Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Ralstonia solanacearum 名詞 一般 * * * * Ralstonia sol...anacearum ... MeSH D043368 200906091329391991 C LS07 UNKNOWN_2 Ralstonia solanacearum
Directory of Open Access Journals (Sweden)
José Magno Martins Bringel
2001-09-01
Full Text Available A murcha bacteriana causada por Ralstonia solanacearum é considerada a principal doença de origem bacteriana no mundo. Centenas de espécies de plantas pertencentes a mais de 50 famílias botânicas têm sido relatadas como hospedeiras. Foi avaliada, em condições de casa de vegetação, a colonização radicular de alface, arroz, cebolinha, ervilha, pepino e soja, por seis isolados de Ralstonia solanacearum (Rs, biovares 1, 2 e 3. Estirpes dos isolados de Rs com resistência múltipla aos antibióticos estreptomicina, rifampicina e cloranfenicol foram utilizadas. A colonização foi avaliada 45 dias após a inoculação, através do plaqueamento de suspensão de trituração em meio de cultura semi-seletivo. A ervilha comportou-se como hospedeira de todos os isolados mas, apenas um isolado da biovar 3 foi patogênico a esta espécie. A soja apresentou populações elevadas de quatro isolados distribuídos entre as três biovares e o pepino, de apenas dois isolados das biovares 1 e 3. Exceto para o isolado que foi patogênico à ervilha, as plantas não apresentaram sintomas da doença, comportando-se como hospedeiras não suscetível. O arroz apresentou populações muito baixas de todos os isolados. Alface e cebolinha não hospedaram nenhum dos isolados inoculados. Os resultados mostram a capacidade de Rs colonizar e sobreviver em diferentes espécies de plantas como rizobactérias.Bacterial wilt caused by Ralstonia solanacearum is considered the main plant disease of bacterial origin in the world, where hundreds of plant species in more than 50 botanical families are host plants. Root colonization of lettuce (Lactuca sativa, rice (Oryza sativa, spring onion (Allium fistulosum, pea (Pisum sativum, cucumber (Cucumis sativus, and soybean (Glycine max by six isolates of Ralstonia solanacearum (Rs biovars 1, 2 and 3 was evaluated under greenhouse conditions. Bacterial strains resistant to streptomycin, rifampicin and chloranfenicol were used
Directory of Open Access Journals (Sweden)
Carlos Alberto Tuão Gava
2002-10-01
Full Text Available Em condições tropicais, a murcha-bacteriana, causada por Ralstonia solanacearum, tem provocado danos severos à cultura do tomate (Lycopersicon esculentum Mill., principalmente em condições de temperaturas acima de 25°C, com umidade relativa elevada. Neste contexto, o controle biológico pode representar uma alternativa viável. Este trabalho teve como objetivo selecionar isolados de estreptomicetos para o controle de R. solanacearum em tomateiro. Entre os isolados avaliados verificaram-se diferenças na inibição do patógeno in vitro, tanto em relação à faixa de pH avaliada, quanto ao tempo de observação. Constataram-se, também, variações no estabelecimento dos isolados de estreptomicetos na rizosfera das plântulas e nas mudas preparadas para transplante, e os isolados SP164, SF232, SAc326 e SG384 apresentaram as densidades populacionais mais elevadas. O experimento conduzido em canteiros com solo infestado com R. solanacearum mostrou que as plantas tratadas com o isolado SG384 apresentaram melhor nível de controle, 48 dias após a semeadura, período no qual todas as testemunhas haviam morrido.The bacterial wilt caused by Ralstonia solanacearum causes high damages in tomato (Lycopersicon esculentum Mill. culture, mainly under temperature above 25ºC and high relative humidity. Because conventional methods of control have shown low efficiency, biological control is a promising alternative. This work aimed to select isolates of streptomycetes for R. solanacearum control in tomato. Differences were found among the isolates in the in vitro inhibition of the pathogen either in time or pH range. The streptomycetes isolates grew differently in the rhizosphere of seedlings and plantlets of tomato. The isolates SP164, SF232, SAc326 and SG384 showed the highest population densities. In the experiment conducted in soil infested with R. solanacearum, plants treated with the isolate SG384 presented best control level 48 days after sowing
Ralstonia solanacearum biovar 1 associated with a new outbreak of potato brown rot in Portugal
Directory of Open Access Journals (Sweden)
Leonor Cruz
2008-10-01
Full Text Available In May 2007, potato plants exhibiting symptoms possibly of brown rot were collected in some potato fields in the Baixo Mondego region (Center, Portugal, as a part of a nationwide programme to monitor Ralstonia solanacearum. All laboratory procedures laid down in Commission Directive 2006/63/EC, including dilution plating on semi-selective medium SMSA, indirect imunofluorescence (IIF, polymerase chain reaction (PCR using specific primers and bioassays on tomato plants, were strictly followed and the causal agent of the disease was identified as Ralstonia solanacearum. The identity of the pure cultures of the isolated organism was confirmed by PCR, IIF and pathogenicity tests on several other plant species (eggplant, tobacco, pelargonium and eucalyptus. In biovar determination, the failure of the isolates to utilise/oxidise certain carbon sources indicated that the isolates were all biovar 1. This biovar has a broader host range than biovar 2 strains, and affects several crops of economic importance including ornamental plants and forest trees. Comparative analysis of 16S rRNA and endoglucanase (egl gene sequences of these isolates with sequences that have been deposited at the GenBank revealed a similarity higher than 99% for several Ralstonia solanacearum isolates from biovar 1, including isolate DAR 64836 (Accession number DQ011551. This is the first report of Ralstonia solanacearum biovar 1 in Portugal. All control measures specified in the Commission Directive are being implemented.
