se ha demostrado que el consumo de frutas y hortalizas tiene un efecto beneficioso para la salud. Debido a su alto contenido de antioxidantes, constituye una de las maneras más efectivas para reducir el riesgo de enfermedades crónicas no transmisibles (Speisky, 2006; Block et al., 1992; Knekt et al., 1997; Ness y Powles, 1997; Doll, 1990; Wang et al., 1996; Del Caro et al., 2004). El aumento de muertes por enfermedades como cáncer, diabetes y enfermedades cardiovasculares, ha llevado a ent...

  8. Obtenção de vanilina por via microbiana

    OpenAIRE

    Vasconcelos, Marcio dos Santos

    2014-01-01

    Orientadora : Profa. Dra. Adriane B. P. Medeiros Tese (doutorado) - Universidade Federal do Paraná, Setor de Tecnologia, Programa de Pós-Graduação em Engenharia de Bioprocessos e Biotecnologia. Defesa: Curitiba,14/11/2014 Bibliografia: fls. 102-105 Resumo: Este trabalho teve como objetivo a determinação das melhores condições para o desenvolvimento de um processo viável de produção biotecnológica de vanilina a partir de fermentação por microrganismos. Foram testados protocolos para ...

  9. Estudio molecular de pacientes colombianos afectados por enanismo esencial

    OpenAIRE

    Navarrete Vargas, Julie Viviana

    2017-01-01

    Los síndromes de enanismo esencial microcefálico son un grupo de enfermedades monogénicas infrecuentes que se caracterizan principalmente por talla baja extrema proporcionada de inicio prenatal y microcefalia severa. En los pacientes que formaron parte del presente estudio se investigaron variantes en el gen PCNT debido a que presentaban hallazgos clínicos compatibles con el síndrome MOPD II (enanismo esencial osteodisplásico microcefálico tipo II). Posteriormente, se amplió el estudio con...

  10. Por qué soy “cronista rojo”

    Directory of Open Access Journals (Sweden)

    Henry Holguín

    2010-06-01

    Full Text Available Refiere que la crónica roja ha sido maltratada, estigmatizada y prohibida desde hace años, más por motivos estéticos que éticos. No existe una técnica periodística para la crónica roja, porque no se enseña a tratarla en las universidades. La crónica roja necesariamente aparecerá mientras haya violencia, delincuencia, no se puede tener una doble moral, acota.

  11. Braveheart: una historia nacionalista escocesa interpretada por Hollywood

    Directory of Open Access Journals (Sweden)

    Fernando TODA IGLESIA

    2014-10-01

    Full Text Available Braveheart, que se estrenó en 1995, a la vez que salía al mercado la novela del mismo nombre, escrita por Randall Wallace —también guionista de la película—, tuvo un gran éxito en Estados Unidos y en buena parte del mundo; en el Reino Unido, triunfó en los cines de Escocia, aunque no tanto en Inglaterra, como era de esperar, pues Braveheart está basada en la primera parte de la historia de las guerras de independencia de Escocia contra Inglaterra a finales del siglo XIII y principios del XIV.

  12. Implicaciones de la Intoxicación por Mercurio.

    OpenAIRE

    Myriam Gutiérrez de Salazar

    2004-01-01

    Generalidades

    El mercurio puede encontrarse en diversidad de minerales, yacimientos y en una gran variedad de estados físicos y químicos, cada uno de ellos tiene toxicidad diferente y sus aplicaciones en la industria, la agricultura y la medicina requiere de distintas evaluaciones. En Colombia es de gran importancia su estudio por el uso indiscriminado que se hace del mercurio metálico durante los procesos de “amalgamación” del oro durante la actividad minera de e...

  13. Tarabilla canaria: ¿por qué tan vulnerable?

    OpenAIRE

    Illera, Juan Carlos; Díaz, Mariano; Nogales, Manuel

    2006-01-01

    Hoy en día la tarabilla canaria sólo vive en Fuerteventura. Que no esté asentada en otras islas de Canarias similares y cercanas, como Lanzarote y Lobos, parece indicar un déficit de habitats semiáridos de calidad. La fidelidad a sus territorios actuales hace a esta pequeña ave amenazada muy vulnerable a impactos como el desarrollo turístico, el exceso de pastoreo o la depredación por gatos asilvestrados.

  14. Políticas activas en las prestaciones por desempleo

    OpenAIRE

    Gil Jiménez, Javier

    2016-01-01

    El presente trabajo explica el tema de las políticas activas y políticas activas en las prestaciones por desempleo, tanto a nivel nacional como internacional. Para explicarlo se definen las políticas activas y sus funciones, tanto de formación, orientación y reinserción laboral. También se hace mención a las reformas llevadas a cabo en las diferentes políticas y el surgimiento de nuevos programas como función de políticas activas encaminadas a la reinserción laboral. Departamento de Derech...

  15. Afastamento do trabalho por transtornos mentais e estressores psicossociais ocupacionais

    Directory of Open Access Journals (Sweden)

    João Silvestre Silva-Junior

    2015-12-01

    Full Text Available RESUMO: Introdução: Os transtornos mentais são a terceira principal causa de concessão de benefício previdenciário por incapacidade no Brasil. A exposição ocupacional a estressores psicossociais pode comprometer a saúde mental dos trabalhadores. Cabe ao perito médico previdenciário caracterizar se o adoecimento incapacitante está relacionado com as condições de trabalho. Objetivo: Avaliar os fatores associados ao afastamento do trabalho por transtornos mentais relacionados ao trabalho, em especial a percepção dos trabalhadores sobre fatores psicossociais no trabalho. Métodos: Estudo analítico realizado em São Paulo com 131 requerentes de auxílio-doença por transtornos mentais. Foram preenchidos questionários sociodemográfico, de hábitos/estilo de vida e fatores psicossociais no trabalho. Resultados: Os quadros mais frequentes foram transtornos depressivos (40,4%. Entre todos os requerimentos, 23,7% foram considerados relacionados ao trabalho. O perfil da maioria dos participantes era: sexo feminino (68,7%, até 40 anos de idade (73,3%, casado/união estável (51,1%, escolaridade igual ou superior a 11 anos (80,2%, não tabagista (80,9%, não ingeria bebida alcoólica (84%, fazia atividade física (77,9%. Sobre os fatores psicossociais, prevaleceu trabalho de alta exigência (56,5%, baixo apoio social (52,7%, desequilíbrio esforço-recompensa (55,7% e comprometimento excessivo (87,0%. Não houve associação estatística entre casos de transtornos mentais relacionados ao trabalho e as variáveis independentes. Conclusão: A concessão do benefício auxílio-doença acidentário não foi associada a variáveis sóciodemográficas, hábitos/estilo de vida ou fatores psicossociais no trabalho. A exposição ocupacional a estressores psicossociais esteve presente no relato da maioria dos trabalhadores afastados do trabalho por transtornos mentais. Entretanto, diversos casos não foram reconhecidos pela perícia m

  16. MicroCuenca, una apuesta por la lectura

    OpenAIRE

    González Merchán, Byron Darío

    2015-01-01

    MicroCuenca una apuesta por la lectura; es un proyecto que busca fomentar la lectura a través de cuentos cortos, microrelatos específicamente. En donde se publica textos y fotografías abstractas y concretas, que giran en torno a la ciudad de Cuenca y a su gente. MicroCuenca a commitment to reading; It is a project that seeks to promote reading through short stories, specifically micro-stories. Where abstract and concrete texts and pictures that revolve around the city of Cuenca and its p...

  17. Manejo de la Disnea guiado por Ecografía

    OpenAIRE

    Vicho Pereira, Raúl

    2013-01-01

    La disnea es uno de los síntomas más frecuentes en el área de Urgencias-Críticos, y la ecografía nos ofrece la posibilidad de hacer un diagnÓstico fsiopatologico-etiológico de forma exacta y precoz para iniciar inmediatamente el tratamiento adecuado. Muchas situaciones clínicas que cursan con disnea tienen en el inicio precoz del tratamiento una variable directamente relacionada con el pronóstico. De forma indirecta, pues, el diagnóstico precoz por ecografía influye en la supervivencia de est...

  18. Lesiones en el hombro causadas por electrocución

    OpenAIRE

    Herrero Barcos, L.; Martínez Martín, Angel Antonio; Herrera Rodríguez, Antonio; Cuenca Espiérrez, Jorge; Panisello Sebastiá, Juan José

    2001-01-01

    Las lesiones en el hombro tras sufrir una descarga eléctrica son raras. Presentamos siete pacientes con luxaciones y fracturas en el hombro debidas a una electrocución. Un alto porcentaje de estas lesiones se diagnostican tarde, empeorando de esta manera el pronóstico. Por ello, ante una electrocución, debemos pensar en una lesión de hombro. Shoulder injuries after an electrical shock are rare. We report seven cases with dislocation and fractures of the shoulder due to electrocution. A hig...