Minh Tran, Tuan; MacIntyre, April; Khokhani, Devanshi; Hawes, Martha; Allen, Caitilyn
2016-11-01
Ralstonia solanacearum is a soil-borne vascular pathogen that colonizes plant xylem vessels, a flowing, low-nutrient habitat where biofilms could be adaptive. Ralstonia solanacearum forms biofilm in vitro, but it was not known if the pathogen benefits from biofilms during infection. Scanning electron microscopy revealed that during tomato infection, R. solanacearum forms biofilm-like masses in xylem vessels. These aggregates contain bacteria embedded in a matrix including chromatin-like fibres commonly observed in other bacterial biofilms. Chemical and enzymatic assays demonstrated that the bacterium releases extracellular DNA in culture and that DNA is an integral component of the biofilm matrix. An R. solanacearum mutant lacking the pathogen's two extracellular nucleases (exDNases) formed non-spreading colonies and abnormally thick biofilms in vitro. The biofilms formed by the exDNase mutant in planta contained more and thicker fibres. This mutant was also reduced in virulence on tomato plants and did not spread in tomato stems as well as the wild-type strain, suggesting that these exDNases facilitate biofilm maturation and bacterial dispersal. To our knowledge, this is the first demonstration that R. solanacearum forms biofilms in plant xylem vessels, and the first documentation that plant pathogens use DNases to modulate their biofilm structure for systemic spread and virulence. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
Lin, Yu-Mei; Chou, I-Chun; Wang, Jaw-Fen; Ho, Fang-I; Chu, Yu-Ju; Huang, Pei-Cheng; Lu, Der-Kang; Shen, Hwei-Ling; Elbaz, Mounira; Huang, Shu-Mei; Cheng, Chiu-Ping
2008-09-01
Ralstonia solanacearum causes a deadly wilting disease on a wide range of crops. To elucidate pathogenesis of this bacterium in different host plants, we set out to identify R. solanacearum genes involved in pathogenesis by screening random transposon insertion mutants of a highly virulent strain, Pss190, on tomato and Arabidopsis thaliana. Mutants exhibiting various decreased virulence levels on these two hosts were identified. Sequence analysis showed that most, but not all, of the identified pathogenesis genes are conserved among distinct R. solanacearum strains. A few of the disrupted loci were not reported previously as being involved in R. solanacearum pathogenesis. Notably, a group of mutants exhibited differential pathogenesis on tomato and Arabidopsis. These results were confirmed by characterizing allelic mutants in one other R. solanacearum strain of the same phylotype. The significantly decreased mutants' colonization in Arabidopsis was found to be correlated with differential pathogenesis on these two plants. Differential requirement of virulence genes suggests adaptation of this bacterium in different host environments. Together, this study reveals commonalities and differences of R. solanacearum pathogenesis on single solanaceous and nonsolanaceous hosts, and provides important new insights into interactions between R. solanacearum and different host plants.
Evaluation of Resistance to Ralstonia solanacearum in Tomato Genetic Resources at Seedling Stage
Directory of Open Access Journals (Sweden)
Sang Gyu Kim
2016-02-01
Full Text Available Bacterial wilt of tomatoes caused by Ralstonia solanacearum is a devastating disease that limits the production of tomato in Korea. The best way to control this disease is using genetically resistant tomato plant. The resistance degree to R. solanacearum was evaluated for 285 tomato accessions conserved in the National Agrobiodiversity Center of Rural Development Administration. These accessions of tomato were originated from 23 countries. Disease severity of tomato accessions was investigated from 7 days to 14 days at an interval of 7 days after inoculation of R. solanacearum under greenhouse conditions. A total of 279 accessions of tomato germplasm were susceptible to R. solanacearum, resulting in wilt and death in 70 to 90% of these plants. Two tomato accessions were moderately resistant to R. solanacearum. Only four accessions showed high resistance against R. solanacearum. No distinct symptom of bacterial wilt appeared on the resistant tomato germplasms for up to 14 days after inoculation of R. solanacearum. Microscopy of resistant tomato stems infected with R. solanacearum revealed limited bacterial spread with thickening of pit membrane and gum production. Therefore, these four resistant tomato germplasms could be used in tomato breeding program against bacterial wilt.
Elsas, van J.D.; Kastelein, P.; Vries, de P.M.; Overbeek, van L.S.
2001-01-01
The fate of Ralstonia solanacearum bv. 2, the causative agent of brown rot in potato, in aquatic habitats of temperate climate regions is still poorly understood. In this study, the population dynamics and the physiological response of R. solanacearum bv. 2 were tested in sterile pure water and in
Directory of Open Access Journals (Sweden)
Andréia Iraci Tumelero
2008-02-01
Full Text Available A sobrevivência de Pectobacterium atrosepticum e de Ralstonia solanacearum foi avaliada em veículo à base de goma xantana (GX, um polímero biológico, e de goma xantana acrescida de polivinilpirrolidona (PVP, um polímero sintético. As culturas, após crescimento até 10(11 ufc mL-1 foram injetadas junto a essas formulações e a sobrevivência avaliada em diferentes condições de armazenamento: em temperatura ambiente, em refrigerador (4ºC e em freezer (-20ºC, por 36 meses. A concentração de células viáveis foi realizada através de diluições seriadas. A patogenicidade foi avaliada em plantas hospedeiras e em iscas. Os resultados permitem observar que a concentração de células viáveis decresceu ao longo do tempo, mantendo-se entre 10³ e 10(4 ufc mL-1 ao final de três anos, exceto para a formulação à base de GX e armazenamento à -20°C, que se mostrou ineficiente para ambas as bactérias. Conclui-se, que os polímeros avaliados mostraram-se eficientes em preservar e manter as características bioquímicas e fisiológicas das bactérias Pectobacterium atrosepticum e de Ralstonia solanacearum.The survival of Pectobacterium atrosepticum and Ralstonia solanacearum was evaluated in biopolymer carrier xanthan gum (GX and xanthan gum together with polymer synthetic polyvinylpyrrolidone (PVP. The cultures after growing up to 10(11 ufc mL-1 were injected into the plolymers carriers. The survival of the bacteria was evaluated at room temperature, refrigerator (4ºC and freezer (-20ºC for 36 months. The evaluation of viability of the preserved bacteria was carried through seriate dilutions using drop method. The pathogenicity was observed in plant hosts and through baits. The results allow observing that the concentration of viable cells decreased along the time mainting to 10³ and 10(4 ufc mL-1 for three years with exception, of the formulation to the base of GX and storage the -20°C, that was inefficient for preservation of
Directory of Open Access Journals (Sweden)
Lin Cai
2018-04-01
Full Text Available Magnesium (Mg is an essential mineral element for plants and is nontoxic to organisms. In this study, we took advantage of nanotechnologies to systematically investigate the antibacterial mechanisms of magnesium oxide nanoparticles (MgONPs against the phytopathogen Ralstonia solanacearum (R. solanacearum in vitro and in vivo for the first time. R. solanacearum has contributed to catastrophic bacterial wilt, which has resulted in the world-wide reduction of tobacco production. The results demonstrated that MgONPs possessed statistically significant concentration-dependent antibacterial activity, and the minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC were measured as 200 and 250 μg/mL, respectively. Additional studies, aimed at understanding the toxicity mechanism of MgONPs, indicated that physical injury occurred to the cell membranes, along with decreased motility and biofilm formation ability of R. solanacearum, due to the direct attachment of MgONPs to the surfaces of the bacterial cells, which was observed by scanning electron microscopy (SEM and transmission electron microscopy (TEM. Reactive oxygen species (ROS accumulation could also be an important reason for the antibacterial action, inducing DNA damage. The toxicity assessment assay under greenhouse conditions demonstrated that the MgONPs had exerted a large effect on tobacco bacterial wilt, reducing the bacterial wilt index. Altogether, the results suggest that the development of MgONPs as alternative antibacterial agents will become a new research subject.
Lowe-Power, Tiffany M.; Hendrich, Connor G.; Roepenack-Lahaye, von Edda; Li, Bin; Wu, Dousheng; Mitra, Raka; Dalsing, Beth L.; Ricca, Patrizia; Naidoo, Jacinth; Cook, David; Jancewicz, Amy; Masson, Patrick; Thomma, Bart; Lahaye, Thomas; Michael, Anthony J.; Allen, Caitilyn
2018-01-01
Ralstonia solanacearum thrives in plant xylem vessels and causes bacterial wilt disease despite the low nutrient content of xylem sap. We found that R. solanacearum manipulates its host to increase nutrients in tomato xylem sap, enabling it to grow better in sap from infected plants than in sap from
Palmarosa (Cymbopogon martini), lemongrass (C. citratus) and eucalyptus (Eucalyptus globulus) oils were investigated for their effects on Ralstonia solanacearum race 4, and their potential use as bio-fumigants for treating pathogen- infested edible ginger (Zingiber officinale R.) fields. Three conce...
Directory of Open Access Journals (Sweden)
Young Kee Lee
2013-12-01
Full Text Available Totally sixty three bacteria were isolated from lower stems showing symptoms of bacterial wilt on pepper plants in 14 counties of 7 provinces, Korea. The isolates showed strong pathogenicity on red pepper (cv. Daewang and tomato (cv. Seogwang seedlings. All virulent bacteria were identified as Ralstonia solanacearum based on colony types, physiological and biochemical tests and polymerase chain reaction (PCR. All R. solanacearum isolates from peppers were race 1. The bacterial isolates consisted of biovar 3 (27% and biovar 4 (73%. Based on polymorphic PCR bands generated by repetitive sequence (rep-PCR, the 63 R. solanacearum isolates were divided into 12 groups at 70% similarity level. These results will be used as basic materials for resistant breeding program and efficient control against bacterial wilt disease of pepper.