  19. Parto inducido por embarazo prolongado Induced delivery in prolonged gestation

    Directory of Open Access Journals (Sweden)

    Mercedes Peña Abraham

    2006-12-01

    Full Text Available Se realizó un estudio retrospectivo, descriptivo, explicativo y longitudinal sobre el comportamiento de la inducción del parto por embarazo prolongado en el Hospital Gineco-Obstétrico "Justo Legón Padilla", en el período comprendido entre enero del 2004 y diciembre del 2005.El universo estuvo constituido por la totalidad de los nacimientos por embarazo prolongado que se produjeron en el período, donde el grupo estudio estaba exclusivamente formado por las gestantes con trabajo de parto inducido (n=104; se estudiaron variables de la madre, del nacimiento y del producto de la concepción y a los datos obtenidos se les aplicó porcentaje. La edad materna más frecuente fue la del grupo de 20 - 35 años (65,5%; predominaron las nulíparas (40,4%, la vía del parto que predominó fue la transpelviana (42,3%; todos con un índice de Bishop >7 puntos La causa más frecuente de cesárea fue el sufrimiento fetal agudo (23%; el embarazo prolongado no constituyó una causa importante de Apgar Bajo, en el parto distócico fue donde ocurrió el mayor número de morbilidad materna y neonatal (9,5%, no se encontró valor significativo en la macrosomía fetal y predominó el sexo femenino en los recién nacidos (65,3%.A retrospective, descriptive, explicative and longitudinal study about the behavior of the induction of labor in prolonged pregnancy was conducted at "Justo Legón Padilla" Gyneco-Obstetric Hospital during the period of January 2004 to December 2005. The whole sample was constituted by the totality of births in prolongad pregnancy during the period where the study group was exclusively formed by pregnants who underwent induced labor (n = 104.Variables of mother, birth and conception product were taken, and percentage method was applied to data collected. The group of most frequent maternal age was 20 - 35 (65,5%, prevailing nulliparous (40,4% and transpelvic labor (42,3%, having a Bishop index = 7. The most frequent cause of cesarean section

  20. Enfermedad cardiovascular en pacientes cubanos afectados por Ataxia de Friedreich.

    OpenAIRE

    Tania Cruz Mariño; Ana Luz Portelles Caminero; William Áreas Zalazar; Luís Velázquez Pérez

    2010-01-01

    Al describir la ataxia de Friedreich, Nicholaus hizo referencia a la patología cardiaca. Esta enfermedad autosómica recesiva se debe a una mutación dinámica en el gen FRDA, codificándose deficientemente la proteína Frataxina, conduciendo a estrés oxidativo y muerte celular cardiaca. La presente investigación se desarrolló con el objetivo de describir las anomalías cardiovasculares presentes en los pacientes cubanos afectados por ataxia de Friedreich. A los individuos con diagnóstico molecular...

  1. Sintomas da injúria por frio em Heliconia spp

    Directory of Open Access Journals (Sweden)

    GUSTAVO JONNAS S. M. BEZERRA

    2008-07-01

    Full Text Available As helicônias, entre as flores tropicais, têm se destacado no mercado internacional (Europa e Estados Unidos devido à beleza, diversidade de cores e formas e durabilidade. No entanto, para a comercialização a longas distâncias é necessário adotar formas de transporte que inibam o processo de senescência das flores e conservem a qualidade pós-colheita. O transporte de flores em temperaturas baixas é o mais utilizado, no entanto, em “flores tropicais” podem causar danos de injúria por frio. O objetivo deste trabalho foi descrever os sintomas causados pela injúria por frio em hastes florais de três genótipos de helicônia (H. bihai, H. wagneriana e H. caribaea x H. bihai cv. Carib Flame. As hastes florais de helicônia foram submetidas, por 72 horas, a três condições de temperatura: refrigerador expositor (2 ºC em caixa de papelão (embalagem padrão para transporte; refrigerador expositor (2 ºC sem caixa de papelão; e laboratório a 25 ºC e U.R. 60% (testemunha. O delineamento experimental utilizado foi o inteiramente casualizado, com três tratamentos e sete repetições na primeira avaliação e cinco repetições na segunda avaliação. Os sintomas da injúria por frio foram descritos a partir da comparação do aspecto visual das hastes florais submetidas a 2 °C com as testemunhas. A temperatura de 2 ºC, com ou sem a embalagem de transporte, provocou sintomas como: aspecto de queimadura no centro das brácteas, manchas escurecidas na área de inserção das brácteas na ráquis e murchamento das extremidades dos pecíolos das folhas e da base das inflorescências.

  2. Por uma geografia dos povos a partir de suas comunidades

    OpenAIRE

    Azevedo, Rafael Sá Rego de

    2016-01-01

    Busca-se uma compreensão do pensamento geográfico de Éliseé Reclus com o objetivo de identificar suas possibilidades e contribuições para o desenvolvimento atual da Geografia, considerando a teoria comunitária como o aspecto central de seu pensamento. Para isso recorreu-se aos textos escritos pelo próprio Reclus, presentes nas coletâneas organizadas por Beatrice Giblin e Manuel Coreia de Andrade e pelo livro A Evolução a Revolução e o Ideal Anarquista. A abordagem original que Reclus tem da G...

  3. Microscopia de Varredura por Sonda em Materiais Carbonosos.

    OpenAIRE

    Rodrigo QueirÃs de Almeida

    2013-01-01

    O grafeno à definido como uma estrutura cristalina bidimensional, formada por uma rede hexagonal de Ãtomos de carbono, e devido Ãs suas propriedades eletrÃnicas e estruturais, existe um enorme interesse em investigar as propriedades fÃsicas de materiais originados da modificaÃÃo quÃmica do grafeno. AlÃm disso, o grafeno à a base para todos os alÃtropos de carbono com estrutura grafÃtica (hibridizaÃÃo sp2), podendo ser envolvido de forma esfÃrica, formando os fulerenos (0D), enrolado em uma es...

  4. ¿Como se hace publicidad por internet?

    Directory of Open Access Journals (Sweden)

    Franz Del Pozo

    2015-01-01

    Full Text Available Internet es el medio de comunicación y venta con el mayor potencial de crecimiento y efectividad al más bajo precio. Para vender se usan tarjetas de crédito, depósitos bancarios, franqueo, comercio electrónico. Explica qué y cómo se hace publicidad por Internet. La Red se usa para difundir y para vender y hay la posibilidad de hacer algo diferente a más de llegar directamente al público objetivo se interactúa con él.

  5. Tratamento da anemia ferropriva com ferro por via oral

    Directory of Open Access Journals (Sweden)

    Rodolfo D. Cançado

    Full Text Available A anemia ferropriva permanece como uma das deficiências nutricionais mais frequentes e importantes no mundo. O tratamento com ferro deve ser iniciado preferencialmente por via oral e a investigação apropriada de sua causa é obrigatória. Os autores discutem os compostos com ferro atualmente disponíveis, o perfil de eficácia, segurança e tolerabilidade desses medicamentos, e o plano terapêutico mais adequado possível para o sucesso no tratamento dessa doença tão comum e importante.

  6. War Horse: La Gran Guerra vista por Spielberg.

    OpenAIRE

    Vaccaro, Juan

    2015-01-01

    Catorce años después de dejar al soldado Ryan en el cementerio americano de Omaha Beach, Steven Spielberg vuelve al frente. En esta ocasión la Primera Guerra Mundial es el marco de la historia del último filme de este brillante director. War Horse (Caballo de batalla) significa el regreso a un territorio explorado y querido1 por el autor de E.T. El extraterrestre (E.T. The Extraterrestrial, 1982). Si 1941 (1979), El imperio del sol (Empire of the Sun, 1987), La lista de Schindler (Schindler’s...

  7. Insuficiencia renal aguda inducida por mordedura de serpiente Bothrops

    Directory of Open Access Journals (Sweden)

    Gustavo A. Aroca Martínez

    2014-01-01

    Full Text Available Mujer de 58 años de edad, remitida a urgencias por presentar cuadro clínico de insuficiencia renal aguda (IRA secundaria a mordedura de serpiente (Bothrops Atrox. Ingresa hipotensa con elevación de azoados e hiperkalemia, ecografía renal dentro de parámetros normales. Se maneja terapia dialítica con lo cual presenta mejoría clínica. En este reporte se detallan aspectos del diagnóstico, manejo clínico y posibles mecanismos fisiopatológicos que explican el daño renal.

  8. El maltrato a personas mayores atendidas por los Servicios Sociales

    OpenAIRE

    Castilla Mora, María del Rosario

    2015-01-01

    La presente tesis trata sobre el maltrato a las personas mayores (MPM). El MPM es el último tipo de violencia familiar, junto con la violencia de género y el maltrato infantil, por la que los investigadores se han preocupado, siendo hoy día el que tiene menor relevancia, tanto para la sociedad en general como a nivel político. Fue en Gran Bretaña donde los primeros investigadores comenzaron a estudiar el tema, concretamente Baker y Burston, en el año 1975, centrándose en el maltrato fís...

  9. Alteraciones hepáticas inducidas por la nutrición parenteral

    OpenAIRE

    J Salas Salvado; A Recaséns Garica

    1993-01-01

    Liver disorders induced by parenteral nutrition Alteraciones hepáticas inducidas por la nutrición parenteral Liver disorders induced by parenteral nutrition Alteraciones hepáticas inducidas por la nutrición parenteral

  10. Análisis de costos por ausentismo laboral atribuibles a licencias médicas por enfermedad. Hospital Nacional Arzobispo Loayza 2015

    OpenAIRE

    Jave Escalante, Gladys Lizeth

    2015-01-01

    Determina el costo generado por el ausentismo laboral atribuible a licencias médicas por enfermedad en el Hospital Nacional Arzobispo Loayza 2015. METODOLOGÍA: Estudio no experimental. La muestra estuvo conformada por 118 médicos asistenciales y personal de enfermería. Para el análisis de los costos se utilizó el costo de tiempo perdido del paciente, ingresos dejados de percibir por el hospital y descuento económico al trabajador. Además se realizó un análisis económico y de sensibilidad. ...