Directory of Open Access Journals (Sweden)
Napoleon N. A. Tjou-Tam-Sin
2017-11-01
Full Text Available Ralstonia pseudosolanacearum (Ralstonia solanacearum phylotype I isolates found in stunted, yellowing, and wilted ornamental rose (Rosa spp. were assessed for their pathogenic ability in two rose cultivars (cv. “Armando” and cv. “Red Naomi” and in four solanaceous crops: tomato (Solanum lycopersicum cv. “Money Maker”, tobacco (Nicotiana tabacum cv. “White Burley”, eggplant (Solanum melongena cv. “Black Beauty” and sweet pepper (Capsicum annum cv. “Yolo Wonder”. Significant differences were observed in susceptibility between the two rose cultivars as well as between the two modes of inoculation performed. The cultivar “Armando” was significantly more susceptible than cultivar “Red Naomi,” exhibiting higher disease severity and incidence. Similarly, stem inoculation after wounding was found to be significantly more effective than soil drenching, resulting in higher disease severity. Additionally, a temperature dependency in susceptibility was observed for both cultivars irrespective of the mode of inoculation, however, this was significantly more pronounced upon soil drenching. The solanaceous crops all showed to be susceptible to the R. pseudosolanacearum isolates originated from the Rosa spp. plants. Furthermore, both rose cultivars were able to harbor symptomless infections with other R. pseudosolanacearum and R. solanacearum isolates than those isolated from rose. Our results clearly demonstrated that latent infections in a rose cultivar such as cv. “Red Naomi” do occur even at temperatures as low as 20°C. This latency poses high risks for the entire floricultural industry as latently infected Rosa spp. plants are propagated and distributed over various continents, including areas where climatic conditions are optimal for the pathogen.
Directory of Open Access Journals (Sweden)
Popović Tatjana
2016-01-01
Full Text Available Brown rot or bacterial wilt caused by bacterium Ralstonia solanacearum is the main limiting factor in potato production. Quarantine measures are necessary to avoid spread of disease to disease-free areas. R. solanacearum has been shown to contaminate watercourses from which crop irrigation is then prohibited causing further potential losses in yield and quality. The bacteria also spread via surfaces that diseased seed potatoes come into contact with. This study showed bactericidal activity of chlorine dioxide (CIO2 on R. solanacearum for disinfection of water, surface and equipment. The results showed that CIO2 solution at concentration of 2 ppm at 30 minutes of exposure time had bactericidal effect for disinfection of water. For surface and equipment disinfection, concentration of 50 ppm showed total efficacy at 30 min and 5 sec exposure time, respectively. Results suggest that use of CIO2 as a disinfectant has a potential for control of brown rot pathogen in water, storage and equipment.
The phytopathogen Ralstonia solanacearum is a species complex that contains a subset of strains that are quarantined or select agent pathogens. An unidentified R. solanacearum strain is considered a select agent in the US until proven otherwise, which can be done by phylogenetic analysis of a partia...
Messiha, N.A.S.
2006-01-01
Potato brown rot, caused by Ralstonia solanacearum race 3 biovar 2 (Phylovar II, sequevar 1), is a serious endemic disease in the Nile Delta of Egypt. It is a quarantine disease in the EU, and export of potatoes from
Detecção de Ralstonia solanacearum em tubérculos de batata através de PCR qualitativa e quantitativa
Adriana de Andrade Figueiró
2008-01-01
Ralstonia solanacearum é uma bactéria transmitida por tubérculos-semente. As biovares 1 (raça 1) e 2 (raça 3) estão associadas à batata (Solanum tuberosum) e apresentam características epidemiológicas diferentes. A certificação de tubérculos-semente constitui-se num processo essencial para o manejo da murcha bacteriana, mas depende de métodos específicos e sensíveis de detecção deste patógeno. Este trabalho objetivou (i) projetar oligonucleotídeos iniciadores para diferenciação das biovares d...
Genetic mapping of a major dominant gene for resistance to Ralstonia solanacearum in eggplant
Lebeau, A.; Gouy, M.; Daunay, Marie Christine; Wicker, E.; Chiroleu, F.; Prior, P.; Frary, Anne; Dintinger, J.
2013-01-01
Resistance of eggplant against Ralstonia solanacearum phylotype I strains was assessed in a F6 population of recombinant inbred lines (RILs) derived from a intra-specific cross between S. melongena MM738 (susceptible) and AG91-25 (resistant). Resistance traits were determined as disease score, percentage of wilted plants, and stem-based bacterial colonization index, as assessed in greenhouse experiments conducted in Réunion Island, France. The AG91-25 resistance was highly efficient toward st...
Directory of Open Access Journals (Sweden)
Edisson Chavarro Mesa
2006-01-01
Full Text Available A polymerase chain reaction-based diagnostic test (PCR has been developed for amplifying a región and obtaining a 292 bp product by using specific 16S rDNA primers for the rapid and precise identification of the causative agent (Ralstonia solanacearum of bacterial withering of potato in asymptomatic tubers. The bacteria was isolated from potato tubers and banana fruit using culturing techniques and immunological and molecular ELISA-NCM and PCR tests, respectively. PCR detected the presence of R. solanacearum on asymptomatic tubers by contrast with ELISA-NCM which did not detect this pathogen. Analysing random amplified polymorphic DNA (RAPD led to differentiating and grouping R. solanacearum by geographical región and bacterial strain, suggesting that differences exist amongst existing collections according to their place of origin, presenting high genetic variability. The results showed that PCR is a sensitive and specific test for detecting R. solanacearum and can therefore be implemented as a method for controlling this pathogen in seed production and certification programmes in áreas free of the disease. The pathogen has been shown to be genetically heterogeneous according to the samples' geographical área thereby hampering control in áreas of Colombia experiencing phytosanitary problems with R. solanacearum in potato crops Key words: bacterial withered, moko, PCR-16S rADN, ELISA-NCM, PCR-RAPD.
Bernoux, M.; Timmers, T.; Jauneau, A.; Brière, C.; Wit, de P.J.G.M.; Marco, Y.; Deslandes, L.
2008-01-01
Bacterial wilt, a disease impacting cultivated crops worldwide, is caused by the pathogenic bacterium Ralstonia solanacearum. PopP2 (for Pseudomonas outer protein P2) is an R. solanacearum type III effector that belongs to the YopJ/AvrRxv protein family and interacts with the Arabidopsis thaliana
She, Xiaoman; Yu, Lin; Lan, Guobing; Tang, Yafei; He, Zifu
2017-01-01
Ralstonia solanacearum species complex is a devastating phytopathogen with an unusually wide host range, and new host plants are continuously being discovered. In June 2016, a new bacterial wilt on Cucurbita maxima was observed in Guangdong province, China. Initially, in the adult plant stage, several leaves of each plant withered suddenly and drooped; the plant then wilted completely, and the color of their vasculature changed to dark brown, ultimately causing the entire plant to die. Creamy-whitish bacterial masses were observed to ooze from crosscut stems of these diseased plants. To develop control strategies for C. maxima bacterial wilt, the causative pathogenic isolates were identified and characterized. Twenty-four bacterial isolates were obtained from diseased C. maxima plants, and 16S rRNA gene sequencing and pathogenicity analysis results indicated that the pathogen of C. maxima bacterial wilt was Ralstonia solanacearum . The results from DNA-based analysis, host range determination and bacteriological identification confirmed that the 24 isolates belonged to R. solanacearum phylotype I, race 1, and eight of these isolates belonged to biovar 3, while 16 belonged to biovar 4. Based on the results of partial egl gene sequence analysis, the 24 isolates clustered into three egl- sequence type groups, sequevars 17, 45, and 56. Sequevar 56 is a new sequevar which is described for the first time in this paper. An assessment of the resistance of 21 pumpkin cultivars revealed that C. moschata cv. Xiangyu1 is resistant to strain RS378, C. moschata cv. Xiangmi is moderately resistant to strain RS378, and 19 other pumpkin cultivars, including four C. maxima cultivars and 15 C. moschata cultivars, are susceptible to strain RS378. To the best of our knowledge, this is the first report of C. maxima bacterial wilt caused by R. solanacearum race 1 in the world. Our results provide valuable information for the further development of control strategies for C. maxima wilt
Directory of Open Access Journals (Sweden)
Xiaoman She
2017-10-01
Full Text Available Ralstonia solanacearum species complex is a devastating phytopathogen with an unusually wide host range, and new host plants are continuously being discovered. In June 2016, a new bacterial wilt on Cucurbita maxima was observed in Guangdong province, China. Initially, in the adult plant stage, several leaves of each plant withered suddenly and drooped; the plant then wilted completely, and the color of their vasculature changed to dark brown, ultimately causing the entire plant to die. Creamy-whitish bacterial masses were observed to ooze from crosscut stems of these diseased plants. To develop control strategies for C. maxima bacterial wilt, the causative pathogenic isolates were identified and characterized. Twenty-four bacterial isolates were obtained from diseased C. maxima plants, and 16S rRNA gene sequencing and pathogenicity analysis results indicated that the pathogen of C. maxima bacterial wilt was Ralstonia solanacearum. The results from DNA-based analysis, host range determination and bacteriological identification confirmed that the 24 isolates belonged to R. solanacearum phylotype I, race 1, and eight of these isolates belonged to biovar 3, while 16 belonged to biovar 4. Based on the results of partial egl gene sequence analysis, the 24 isolates clustered into three egl- sequence type groups, sequevars 17, 45, and 56. Sequevar 56 is a new sequevar which is described for the first time in this paper. An assessment of the resistance of 21 pumpkin cultivars revealed that C. moschata cv. Xiangyu1 is resistant to strain RS378, C. moschata cv. Xiangmi is moderately resistant to strain RS378, and 19 other pumpkin cultivars, including four C. maxima cultivars and 15 C. moschata cultivars, are susceptible to strain RS378. To the best of our knowledge, this is the first report of C. maxima bacterial wilt caused by R. solanacearum race 1 in the world. Our results provide valuable information for the further development of control strategies
Directory of Open Access Journals (Sweden)
Vandamme Peter
2003-03-01
Full Text Available Abstract Background Ralstonia solanacearum is an important plant pathogen. The genome of R. solananearum GMI1000 is organised into two replicons (a 3.7-Mb chromosome and a 2.1-Mb megaplasmid and this bipartite genome structure is characteristic for most R. solanacearum strains. To determine whether the megaplasmid was acquired via recent horizontal gene transfer or is part of an ancestral single chromosome, we compared the abundance, distribution and compositon of simple sequence repeats (SSRs between both replicons and also compared the respective compositional biases. Results Our data show that both replicons are very similar in respect to distribution and composition of SSRs and presence of compositional biases. Minor variations in SSR and compositional biases observed may be attributable to minor differences in gene expression and regulation of gene expression or can be attributed to the small sample numbers observed. Conclusions The observed similarities indicate that both replicons have shared a similar evolutionary history and thus suggest that the megaplasmid was not recently acquired from other organisms by lateral gene transfer but is a part of an ancestral R. solanacearum chromosome.