  11. Neurocriptococose por Cryptococcus neoformans não capsulado

    Directory of Open Access Journals (Sweden)

    C.S. Lacaz

    1993-09-01

    Full Text Available Os autores registram um caso de neurocriptococose em paciente HIV-negativo, por Cryptococcus neoformans acapsulado ou deficiente em cápsula. O quadro neurológico era de meningoencefalite subaguda, compatível ao diagnóstico de neurotuberculose, pelo exame do líquido cefalorraqueano (LCR, Estruturas leveduriformes foram encontradas no interior de macrófagos, ao exame citomorfológico do LCR. Cultivo do sedimento do LCR revelou a presença de Cryptococcus neoformans não capsulado (identificação bioquímica. A inoculação da amostra em camundongo, por via intraperitoneal, permitiu a produção de cápsula que desaparecia em cultivos. Foi estudada a micromorfologia do fungo à microscopia eletrônica de varredura. A evolução foi favorável com o emprego da anfotericina B associada a 5-fluorocitosina. Não foi caracterizada a variadade de Criptococcus neoformans agente do processo.

  12. Paludismo por Plasmodiumvivax: presentación de un caso

    Directory of Open Access Journals (Sweden)

    Mérida Morales Lugo

    2014-08-01

    Full Text Available Introducción: el paludismo o malaria, es la enfermedad infecciosa tropical más frecuente del mundo y dependiendo del subtipo del Plasmodium se puede definir su distribución geográfica. La cantidad de casos reportados en los últimos años ha aumentado debido al incremento en el número de viajeros a zonas endémicas, falta de profilaxis adecuada y la prevalencia cada vez mayor de parásitos resistentes a los fármacos empleados para su tratamiento. Caso clínico: se presenta un caso con un síndrome febril agudo y antecedente epidemiológico de regresar de Guinea Ecuatorial, país donde el paludismo se considera endémico. Conclusiones: la malaria por Plasmodiumvivax es considerada una enfermedad de prevalencia muy baja, curso clínico benigno y distribución geográfica limitada a zonas de Asia, América del Sur y Oceanía; sin embargo, en este trabajo se pudo demostrar la infección por P. vivax en viajero procedente de Guinea Ecuatorial donde el tipo de Plasmodiummás frecuente es el falciparum.

  13. La "Ley Pinochet de Telecomunicaciones" Disputa por el dial

    Directory of Open Access Journals (Sweden)

    Marcela A. Amaya García

    2015-01-01

    Full Text Available En Chile existen 1.264 radios comerciales, el 99 por ciento de los chilenos escucha radio en un promedio de 4,6 horas diarias. El éxito financiero alcanzado en el negocio de la radiodifusión durante la Dictadura abrió el hambre a los capitales extranjeros lo que significó una concentración importante de la propiedad que no se conocía en Chile. Una fecha clave para la radiotelefonía chilena fue 1990 en que la naciente democracia abrió camino a los nuevos medios. Dos años más tarde la derecha política se levantó con el objetivo de modificar la ley de radiodifusión existente. Casi de manera gratuita se entregaron concesiones radiales por 25 años a los nacientes empresarios de la radiodifusión, esgrimiendo como pretexto el cambio de lo analógico a lo digital.

  14. EL MST Y LAS DISPUTAS POR LAS ALTERNATIVAS EN BRASIL

    Directory of Open Access Journals (Sweden)

    João Pedro Stédile

    2012-04-01

    Full Text Available La victoria del presidente Lulaen las últimas elecciones cambió la correlaciónde fuerzas de la lucha por la reforma agraria enBrasil. Por los compromisos históricos del PT,su liderazgo y como partido de izquierda,tenemos ahora un gobierno federal que apoyala reforma agraria, al contrario de lo que fue elgobierno de Fernando Henrique Cardoso. Porlo tanto, la disputa se sitúa en otro nivel. Sinembargo, hay otras fuerzas poderosas que seoponen a la reforma agraria como lo son ellatifundio, el modelo neoliberal del agro-negocio, la clase dominante como un todo, elEstado burgués brasileño y los medios decomunicación que actúan como un espacio delucha ideológica que disputa la hegemonía en lasociedad contra nosotros. En este nuevocontexto, el MST evalúa que ahora sí se puedeavanzar en la reforma agraria, pero que es unmomento de acumulación de fuerzas y no degrandes definiciones que consoliden la reformaagraria de nuevo tipo que nosotrosdefendemos. Es decir, estamos acumulandopara el futuro.

  15. Efectividad de la acupuntura con tachuela en afectados por epicondilitis

    Directory of Open Access Journals (Sweden)

    Mercedes Gay Muguercia

    2014-06-01

    Full Text Available Se realizó una intervención terapéutica en 20 pacientes con epicondilitis, remitidos de la consulta de Ortopedia al Departamento de Medicina Natural Tradicional del Hospital Provincial Docente Clinicoquirúrgico "Saturnino Lora Torres" de Santiago de Cuba, de septiembre a diciembre de 2012, con vistas a determinar la efectividad de la acupuntura con tachuela en ellos. Los afectados fueron valorados y, de forma aleatoria, se les distribuyó en 2 grupos de 10 integrantes cada uno: el de estudio, que recibió acupuntura (agujas de 0,2 mm de forma permanente en los puntos Ashi y en el IG-11, y el de control, tratado convencionalmente con antiinflamatorios y analgésicos. Luego de aplicadas las terapias, los pacientes fueron valorados a los 5, 10 y 15 días, teniendo en cuenta el cuadro clínico dado por dolor, inflamación e impotencia funcional. La regresión de los síntomas se evaluó por la escala visual analógica, y se obtuvo una efectividad marcada del tratamiento con acupuntura en relación con el medicamentoso

  16. Homenaje a Rosario Camacho. Por Antonio Bonet Correa.

    Directory of Open Access Journals (Sweden)

    Antonio Bonet Correa

    2013-01-01

    Full Text Available En el actual panorama de la Historia del Arte en España hay que tener en cuenta las valiosísimas aportaciones, tanto científicas como literarias, producidas por las numerosas e importantes figuras femeninas dedicadas a la docencia y a la investigación de una disciplina de las ciencias humanas que, con anterioridad, parecía estar exclusivamente en manos de los varones. Sin duda alguna este hecho se debe al cambio general en las costumbres y a la revolución llevada a cabo por las mujeres en la moderna vida social. En lo que, de manera concreta, se refiere al ámbito universitario y al área de la educación, fue una conquista lenta y progresiva a lo largo del siglo XX. En la pasada centuria, fueron las maestras de escuela, formadas en las Escuelas Normales, las que inicialmente se impusieron en la Primera Enseñanza. Después, en la II República, las mujeres accedieron al profesorado de los Institutos de Segunda Enseñanza. Finalmente, al terminar la Guerra Civil, en el último tercio de la pasada centuria, ocuparon los puestos principales de las universidades, centros de investigación, dirección de museos, galerías de arte y ejercieron con rotundo éxito la historia y la crítica de arte.

  17. Letalidad por accidentes de trabajo en Villa Clara

    Directory of Open Access Journals (Sweden)

    Miguel Gómez Vital

    1999-01-01

    Full Text Available Se valora la problemática de la letalidad por accidentes laborales en la provincia de Villa Clara, en el período comprendido entre 1987 y 1997. Se determinan las principales causas, y fue la conducta negligente del individuo la que más incidió. En los últimos años de la década del 80 se registraron más cantidad de muertes por accidentes de trabajo, los que ocurrieron fundamentalmente en el puesto laboral. Queda puntualizado el importante rol del equipo médico en instituciones laborales.The problem of letality from working accidents in the province of Villa Clara from 1987 to 1997 was evaluated. The main causes were also determined. Individual negligent behaviour proved to be the first cause. More deaths from working accidents were registered late in the 1980s. Most of these accidents occurred at the working place. It was stressed the important role played by the medical team at the working institutions

  18. ¿POR QUÉ DEFENDER LA CIENCIA EN COLOMBIA?

    Directory of Open Access Journals (Sweden)

    Enrique Forero González

    2016-12-01

    Full Text Available

    Un grupo de nuestros más destacados científicos le cuenta a la sociedad colombiana por qué es necesario defender la ciencia en el país, demuestra con lujo de detalles porqué este tema se considera importante y se refiere a la forma como los países más avanzados del mundo han alcanzado esos niveles de desarrollo gracias a sus inversiones en educación, ciencia y tecnología. También, llama la atención sobre el hecho que la clase política tiene el deber ético de hacer políticas sobre ciencia, tecnología e innovación fundamentándose en los planteamientos de los académicos. En efecto, cuando se definen políticas como las contenidas en el documento Conpes de Competitividad, Ciencia, Tecnología e Innovación sin la participación de la comunidad académica, el resultado siempre es deficiente. Adicionalmente, así como el documento Conpes no deja tranquila a la comunidad científica, el Sistema Nacional de Regalías también produce muchas dudas y preocupaciones, por lo cual se sugiere que se piense desde el Senado en una reforma a ese sistema para que, por ejemplo, la evaluación y posterior aprobación de los proyectos de ciencia, tecnología e innovación sean definidas sobre una base académica, no política.

    Para comenzar, da la impresión que, en general, las políticas gubernamentales ignoran por completo a la comunidad académica. En días recientes recibí una invitación por parte del Departamento Nacional de Planeación para el lanzamiento del Plan Maestro de la Orinoquia, ‘una estrategia integral con proyección para el año 2030, para el desarrollo regional, con un enfoque diferenciado que involucra la articulación Nación-Territorio’, pero entre los conferencistas invitados no había ni un sólo representante de la comunidad científica o académica. Sin embargo, cabe señalar que no hay área de importancia para el país que no sea impactada por las contribuciones de las ciencias básicas: la salud, el

  19. De compras por el supermercado genético

    Directory of Open Access Journals (Sweden)

    Singer, Peter

    2002-12-01

    Full Text Available Should we say that selective abortion is a “powerful message that we seek to eliminate future persons”? When deaf parents want to have a deaf children, Are they crazy? Are they advocates of a culture –the Deaf culture? If genetic engineering can give us health, intelligent, and athletic childrens, why say not to this advantages? The aim of this article is not to deal with all objections that could be urged against these options; the purpose is developing a clear understanding of the central values at stake.