Filamentous phages of Ralstonia solanacearum: double-edged swords for pathogenic bacteria.
Yamada, Takashi
2013-01-01
Some phages from genus Inovirus use host or bacteriophage-encoded site-specific integrases or recombinases establish a prophage state. During integration or excision, a superinfective form can be produced. The three states (free, prophage, and superinfective) of such phages exert different effects on host bacterial phenotypes. In Ralstonia solanacearum, the causative agent of bacterial wilt disease of crops, the bacterial virulence can be positively or negatively affected by filamentous phages, depending on their state. The presence or absence of a repressor gene in the phage genome may be responsible for the host phenotypic differences (virulent or avirulent) caused by phage infection. This strategy of virulence control may be widespread among filamentous phages that infect pathogenic bacteria of plants.
Directory of Open Access Journals (Sweden)
Germán Ceballos
2014-01-01
Full Text Available El moko, enfermedad causada por Ralstonia solanacearum raza 2, afecta la producción de plátano (Musa AAB Simmonds en Colombia, ocasionando pérdidas hasta de 100%. In vitro, se evaluó el efecto de filtrados crudos de cepas de Trichoderma sp. y dos productos comerciales como posibles reductores de poblaciones de R. solanacearum. Para cada cepa de Trichoderma spp., se empleó filtrado (40% en solución acuosa y para R. solanacearum se utilizó una dilución de 10-4 por caja de petri, en un diseño completamente al azar con tres repeticiones para determinar el número de unidades formadoras de colonia de R. solanacearum. En invernadero, se aplicaron suspensiones de T. harzianum (Agroguard®, T. viride 14PDA3A y Ecoterra® en plantas de plátano Dominico Hartón y 30 días después se inoculó R. solanacearum en un diseño de bloques completos al azar con cuatro repeticiones. La severidad del ataque de R. solanacearum se evaluó utilizando una escala de síntomas foliares de 0 a 6. In vitro, los extractos crudos de dos cepas y dos productos comerciales de Trichoderma spp. inhibieron el 100% de R. solanacearum. Los tratamientos con T. viride y Ecoterra® mostraron bajos niveles de control de R. solanacearum en plantas (0.63 y 1.88, respectivamente.
Kumar, Aundy; Munjal, Vibhuti; Sheoran, Neelam; Prameela, Thekkan Puthiyaveedu; Suseelabhai, Rajamma; Aggarwal, Rashmi; Jain, Rakesh Kumar; Eapen, Santhosh J
2017-01-05
The genome of Ralstonia solanacearum CaRs_Mep, a race 4/biovar 3/phylotype I bacterium causing wilt in small cardamom and other Zingiberaceae plants, was sequenced. Analysis of the 5.7-Mb genome sequence will aid in better understanding of the genetic determinants of host range, host jump, survival, pathogenicity, and virulence of race 4 of R. solanacearum. Copyright © 2017 Kumar et al.
Regulation Involved in Colonization of Intercellular Spaces of Host Plants in Ralstonia solanacearum
Directory of Open Access Journals (Sweden)
Yasufumi Hikichi
2017-06-01
Full Text Available A soil-borne bacterium Ralstonia solanacearum invading plant roots first colonizes the intercellular spaces of the root, and eventually enters xylem vessels, where it replicates at high levels leading to wilting symptoms. After invasion into intercellular spaces, R. solanacearum strain OE1-1 attaches to host cells and expression of the hrp genes encoding components of the type III secretion system (T3SS. OE1-1 then constructs T3SS and secrets effectors into host cells, inducing expression of the host gene encoding phosphatidic acid phosphatase. This leads to suppressing plant innate immunity. Then, OE1-1 grows on host cells, inducing quorum sensing (QS. The QS contributes to regulation of OE1-1 colonization of intercellular spaces including mushroom-type biofilm formation on host cells, leading to its virulence. R. solanacearum strains AW1 and K60 produce methyl 3-hydroxypalmitate (3-OH PAME as a QS signal. The methyltransferase PhcB synthesizes 3-OH PAME. When 3-OH PAME reaches a threshold level, it increases the ability of the histidine kinase PhcS to phosphorylate the response regulator PhcR. This results in elevated levels of functional PhcA, the global virulence regulator. On the other hand, strains OE1-1 and GMI1000 produce methyl 3-hydroxymyristate (3-OH MAME as a QS signal. Among R. solanacearum strains, the deduced PhcB and PhcS amino acid sequences are related to the production of QS signals. R. solanacearum produces aryl-furanone secondary metabolites, ralfuranones, which are extracellularly secreted and required for its virulence, dependent on the QS. Interestingly, ralfuranones affect the QS feedback loop. Taken together, integrated signaling via ralfuranones influences the QS, contributing to pathogen virulence.