    ¿Estamos eliminando una cultura, la de los sordos, cuando tratamos de evitar que nazcan niños sordos? El aborto terapéutico, ¿significa que, por ejemplo, creemos que las vidas de los afectados por síndrome de Down son vidas de menor valor que las vidas “normales”? Si se permitiera la manipulación genética de los embriones ¿sería poco ético encargar hijos guapos y altos? Este artículo no aporta respuestas a estas preguntas, pero sí que plantea los términos para dar cuenta de ellas y eleva acta de lo difícil que es dar una respuesta concluyente.

  20. Factores de riesgo asociados a la mortalidad por enterocolitis necrotizante

    Directory of Open Access Journals (Sweden)

    Vivian R. Mena Miranda

    Full Text Available La enterocolitis necrotizante es una urgencia gastrointestinal de causa multifactorial muy relacionada con el neonato pretérmino. Su elevada mortalidad radica en la falta de prevención por el médico a cualquier nivel de atención y a su diagnóstico tardío en los grupos de riesgo. Se realizó un estudio retrospectivo de los 63 pacientes fallecidos por enterocolitis necrotizante durante un período de 25 años en el Hospital Pediátrico Docente de Centro Habana, donde se encontró que el 71,4 % de los afectados era de la raza blanca y el 68,2 % del sexo masculino. La edad más frecuente se encontró en los menores de 3 meses de edad (36,5 % y el 46 % del total de la muestra estudiada tuvo un peso al nacer inferior a los 1 500 g. La prematuridad apareció asociada en el 55,5 % de los fallecidos y el 65 % tuvo lactancia mixta desde el momento de nacimiento.

  1. Profilaxis de la úlcera gastrointestinal producida por AINES

    Directory of Open Access Journals (Sweden)

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  2. ENCUESTA EXPLORATORIA DE INFECCION POR Brucella canis EN PERROS DE

    Directory of Open Access Journals (Sweden)

    Ana Pardo D

    2009-08-01

    Full Text Available Objetivo. Determinar la presencia de anticuerpos a B. canis en perros domésticos y callejeros del municipio de Villavicencio, Colombia. Materiales y métodos. Se utilizó la prueba de aglutinación rápida en placa con antígeno menos mucoide (M- en 201 muestras de suero. En dos animales seropositivos se realizó intento de aislamiento por hemocultivo en medio selectivo para Brucella (oxoid®. En un animal seropositivo, con crecimiento bacteriano con características morfológicas sugestivas a B. canis se realizó histopatología de testículo, bazo e hígado. Resultados. La seropositividad general fue de 1.49% y correspondió a tres caninos machos, dos de los cuales presentaron signos clínicos de epididimitis y orquitis (unilateral. El cultivo y la histopatología no fueron concluyentes para el diagnostico de B. canis. Conclusiones. La seropositividad fue baja y sugiere que la población estudiada no ha estado en contacto con la bacteria. La presencia de reactores puede estar asociado con falsos positivos. El no aislamiento de la bacteria no indica que la enfermedad no exista por lo que se requiere de nuevos estudios.

  3. Intoxicação por salinomicina em bovinos

    Directory of Open Access Journals (Sweden)

    Gava Aldo

    1997-01-01

    Full Text Available Descreve-se um surto de intoxicação por salinomicina em bovinos. De um grupo de 46 novilhas Simmental, 13 morreram após manifestação de incoorde-nação, andar rígido, diarréia, emagrecimento, tremores musculares, cansaço após pequenos movimentos, dispnéia e, ocasionalmente, urina escura. Os animais eram encontrados mortos ou morriam subitamente quando movimentados. As lesões macroscópicas consistiam basicamente de áreas pálidas no miocárdio, hemorragias subepicárdicas, hidropericárdio, hidrotórax, congestão e edema pulmonar e, em alguns casos, edema de declive e fígado de noz-moscada. Os principais achados microscópicos foram lesões multifocais de necrose e perda de fibras miocárdicas, que eram substituídas por tecido conjuntivo fibroso. Cerca de 9 dias antes do início da mortandade, as novilhas tinham sido medicadas para eimeriose, com um premix contendo 6% de salinomicina.

  4. Por uma criminologia crítica feminista

    Directory of Open Access Journals (Sweden)

    Camila Damasceno de Andrade

    2016-08-01

    Full Text Available Este artigo tem o escopo de trazer elementos para a construção de uma criminologia crítica de cunho feminista, motivado pela histórica exclusão das perspectivas de gênero nos mais afamados discursos criminológicos e pela discordância em relação ao pleito feminista por punição. Discorre, primeiramente, sobre a ausência das mulheres nas produções científicas e, em especial, na criminologia. Em seguida, analisa as reflexões provocadas pelo surgimento da criminologia feminista, que, ao mesmo tempo em que elabora profundas críticas ao sistema penal, também atua no sentido de legitimá-lo. Por fim, propõe a formulação de uma criminologia que acolha as experiências femininas sem, todavia, clamar pela expansão do controle penal.

  5. El apoyo social en la mujer maltratada por su pareja

    Directory of Open Access Journals (Sweden)

    María Pilar Matud Aznar

    2003-01-01

    Full Text Available En este estudio descriptivo mediante encuestas analizamos el apoyo social en tres grupos de mujeres maltratadas: uno formado por 66 mujeres que estaban conviviendo con el agresor, otro de 95 mujeres que, aunque habían sido maltratadas por su pareja, ya no convivían con el agresor, y un grupo de 39 mujeres que se encontraban en casas de acogida. Encontramos que las áreas donde las mujeres maltratadas percibían menos apoyo social eran en la laboral, económica y la familiar, y las personas que citaban con más frecuencia como fuente de apoyo fueron las amistades, los hijos y la familia. Las mujeres que estaban conviviendo con el agresor tenían menos apoyo social estructural y percibido que las mujeres que ya no convivían con él y que un grupo control de mujeres no maltratadas. El apoyo social correlacionaba negativamente con disfunción social y positivamente con autoestima. En el grupo de mujeres no maltratadas y en el que ya no convivía con el agresor el apoyo social percibido correlacionaba negativamente con sintomatología depresiva, somática y de ansiedad e insomnio.

  6. Factores de riesgo asociados a la mortalidad por enterocolitis necrotizante

    Directory of Open Access Journals (Sweden)

    Vivian R. Mena Miranda

    Full Text Available La enterocolitis necrotizante (ECN es una urgencia gastrointestinal de causa multifactorial muy relacionada con el neonato pretérmino. Su elevada mortalidad radica en la falta de prevención por el médico a cualquier nivel de atención y a su diagnóstico tardío en los grupos de riesgo. Se realizó un estudio retrospectivo de los 63 pacientes fallecidos por ECN durante un período de 25 años en el Hospital Pediátrico Docente "Centro Habana", donde se encontró que 71,4 % de los afectados eran de la raza blanca y el 68,2 % del sexo masculino. La edad más frecuente se halló en los menores de 3 meses de edad (36,5 % y el 46 % del total de la muestra estudiada tuvo un peso al nacer inferior a los 1 500 g. La prematuridad apareció asociada en el 55,5 % de los fallecidos y el 65 % tuvo lactancia mixta desde el momento de nacimiento.

  7. Redes neuronales artificiales para la predicción de la calidad en soldadura por resistencia por puntos

    Directory of Open Access Journals (Sweden)

    Martín, O.

    2006-10-01

    Full Text Available An artificial neural network is proposed as a tool for predicting from three parameters (weld time, current intensity and electrode sort if the quality of a resistance spot weld reaches a certain level or not. The quality is determined by cross tension testing. The fact of reaching this quality level or not is the desired output that goes with each input of the artificial neural network during its supervised learning. The available data set is made up of input/desired output pairs and is split randomly into a training subset (to update synaptic weight values and a validation subset (to avoid overfitting phenomenon by means of cross validation.

    Se propone una red neuronal artificial como herramienta para predecir, a partir de tres parámetros operativos (tiempo de soldadura, intensidad de corriente y tipo de electrodo, si la calidad de una unión soldada por resistencia por puntos alcanza o no un cierto nivel. El entrenamiento de la red neuronal conlleva que la calidad se determine previamente mediante ensayos de tracción en probetas en cruz. El hecho de alcanzar o no el citado nivel de calidad constituye la respuesta objetivo que acompaña a cada entrada de la red neuronal artificial durante su aprendizaje supervisado. El conjunto de datos disponible está formado por pares entrada/salida objetivo y se divide de forma aleatoria en un subconjunto de entrenamiento (para actualizar los valores de los pesos sinápticos y en un subconjunto de validación (para combatir el fenómeno de overfitting mediante validación cruzada.

  8. Ejecución de puentes pretensados por voladizos sucesivos

    Directory of Open Access Journals (Sweden)

    Fernández Casado, Carlos

    1963-12-01

    Full Text Available The system of construction whereby successive extensions of a cantilevered structure are carried out has made it possible to extend, to an extraordinary extent, the free spans of straight section prestressed concrete bridges. At present the Bendorf bridge is being constructed, whose central span in 258 ms long. This system was first used in Brazil, for the construction of an ordinary reinforced concrete bridge over the river Peixe. But the method fell into disuse, except for very few exceptions, until Firsterwalder against brought it up to date 20 years later, when building the Neckar bridge, made of prestressed concrete. With new technique all the advantages of the system could be exploited, as well as achieving a very rapid construction. This constructional procedure leads directly to the structural type known as compensated cantilevers. T shaped cells are attached together by means of prestressing cables to form advancing cantilevers. Thereby a total bridge structure is formed, whose span is twice that of each cantilevered half. This method can be applied to other bridge types, such as dintels with overhanging sections (this was the first new application, single span portal frames, T portal frames, continuous beams, etc. The typical constructional method is to move the formwork, which is anchored and cantilevered beyond the constructed part. A weekly progress of 3,50 ms is normal. It is also possible to employ prefabricated sections, which are successively joined to the ones already in place. (Owing to the length of this article, it will be published in several successive issues.El sistema de construcción por voladizos sucesivos ha permitido ampliar, de modo extraordinario, las luces de los puentes de tramo recto de hormigón pretensado. Actualmente se construye el puente de Bendorf con tramo central de 258 metros. Se utilizó por primera vez en Brasil para la construcción de un puente de hormigón armado normal sobre el río Peixe, pero

  9. Ejecución de puentes pretensados por voladizos sucesivos

    Directory of Open Access Journals (Sweden)

    Fernández Casado, Carlos

    1964-02-01

    Full Text Available The system of construction whereby successive extensions of a cantilevered structure are carried out has made it possible to extend, to an extraordinary extent, the free spans of straight section prestressed concrete bridges. At present the Bendorf bridge is being constructed, whose central span is 358 m long. This system was first used in Brazil, for the construction of an ordinary reinforced concrete bridge over the river Peixe. But the method fell into disuse, except for very few exceptions, until Firsterwalder again brought it up to date 20 years later, when building the Neckar bridge, made of prestressed concrete. With this new technique all the advantages of the system could be exploited, as well as achieving a very rapid construction. This constructional procedure leads directly to the structural type known as compensate cantilevers. T shaped cells are attached together by means of prestressing cables to form advancing cantilevers. Thereby a total bridge structure is formed, whose span is twice that of each cantilevered half. This method can be applied to other bridge types, such as dintels with overhanging sections (this was the first new application, single span portal frames, T portal frames, continuous beams, etc. The typical constructional method is to move the formwork, which is anchored and cantilevered beyond the constructed part. A weekly progress of 3,50 m is normal. It is also possible to employ prefabricated sections, which are successively joined to the ones already in place. (Owing to the length of this article, it will be published in several successive issues.El sistema de construcción por voladizos sucesivos ha permitido ampliar, de modo extraordinario, las luces de los puentes de tramo recto de hormigón pretensado. Actualmente se construye el puente de Bendorf con tramo central de 258 metros. Se utilizó por primera vez en Brasil para la construcción de un puente de hormigón armado normal sobre el río Peixe, pero

  10. La anemia por deficiencia de hierro en la población infantil de Cuba. Brechas por cerrar

    OpenAIRE

    Pita-Rodríguez, Gisela; Jiménez-Acosta, Santa

    2011-01-01

    La anemia es un problema de salud mundial que afecta tanto a los países desarrollados como a aquellos en desarrollo. Sus causas pueden ser multifactoriales y frecuentemente pueden coexisitir varias de ellas; la principal es la baja ingestión de alimentos con fuentes adecuadas de hierro, tanto en cantidad como en calidad. En Cuba se está trabajando desde el año 1987 en el desarrollo de programas de intervención para la prevención de la anemia por deficiencia de hierro en la población, pero a p...

  11. Vivencias psicosociales reveladas por niños que reciben tratamiento con quimioterapia por cáncer

    OpenAIRE

    BLANCA CECILIA VANEGAS DE AHOGADO; MARÍA ELVIRA BELTRÁN HERRERA; VIVIANA CIFUENTES GIL; YULIETH ALEJANDRA DUARTE; JIMMY JULIÁN MONTOYA; JOHANNA MARCELA RIVERA ZABALA; MARÍA MERCEDES LAFAURIE VILLAMIL

    2009-01-01

    Se realizó un estudio cualitativo con el propósito de descubrir las vivencias psicosociales de niños y niñas de 9 a 12 años que recibían tratamiento con quimioterapia por cáncer. La recolección de la información se hizo mediante encuentros lúdicos con el apoyo de algunas preguntas básicas que facilitaron las revelaciones narrativas. Tres aspectos se destacan en los hallazgos del estudio: vivencias desfavorables, vivencias relacionadas con la autoestima y vivencias favorables; las dos primeras...

  12. Choque cardiogênico por dissulfiram Shockcardiogénico por disulfiram Cardiogenic shock caused by disulfiram

    Directory of Open Access Journals (Sweden)

    Ana Jerónimo

    2009-03-01

    Full Text Available A intoxicação medicamentosa por dissulfiram é uma situação rara, mas, que pode se apresentar com manifestações cardiovasculares graves e potencialmente fatais, como choque cardiogênico. É apresentado o caso de uma paciente com choque refratário, após intoxicação voluntária por dissulfiram. A avaliação clínica e bioquímica, junto à avaliação ecocardiográfica e à monitorização invasiva, confirmaram tratar-se de um choque cardiogênico associado a esse fármaco. São discutidos os mecanismos de ação conhecidos do dissulfiram e descritos os principais efeitos colaterais, especialmente os cardiovasculares, alertando para a importância da suspeição diagnóstica e da abordagem terapêutica imediata mais adequada nesse contexto.La intoxicación medicamentosa por disulfiram es una situación rara, aunque puede presentarse con manifestaciones cardiovasculares graves y potencialmente fatales, como el shock cardiogénico. Este relato presenta el caso de una paciente con shock refractario, tras intoxicación voluntaria por disulfiram. La evaluación clínica y bioquímica, junto a la evaluación ecocardiográfica y el monitoreo invasivo, confirmaron tratarse de un shock cardiogénico asociado a ese fármaco. A lo largo del presente relato se discuten los mecanismos de acción del disulfiram conocidos, así como se describen los principales efectos colaterales, específicamente los cardiovasculares. En este sentido, también se alerta para la importancia de la sospecha diagnóstica y del abordaje terapéutico inmediato más adecuado a este contexto.Drug intoxication with disulfiram is a rare condition that may lead to severe and potentially fatal cardiovascular manifestations such as cardiogenic shock. We report the case of a female patient with refractory shock after deliberate self-poisoning with disulfiram. Clinical, biochemical and echocardiographic assessment, as well as invasive monitoring confirmed cardiogenic shock

  13. Respuesta al entrenamiento en EPOC: Diferencia entre limitación por fatiga muscular y por disnea

    OpenAIRE

    Martín Sívori; Laura Bustamante; Alejandro Martínez Fraga; Marta Almeida; César Saenz

    2011-01-01

    Este estudio comparó la respuesta post entrenamiento al ejercicio en pacientes limitados por fatiga muscular (LF) vs. disnea (LD). Se incluyeron pacientes con EPOC moderada y grave (definición GOLD), clasificándolos en LF si la respuesta a cicloergometría máxima tenía ≥ 2 puntos en la escala de Borg para fatiga muscular vs. disnea; LD a la inversa. Se realizaron ergometría submáxima, 6 minutos y pruebas de calidad de vida mediante cuestionario. Fueron entrenados 3 veces/semana, 90 min/sesión ...

  14. Premian record transmision de datos a 5,44 gigabits por segundo

    CERN Multimedia

    2003-01-01

    "El Laboratorio Europeo para la Fisica de Particulas (CERN) y el Instituto de Tecnologia de California (EEUU) seran galardonados con un premio por haber conseguido batir el record de velocidad de transmision por Internet a 5,44 gigabits por segundo, informaron hoy, miercoles, fuentes de ambos organismos" (1/2 page).

  15. Multiple mechanisms of phase variation of PorA in Neisseria meningitidis

    NARCIS (Netherlands)

    van der Ende, A.; Hopman, C. T.; Dankert, J.

    2000-01-01

    Previously, we reported that PorA expression in Neisseria meningitidis is modulated by variation in the length of the homopolymeric tract of guanidine residues between the -35 and -10 regions of the promoter or by deletion of porA. To reveal additional mechanisms of variation in PorA expression, the

  16. Differential Control Efficacies of Vitamin Treatments against Bacterial Wilt and Grey Mould Diseases in Tomato Plants

    Directory of Open Access Journals (Sweden)

    Jeum Kyu Hong

    2016-10-01

    Full Text Available Bacterial wilt and grey mould in tomato plants are economically destructive bacterial and fungal diseases caused by Ralstonia solanacearum and Botrytis cinerea, respectively. Various approaches including chemical and biological controls have been attempted to arrest the tomato diseases so far. In this study, in vitro growths of bacterial R. solanacearum and fungal B. cinerea were evaluated using four different vitamins including thiamine (vitamin B1, niacin (vitamin B3, pyridoxine (vitamin B6, and menadione (vitamin K3. In planta efficacies of the four vitamin treatments on tomato protection against both diseases were also demonstrated. All four vitamins showed different in vitro antibacterial activities against R. solanacearum in dose-dependent manners. However, treatment with 2 mM thiamine was only effective in reducing bacterial wilt of detached tomato leaves without phytotoxicity under lower disease pressure (10⁶ colony-forming unit [cfu]/ml. Treatment with the vitamins also differentially reduced in vitro conidial germination and mycelial growth of B. cinerea. The four vitamins slightly reduced the conidial germination, and thiamine, pyridoxine and menadione inhibited the mycelial growth of B. cinerea. Menadione began to drastically suppress the conidial germination and mycelial growth by 5 and 0.5 mM, respectively. Grey mould symptoms on the inoculated tomato leaves were significantly reduced by pyridoxine and menadione pretreatments one day prior to the fungal challenge inoculation. These findings suggest that disease-specific vitamin treatment will be integrated for eco-friendly management of tomato bacterial wilt and grey mould.