Lowe-Power, Tiffany M; Hendrich, Connor G; von Roepenack-Lahaye, Edda; Li, Bin; Wu, Dousheng; Mitra, Raka; Dalsing, Beth L; Ricca, Patrizia; Naidoo, Jacinth; Cook, David; Jancewicz, Amy; Masson, Patrick; Thomma, Bart; Lahaye, Thomas; Michael, Anthony J; Allen, Caitilyn
2018-04-01
Ralstonia solanacearum thrives in plant xylem vessels and causes bacterial wilt disease despite the low nutrient content of xylem sap. We found that R. solanacearum manipulates its host to increase nutrients in tomato xylem sap, enabling it to grow better in sap from infected plants than in sap from healthy plants. Untargeted GC/MS metabolomics identified 22 metabolites enriched in R. solanacearum-infected sap. Eight of these could serve as sole carbon or nitrogen sources for R. solanacearum. Putrescine, a polyamine that is not a sole carbon or nitrogen source for R. solanacearum, was enriched 76-fold to 37 µM in R. solanacearum-infected sap. R. solanacearum synthesized putrescine via a SpeC ornithine decarboxylase. A ΔspeC mutant required ≥ 15 µM exogenous putrescine to grow and could not grow alone in xylem even when plants were treated with putrescine. However, co-inoculation with wildtype rescued ΔspeC growth, indicating R. solanacearum produced and exported putrescine to xylem sap. Intriguingly, treating plants with putrescine before inoculation accelerated wilt symptom development and R. solanacearum growth and systemic spread. Xylem putrescine concentration was unchanged in putrescine-treated plants, so the exogenous putrescine likely accelerated disease indirectly by affecting host physiology. These results indicate that putrescine is a pathogen-produced virulence metabolite. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.
Kawasaki, Takeru; Satsuma, Hideki; Fujie, Makoto; Usami, Shoji; Yamada, Takashi
2007-12-01
A green fluorescent protein (GFP)-expressing plasmid was constructed from a filamentous bacteriophage phiRSS1 that infects the phytopathogen Ralstonia solanacearum. This plasmid designated as pRSS12 (4.7 kbp in size) consists of an approximately 2248 bp region of the phiRSS1 RF DNA, including ORF1-ORF3 and the intergenic region (IG), and a Km cassette in addition to the GFP gene. It was easily introduced by electroporation and stably maintained even without selective pressure in strains of R. solanacearum of different races and biovars. Strong green fluorescence emitted from pRSS12-transformed bacterial cells was easily monitored in tomato tissues (stem, petiole, and root) after infection as well as from soil samples. These results suggest that pRSS12 can serve as an easy-to-use GFP-tagging tool for any given strain of R. solanacearum in cytological as well as field studies.
Chave, Marie; Crozilhac, Patrice; Deberdt, Péninna; Plouznikoff, Katia; Declerck, Stéphane
2017-10-01
Bacterial wilt caused by Ralstonia solanacearum is one of the world's most important soil-borne plant diseases. In Martinique, French West Indies, a highly virulent new pathogenic variant of this bacterium (phylotype IIB/4NPB) severely impacts tomato production. Here we report on the effect of R. solanacearum CFBP 6783, classified in phytotype IIB/4NPB, on tomato plantlets grown under strict in vitro culture conditions in the presence or absence of the arbuscular mycorrhizal fungus Rhizophagus irregularis MUCL 41833. A mycelium donor plant (i.e. Crotalaria spectabilis) was used for rapid, uniform mycorrhization of tomato plantlets that were subsequently infected by the bacterium. Bacterial wilt was significantly delayed and the incidence of the disease consequently reduced in the mycorrhizal tomato plantlets. Conversely, R. solanacearum did not affect root colonization by the AMF within the 16 days of the experiment. These results suggested that the mycorrhizal fungus was able to reduce bacterial wilt symptoms, probably by eliciting defence mechanisms in the plant.
Wenneker, M.; Verdel, M.S.W.; Groeneveld, R.M.W.; Kempenaar, C.; Beuningen, van A.R.; Janse, J.D.