  17. Differential Control Efficacies of Vitamin Treatments against Bacterial Wilt and Grey Mould Diseases in Tomato Plants.

    Science.gov (United States)

    Hong, Jeum Kyu; Kim, Hyeon Ji; Jung, Heesoo; Yang, Hye Ji; Kim, Do Hoon; Sung, Chang Hyun; Park, Chang-Jin; Chang, Seog Won

    2016-10-01

    Bacterial wilt and grey mould in tomato plants are economically destructive bacterial and fungal diseases caused by Ralstonia solanacearum and Botrytis cinerea , respectively. Various approaches including chemical and biological controls have been attempted to arrest the tomato diseases so far. In this study, in vitro growths of bacterial R. solanacearum and fungal B. cinerea were evaluated using four different vitamins including thiamine (vitamin B1), niacin (vitamin B3), pyridoxine (vitamin B6), and menadione (vitamin K3). In planta efficacies of the four vitamin treatments on tomato protection against both diseases were also demonstrated. All four vitamins showed different in vitro antibacterial activities against R. solanacearum in dose-dependent manners. However, treatment with 2 mM thiamine was only effective in reducing bacterial wilt of detached tomato leaves without phytotoxicity under lower disease pressure (10 6 colony-forming unit [cfu]/ml). Treatment with the vitamins also differentially reduced in vitro conidial germination and mycelial growth of B. cinerea . The four vitamins slightly reduced the conidial germination, and thiamine, pyridoxine and menadione inhibited the mycelial growth of B. cinerea . Menadione began to drastically suppress the conidial germination and mycelial growth by 5 and 0.5 mM, respectively. Grey mould symptoms on the inoculated tomato leaves were significantly reduced by pyridoxine and menadione pretreatments one day prior to the fungal challenge inoculation. These findings suggest that disease-specific vitamin treatment will be integrated for eco-friendly management of tomato bacterial wilt and grey mould.

  18. Selection and Characterization of Endophytic Bacteria as Biocontrol Agents of Tomato Bacterial Wilt Disease

    Directory of Open Access Journals (Sweden)

    ABDJAD ASIH NAWANGSIH

    2011-06-01

    Full Text Available Biological control of bacterial wilt pathogen (Ralstonia solanacearum of tomato using endophytic bacteria is one of the alternative control methods to support sustainable agriculture. This study was conducted to select and characterize endophytic bacteria isolated from healthy tomato stems and to test their ability to promote plant growth and suppress bacterial wilt disease. Among 49 isolates successfully isolated, 41 were non-plant pathogenic. Green house test on six selected isolates based on antagonistic effect on R. solanacearum or ability to suppress R. solanacearum population in dual culture assays obtained BC4 and BL10 isolates as promising biocontrol agents. At six weeks after transplanting, plants treated with BC4 isolate showed significantly lower disease incidence (33% than that of control (83%. Plants height was not significantly affected by endophytic bacterial treatments. Based on 16S rRNA sequence, BC4 isolate had 97% similarity with Staphylococcus epidermidis (accession number EU834240.1, while isolate BL10 had 98% similarity with Bacillus amyloliquefaciens strain JK-SD002 (accession number AB547229.1.

  19. A dual resistance gene system prevents infection by three distinct pathogens.

    Science.gov (United States)

    Narusaka, Mari; Kubo, Yasuyuki; Shiraishi, Tomonori; Iwabuchi, Masaki; Narusaka, Yoshihiro

    2009-10-01

    Colletotrichum higginsianum causes typical anthracnose lesions on the leaves, petioles, and stems of cruciferous plants. Inoculation of Arabidopsis thaliana ecotype Columbia leaves with C. higginsianum results in fungal growth and disease symptoms reminiscent of those induced in other cruciferous plants. We performed map-based cloning and natural variation analysis of 19 A. thaliana ecotypes to identify a dominant resistance locus against C. higginsianum. We found that the A. thaliana RCH2 (for recognition of C. higginsianum) locus encodes two NB-LRR proteins, both of which are required for resistance to C. higginsianum in the A. thaliana ecotype Ws-0. Both proteins are well-characterized R proteins involved in resistance against bacterial pathogens; RRS1 (resistance to Ralstonia solanacearum 1) confers resistance to strain Rs1000 of R. solanacearum and RPS4 to Pseudomonas syringae pv. tomato strain DC3000 expressing avrRps4 (Pst-avrRps4). Furthermore, we found that both RRS1-Ws and RPS4-Ws genes are required for resistance to Pst-avrRps4 and to Rs1002 R. solanacearum. We therefore demonstrate that a pair of neighboring genes, RRS1-Ws and RPS4-Ws, function cooperatively as a dual R-gene system against at least three distinct pathogens.

  20. APPLICATIONS OF POTASSIUM FERTILIZER AND Bacillus sp. BIOPESTICIDE FOR INCREASING TOMATO RESISTANCE TO BACTERIAL WILT DISEASE

    Directory of Open Access Journals (Sweden)

    Nur Prihatiningsih

    2011-02-01

    Full Text Available Bacterial wilt on tomato caused by Ralstonia solanacearum is a crucial disease, because it can reduce yield until 50%. The aims of this research were: 1 to find out biopesticide formula for Bacillus sp.growth, 2 to test Bacillus sp. against R. solanacearum in vitro, 3 to test potassium fertilizer combined with Bacillus sp. for enhancing tomato resistance to the bacterial wilt disease. The research was conducted in 2 steps i.e to test the persistence of Bacillus sp. in biopesticide formula, and to test the best combination of both potassium and the Bacillus sp. biopesticide. The results showed that Bacillus B298 was the best isolate in its persistence on the biopesticide formula of organic growth medium+CaCO3+CMC 1%+mannitol 1%, and in inhibiting R. solanacearum. The best biopesticide formula for the Bacillus sp. persistence was growth organic media+ CaCO3+CMC 1%+mannitol 1%. Bacillus sp. was able to increase tomato resistance to the bacterial wilt disease from the category of susceptible to be tolerant and becoming resistant.

  1. Hydrogen Peroxide- and Nitric Oxide-mediated Disease Control of Bacterial Wilt in Tomato Plants

    Directory of Open Access Journals (Sweden)

    Jeum Kyu Hong

    2013-12-01

    Full Text Available Reactive oxygen species (ROS generation in tomato plants by Ralstonia solanacearum infection and the role of hydrogen peroxide (H₂O₂ and nitric oxide in tomato bacterial wilt control were demonstrated. During disease development of tomato bacterial wilt, accumulation of superoxide anion (O₂− and H₂O₂ was observed and lipid peroxidation also occurred in the tomato leaf tissues. High doses of H₂O₂and sodium nitroprusside (SNP nitric oxide donor showed phytotoxicity to detached tomato leaves 1 day after petiole feeding showing reduced fresh weight. Both H₂O₂and SNP have in vitro antibacterial activities against R. solanacearum in a dose-dependent manner, as well as plant protection in detached tomato leaves against bacterial wilt by 10⁶ and 10⁷ cfu/ml of R. solanacearum. H₂O₂- and SNP-mediated protection was also evaluated in pots using soil-drench treatment with the bacterial inoculation, and relative ‘area under the disease progressive curve (AUDPC’ was calculated to compare disease protection by H₂O₂ and/or SNP with untreated control. Neither H₂O₂ nor SNP protect the tomato seedlings from the bacterial wilt, but H₂O₂+ SNP mixture significantly decreased disease severity with reduced relative AUDPC. These results suggest that H₂O₂ and SNP could be used together to control bacterial wilt in tomato plants as bactericidal agents.

  2. Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture

    Directory of Open Access Journals (Sweden)

    Belén Álvarez

    2017-07-01

    Full Text Available Bacterial wilt diseases caused by Ralstonia solanacearum, R. pseudosolanacearum, and R. syzygii subsp. indonesiensis (former R. solanacearum species complex are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the advantage of being environmentally friendly. Advances in bacterial wilt biocontrol include an increasing interest in bacteriophage-based treatments as a promising re-emerging strategy. Bacteriophages against the bacterial wilt pathogens have been described with either lytic or lysogenic effect but, they were proved to be active against strains belonging to R. pseudosolanacearum and/or R. syzygii subsp. indonesiensis, not to the present R. solanacearum species, and only two of them demonstrated successful biocontrol potential in planta. Despite the publication of three patents on the topic, until now no bacteriophage-based product is commercially available. Therefore, there is still much to be done to incorporate valid bacteriophages in an integrated management program to effectively fight bacterial wilt in the field.

  3. Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture.

    Science.gov (United States)

    Álvarez, Belén; Biosca, Elena G

    2017-01-01

    Bacterial wilt diseases caused by Ralstonia solanacearum , R. pseudosolanacearum , and R. syzygii subsp. indonesiensis (former R. solanacearum species complex) are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the advantage of being environmentally friendly. Advances in bacterial wilt biocontrol include an increasing interest in bacteriophage-based treatments as a promising re-emerging strategy. Bacteriophages against the bacterial wilt pathogens have been described with either lytic or lysogenic effect but, they were proved to be active against strains belonging to R. pseudosolanacearum and/or R. syzygii subsp. indonesiensis , not to the present R. solanacearum species, and only two of them demonstrated successful biocontrol potential in planta . Despite the publication of three patents on the topic, until now no bacteriophage-based product is commercially available. Therefore, there is still much to be done to incorporate valid bacteriophages in an integrated management program to effectively fight bacterial wilt in the field.

  4. Water Extract from Spent Mushroom Substrate of Hericium erinaceus Suppresses Bacterial Wilt Disease of Tomato

    Science.gov (United States)

    Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop

    2015-01-01

    Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048

  5. El Descubrimiento del Origen Carencial del Bocio por Boussingault

    Directory of Open Access Journals (Sweden)

    J. Lavollay

    1987-04-01

    í hacerle notar que esta investigación caía realmente fuera de mi competencia, y que en el Ejército había médicos capaces de realizarla con éxito. Por toda respuesta, el general Urdaneta me hizo saber que los trabajos topográficos que entonces yo llevaba a cabo … serían suspendidos; que debería hacer un viaje de doscientas a trescientas leguas en las Cordilleras, vivir en las regiones bociosas, y que, terminada mi misión, debería entregarle un informe”.

    Conocemos este informe únicamente a través de un resumen publicado por su autor muchos años después. Se trata de un trabajo notable por el carácter profundamente científico del estudio realizado sobre el terreno por el sabio químico, por el estrecho análisis de las causas presuntas de la afección y, por fin, sobre todo, por su conclusión: Boussingault atribuye categóricamente la (Nota del profesor J. Ma. del Corral. enfermedad a la “privación de compuestos yodurados”...

  6. Protestas sociales por la salud en Colombia: la lucha por el derecho fundamental a la salud, 1994-2010

    Directory of Open Access Journals (Sweden)

    María Esperanza Echeverry-López

    2015-02-01

    Full Text Available Esta investigación documental reconstruye la contienda transgresiva en salud en Colombia durante la implantación de la reforma, entre 1994 y 2010, a partir del análisis de fuentes primarias y secundarias. Utiliza el enfoque de la contienda política, una teoría de la acción colectiva, basada en una perspectiva relacional entre actores colectivos y estructura política, para comprender transformaciones históricas. Se reconstruyen tres episodios de contienda, evidenciando un vínculo causal entre protesta y reformas estructurales de política social y de salud. Las luchas de los actores subalternos visibilizaron el despojo de derechos laborales, la crisis de los hospitales públicos y las barreras de acceso a los servicios, como efectos adversos de la reforma; el gobierno favoreció los intereses del capital privado. Las protestas persistieron, pese a la violencia antisindical y a la represión gubernamental, nuevos actores y un movimiento nacional por la salud reconfiguraron la esfera pública, construyendo identidad en torno a la lucha por el derecho fundamental a la salud.

  7. Consumo de medicamentos por idosos, Goiânia, Brasil

    Directory of Open Access Journals (Sweden)

    Thalyta Renata Araújo Santos

    2013-02-01

    Full Text Available OBJETIVO: Analisar o padrão de consumo de medicamentos entre idosos e sua associação com aspectos socioeconômicos e autopercepção de saúde. MÉTODOS: Estudo de base populacional e delineamento transversal com 934 idosos de Goiânia, GO, Brasil, entre dezembro de 2009 e abril de 2010. Os dados foram coletados por meio de questionário. As variáveis estudadas foram: número de medicamentos consumidos, sexo, estado civil, escolaridade, tipo de moradia, idade, renda e autopercepção de saúde. Os medicamentos foram classificados segundo o Anatomical Therapeutic and Chemical Classification. Os medicamentos impróprios para idosos foram identificados segundo o Critério de Beers-Fick. Os testes utilizados foram Qui-quadrado (X² e exato de Fisher e p foi considerado significativo quando < 0,05. RESULTADOS: Os idosos consumiam 2.846 medicamentos (3,63 medicamentos/idoso. Os mais usuais atuavam no aparelho cardiovascular (38,6%. A prevalência de polifarmácia foi de 26,4% e da automedicação de 35,7%. Os medicamentos mais ingeridos por automedicação foram os analgésicos (30,8%; 24,6% dos idosos consumia medicamento considerado impróprio. Mulheres, viúvos, idosos com 80 anos ou mais e com pior autopercepção de saúde praticavam mais a polifarmácia. A maior prática da automedicação esteve associada com menor escolaridade e pior autopercepção de saúde. CONCLUSÕES: O padrão do consumo de medicamentos por idosos foi semelhante ao encontrado em idosos de outras regiões do Brasil. O número de medicamentos usados, a prevalência das práticas da polifarmácia e automedicação e consumo de medicamentos impróprios estiveram dentro da média nacional.

  8. Manejo hospitalario de la meningoencefalitis bacteriana por S. Neumoniae

    Directory of Open Access Journals (Sweden)

    Roberto Álvarez Fumero

    2003-12-01

    Full Text Available La actitud terapéutica ante la meningitis bacteriana (MEB es uno de los retos más importantes a los que se enfrenta el pediatra, pues de su oportuno y adecuado manejo depende el pronóstico. Los cambios en la epidemiología de los síndromes neurológicos infecciosos bacterianos observados en Cuba a partir del año 2000, promovieron la implementación de modificaciones al régimen terapéutico antibiótico convencional. En este artículo, sin olvidar que el tratamiento ideal es el preventivo, se expone una revisión actualizada del manejo hospitalario de las MEB por S.pneumoniae, que incluye: adopción de medidas generales, instauración temprana de acciones dirigidas a atenuar los efectos perjudiciales de la respuesta inflamatoria sistémica, conducta específica contra el agente (antibioticoterapia y finalmente la identificación precoz e inicio de la rehabilitación de secuelas. Se hace énfasis en las modificaciones al esquema antibiótico adoptadas recientemente por la Comisión Nacional de SNI. Se exponen consideraciones sobre la introducción de la vancomicina en esquema antimicrobiano de las MEB por S.pneumoniae.The therapeutic attitude to face bacterial meningitis (BME is one of the most important challenges for pediatricians, since the prognosis depends on its timely and adequate management The changes in the epidemiology of the bacterial infectious neurological syndromes ocurred in Cuba from 2000 on, promoted the implementation of modifications in the conventional therapeutical antibiotic regimen. In this article, without forgetting that the ideal treatment is the preventive one, it is exposed an updated review of the hospital management of BME due to S.Pneumoniae that includes: adoption of general measures, early establishment of actions directed to alleviate the harmful effects of the systemic inflammatory reponse, specific conduct against the agent (antibiotic therapy and, finally, the identification and beginning of the

  9. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  10. Efeito da solarização e biofumigação, durante o outono, na incidência de murcha-bacteriana e produtividade da batata Effect of soil solarization and biofumigation during autumn on bacterial wilt incidence and potato yield

    Directory of Open Access Journals (Sweden)

    Mírian Josefina Baptista

    2006-03-01

    Full Text Available A murcha-bacteriana causada por Ralstonia solanacearum é uma das principais doenças da cultura da batata. A solarização tem sido estudada como opção para a desinfestação do solo e tem potencial para o controle da murcha bacteriana. A técnica é indicada para uso nas estações quentes do ano pois depende de condições climáticas adequadas. Devido ao período de plantio de determinadas culturas, é interessante avaliar o uso da solarização em outras épocas do ano e associada a outras técnicas para garantir sua eficiência. A biofumigação é a desinfestação do solo através da adição de matéria orgânica que, durante sua decomposição, libera substâncias tóxicas aos fitopatógenos. Neste trabalho avaliou-se durante o outono (maio a junho os efeitos da adição de cama de aves (biofumigação e da solarização na incidência natural da murcha-bacteriana e na produtividade da batata, através dos tratamentos: adição de cama de aves (20 t/ha, uréia (100 kg/ha, aplicação de brometo de metila e solo sem tratamento (testemunha, todos solarizados ou não solarizados. Avaliou-se a produção de tubérculos totais e comerciais e, a partir da incidência de murcha-bacteriana, foi feito o cálculo da área abaixo da curva de progresso da doença (AACPD. Na área infestada, apenas o uso do brometo de metila proporcionou reduções significativas na incidência da murcha-bacteriana. No entanto, a aplicação de brometo de metila e a adição de cama de aves em associação com a solarização possibilitaram produção significativamente maior de tubérculos de batata em relação à testemunha. Os efeitos da solarização associada à biofumigação com cama de aves sobre a produtividade da batata em área infestada com R. solanacearum devem ser melhor investigados.Bacterial wilt caused by Ralstonia solanacearum is one of the most important diseases of the potato. Soil solarization has been studied as an option for soilborne

  11. Iconografía por Resonancia Magnética

    Directory of Open Access Journals (Sweden)

    Jaime Gómez Gonzalez

    1987-04-01

    Full Text Available

    Iconografía, del griego “eikon” imagen y “graphein” dibujar, es la ciencia de las imágenes. La reproducción de imágenes del cuerpo humano puede hacerse por muchos medios, el más reciente, la Resonancia Magnética. Se trata de un procedimiento bien conocido por los químicos desde hace casi cuatro decenios y que se emplea para el análisis espectrográfico de cualquier substancia.

    Hace menos de diez años Raymond Damadian pudo utilizar este sistema para producir imágenes de cortes tomográficos del cuerpo humano en cualquier plano, sin utilizar radiaciones ionizantes. El perfeccionamiento del equipo ha llegado en los últimos tres años a producir imágenes con detalles anatómicos de gran perfección. Existe la posibilidad de hacer análisis espectrográfico en vivo, pero este procedimiento se encuentra aún en investigación.

    Para evaluar el sistema, el autor ha visitado varias fábricas en Europa y Estados Unidos, un número importante de laboratorios de centros hospitalarios en Nueva York, Houston, La Florida, y contribuyó a organizar en la Fundación Instituto Neurológico de Colombia, en colaboración con el Centro Internacional de Física, el I Seminario Internacional sobre Iconografía por Resonancia Magnética en abril de 1986, con participación de conferenciantes de Alemania, Bélgica, Dinamarca y los Estados Unidos.

    Se han compilado los informes de unos quince fabricantes, cuatro de ellos con representación en Colombia; se solicitaron cotizaciones, se realizaron estudios económicos y se consultó con arquitectos para adecuar el sitio donde se podría instalar el equipo en la Fundación Instituto Neuro lógico de Colombia, como un servicio más a la comunidad. En este momento se programa para 1987, el 11Seminario Internacional de Iconografía por Resonancia Magnética.

    El principio utilizado para obtener estas imágenes se basa en conceptos físicos muy complejos; sin embargo, se pueden

  12. La batalla global por el alma del capitalismo

    Directory of Open Access Journals (Sweden)

    Luis Esteban G. Manrique

    2012-07-01

    Full Text Available El gigante informático norteamericano Apple vale hoy en bolsa unos 350.000 millones de dólares, 20.000 millones más que la segunda compañía del país, ExxonMobil, y también más que los 32 mayores bancos de la zona euro juntos. Sin embargo, Apple apenas tiene 47.000 empleados en todo el mundo, 30.000 de los cuales trabajan en EE.UU., pero ninguno de ellos en plantas de ensamblaje. Todos sus famosos productos -los iMac, iPod, iPad, iPhone- son fabricados en China por la contratista taiwanesa Foxconn, para la que trabajan casi un millón de personas, 250.000 de ellas dedicadas en exclusiva a los artilugios electrónicos de la compañía de la manzana.

  13. Ulcera cutanea provocada por hongos del genero Fusarium

    Directory of Open Access Journals (Sweden)

    Negroni Ricardo

    1997-01-01

    Full Text Available Se presenta el caso de un paciente oriundo y procedente del Paraguay, de 40 años de edad, portador de una ulceración crónica en cara externa del pie izquierdo, de 2 meses de evolución, debida a una hialohifomicosis por Fusarium oxysporum. Se destacan las características clínicas, métodos de diagnóstico y terapeútica de esta micosis, además de las diferentes etiologías a considerar en el diagnóstico diferencial de una úlcera en personas procedentes del área tropical o subtropical.

  14. El Defensor del Público: una figura por descubrir

    Directory of Open Access Journals (Sweden)

    César Mauricio Velásquez Ossa

    2002-01-01

    Full Text Available En la coyuntura actual de los medios de comunicación, caracterizada por intereses individuales, económicos y un alto cúmulo de contenido informativo, se hace necesario el establecimiento de un canal de comunicación con el público. El Defensor del Público surge, entonces, como un mediador entre la empresa informativa y la sociedad, que genera entre ellos procesos de comunicación e impulsa a la primera hacia la constante búsqueda de la verdad, el ejercicio de la responsabilidad social en el manejo ético de la información y la generación de opinión pública responsable y libre.

  15. Eliminación del plomo por curado casero

    Directory of Open Access Journals (Sweden)

    Torres-Sánchez Luisa

    1999-01-01

    Full Text Available Objetivo. Evaluar el curado ácido como medida preventiva para reducir el contenido de plomo en vasijas de barro vidriadas. Material y métodos. En 27 vasijas de barro procedentes de cuatro estados de México se determinó, mediante espectrofotometría de absorción atómica, el nivel de plomo residual, después de cuatro lavados con ácido acético al 3%. Resultados. El contenido de plomo en el ácido acético utilizado para lavar las vasijas disminuyó proporcionalmente con el número de lavados, aunque se conservó por arriba de los niveles permisibles (2.5-7.0 p.p.m.. Conclusiones. El curado ácido de piezas de barro no es una medida preventiva útil para reducir la exposición a plomo.

  16. Resposta à Pergunta: Por que Devemos Agir Moralmente?

    Directory of Open Access Journals (Sweden)

    Luiz Paulo Rouanet

    2011-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2011v10n1p97 A questão que se coloca diz respeito ao tema do contratualismo moral. Envolve uma tentativa de resposta à questão sobre os motivos, ou as razões, para uma conduta moral por parte de agentes numa sociedade pós-secular. Numa sociedade que não se pauta quer pela religião como pressuposto comum, quer pelo ideal moderno de uma sociedade secular, a questão sobre os motivos de nossa ação moral adquire novos contornos. Essa resposta tomará como ponto de partida, neste texto, a filosofia moral e política kantiana.

  17. DIOSCÓRIDES RESCATADO POR LOS ÁRABES

    Directory of Open Access Journals (Sweden)

    Ricardo H Elía

    2009-01-01

    Full Text Available La historia oficial afirma que Occidente heredó directamente el legado cultural de Grecia y Roma. Pero si la mayoría de los manuscritos griegos y latinos fueron destruidos a partir del saqueo de la Biblioteca de Alejandría en 391, los archivos de Roma fueron devastados en sendas ocasiones entre 410 y 476 por visigodos y hérulos, y los escasos vestigios clásicos que quedaban en Atenas fueron arrasados por Justiniano I en 529, ¿cuál fue la conexión que logró transmitir esa literatura y pudo ser aprovechada en un período anterior al renacimiento? La salvación de las piezas literarias se realizó durante ochocientos afios de activa y responsable tarea de recopilación por parte de los árabes durante la línea de tiempo que oscila entre 650-1450 en la que fueron rescatados, traducidos y retransmitidos hacia los cuatro puntos cardinales. Los científicos árabes, al igual que Arquímedes o Herón, nunca se separaron del saber empírico, por el contrario, lo profundizaron. El movimiento científico árabe no sólo interpretó el saber de los antiguos sino desarrolló una nueva ciencia donde la razón sustentaba a la fe y viceversa. Esta fue la base esencial que permitió construir el Renacimiento y la Ilustración, que a su vez posibilitaron la Modernidad. En este contexto, fue de capital importancia la traducción al árabe de la obra de Dioscórides ya que no sólo fue de gran utilidad para la farmacología y medicina en el mundo musulmán sino que a través de éste las recetas del médico griego de Nerón reingresaron a la Europa latina donde fueron recibidas como una panacea.Official history affirms that the West directly inherited the cultural legacy of Greece and Rome. But if most of the Greek and latin manuscripts they were destroyed at the sacking of the Library of Alexandria in 391, the archives of Rome were devastated in several occasions between 410 and 476 by Visigoth and heruls, and the little classic vestiges that were in

  18. Imunidade conferida por vacinas anti-meningocócicas

    Directory of Open Access Journals (Sweden)

    Milagres Lucimar Gonçalves

    1993-01-01

    Full Text Available Em razão da recente epidemia de doença meningocócica causada por N. meningitidis B na Grande São Paulo, Brasil, foi feita revisão das epidemias dessa doença ocorridas no Brasil desde o início do século e uma análise das vacinas atuais contra N. meningitidis A, C, Y e W135. Também são discutidos os mais recentes avanços no desenvolvimento e aplicação de vacina contra M meningitidis B, um desafio constante para os maiores centros de pesquisa de todo o mundo.

  19. ¿POR QUÉ DEFENDER LA CIENCIA EN COLOMBIA?

    OpenAIRE

    Enrique Forero González

    2016-01-01

    Un grupo de nuestros más destacados científicos le cuenta a la sociedad colombiana por qué es necesario defender la ciencia en el país, demuestra con lujo de detalles porqué este tema se considera importante y se refiere a la forma como los países más avanzados del mundo han alcanzado esos niveles de desarrollo gracias a sus inversiones en educación, ciencia y tecnología. También, llama la atención sobre el hecho que la clase política tiene el deber ético de hacer políticas sobre cie...

  20. Compton imaging with the PorGamRays spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Judson, D.S., E-mail: dsj@ns.ph.liv.ac.uk [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Boston, A.J. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Coleman-Smith, P.J. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Cullen, D.M. [Schuster Laboratory, University of Manchester, Manchester M13 9PL (United Kingdom); Hardie, A. [STFC Rutherford Appleton Laboratory, Harwell Science and Innovation Campus, Didcot OX11 0QX (United Kingdom); Harkness, L.J. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Jones, L.L. [STFC Rutherford Appleton Laboratory, Harwell Science and Innovation Campus, Didcot OX11 0QX (United Kingdom); Jones, M. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Lazarus, I. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Nolan, P.J. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Pucknell, V. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Rigby, S.V. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Seller, P. [STFC Rutherford Appleton Laboratory, Harwell Science and Innovation Campus, Didcot OX11 0QX (United Kingdom); Scraggs, D.P. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom); Simpson, J. [STFC Daresbury Laboratory, Daresbury, Warrington WA4 4AD (United Kingdom); Slee, M.; Sweeney, A. [Department of Physics, University of Liverpool, Liverpool L697ZE (United Kingdom)

    2011-10-01

    The PorGamRays project aims to develop a portable gamma-ray detection system with both spectroscopic and imaging capabilities. The system is designed around a stack of thin Cadmium Zinc Telluride (CZT) detectors. The imaging capability utilises the Compton camera principle. Each detector is segmented into 100 pixels which are read out through custom designed Application Specific Integrated Circuits (ASICs). This device has potential applications in the security, decommissioning and medical fields. This work focuses on the near-field imaging performance of a lab-based demonstrator consisting of two pixelated CZT detectors, each of which is bonded to a NUCAM II ASIC. Measurements have been made with point {sup 133}Ba and {sup 57}Co sources located {approx}35mm from the surface of the scattering detector. Position resolution of {approx}20mm FWHM in the x and y planes is demonstrated.