1999-01-01
The population dynamics of the brown rot bacterium Ralstonia (Pseudomonas) solanacearum in surface water of two selected water-areas were monitored over a two-year period. In some cases during summer, high bacterial numbers (up to 106 cfu l−1) were observed. In a host plant survey a few plants of
Cao, Yu; Pi, Hualiang; Chandrangsu, Pete; Li, Yongtao; Wang, Yuqi; Zhou, Han; Xiong, Hanqin; Helmann, John D; Cai, Yanfei
2018-03-12
Plant growth promoting rhizobacteria (PGPR) provide an effective and environmentally sustainable method to protect crops against pathogens. The spore-forming Bacilli are attractive PGPR due to their ease of storage and application. Here, we characterized two rhizosphere-associated Bacillus velezensis isolates (Y6 and F7) that possess strong antagonistic activity against Ralstonia solanacearum and Fusarium oxysporum under both laboratory and greenhouse conditions. We identified three lipopeptide (LP) compounds (surfactin, iturin and fengycin) as responsible for the antimicrobial activity of these two strains. We further dissected the contribution of LPs to various biological processes important for rhizosphere colonization. Although either iturin or fengycin is sufficient for antibacterial activity, cell motility and biofilm formation, only iturin plays a primary role in defense against the fungal pathogen F. oxysporum. Additionally, we found that LP production is significantly stimulated during interaction with R. solanacearum. These results demonstrate the different roles of LPs in the biology of B. velezensis and highlight the potential of these two isolates as biocontrol agents against phytopathogens.
Cellier, Gilles; Jacobs, Jonathan M.; Mangenot, Sophie; Barbe, Valérie; Lajus, Aurélie; Vallenet, David; Medigue, Claudine; Fegan, Mark; Allen, Caitilyn; Prior, Philippe
2011-01-01
The Ralstonia solanacearum species complex includes R. solanacearum, R. syzygii, and the Blood Disease Bacterium (BDB). All colonize plant xylem vessels and cause wilt diseases, but with significant biological differences. R. solanacearum is a soilborne bacterium that infects the roots of a broad range of plants. R. syzygii causes Sumatra disease of clove trees and is actively transmitted by cercopoid insects. BDB is also pathogenic to a single host, banana, and is transmitted by pollinating insects. Sequencing and DNA-DNA hybridization studies indicated that despite their phenotypic differences, these three plant pathogens are actually very closely related, falling into the Phylotype IV subgroup of the R. solanacearum species complex. To better understand the relationships among these bacteria, we sequenced and annotated the genomes of R. syzygii strain R24 and BDB strain R229. These genomes were compared to strain PSI07, a closely related Phylotype IV tomato isolate of R. solanacearum, and to five additional R. solanacearum genomes. Whole-genome comparisons confirmed previous phylogenetic results: the three phylotype IV strains share more and larger syntenic regions with each other than with other R. solanacearum strains. Furthermore, the genetic distances between strains, assessed by an in-silico equivalent of DNA-DNA hybridization, unambiguously showed that phylotype IV strains of BDB, R. syzygii and R. solanacearum form one genomic species. Based on these comprehensive data we propose a revision of the taxonomy of the R. solanacearum species complex. The BDB and R. syzygii genomes encoded no obvious unique metabolic capacities and contained no evidence of horizontal gene transfer from bacteria occupying similar niches. Genes specific to R. syzygii and BDB were almost all of unknown function or extrachromosomal origin. Thus, the pathogenic life-styles of these organisms are more probably due to ecological adaptation and genomic convergence during vertical
Jacobs, Jonathan M; Babujee, Lavanya; Meng, Fanhong; Milling, Annett; Allen, Caitilyn
2012-01-01
Plant xylem fluid is considered a nutrient-poor environment, but the bacterial wilt pathogen Ralstonia solanacearum is well adapted to it, growing to 10(8) to 10(9) CFU/g tomato stem. To better understand how R. solanacearum succeeds in this habitat, we analyzed the transcriptomes of two phylogenetically distinct R. solanacearum strains that both wilt tomato, strains UW551 (phylotype II) and GMI1000 (phylotype I). We profiled bacterial gene expression at ~6 × 10(8) CFU/ml in culture or in plant xylem during early tomato bacterial wilt pathogenesis. Despite phylogenetic differences, these two strains expressed their 3,477 common orthologous genes in generally similar patterns, with about 12% of their transcriptomes significantly altered in planta versus in rich medium. Several primary metabolic pathways were highly expressed during pathogenesis. These pathways included sucrose uptake and catabolism, and components of these pathways were encoded by genes in the scrABY cluster. A UW551 scrA mutant was significantly reduced in virulence on resistant and susceptible tomato as well as on potato and the epidemiologically important weed host Solanum dulcamara. Functional scrA contributed to pathogen competitive fitness during colonization of tomato xylem, which contained ~300 µM sucrose. scrA expression was induced by sucrose, but to a much greater degree by growth in planta. Unexpectedly, 45% of the genes directly regulated by HrpB, the transcriptional activator of the type 3 secretion system (T3SS), were upregulated in planta at high cell densities. This result modifies a regulatory model based on bacterial behavior in culture, where this key virulence factor is repressed at high cell densities. The active transcription of these genes in wilting plants suggests that T3SS has a biological role throughout the disease cycle. IMPORTANCE Ralstonia solanacearum is a widespread plant pathogen that causes bacterial wilt disease. It inflicts serious crop losses on tropical
Directory of Open Access Journals (Sweden)
Cécile Segonzac
2017-08-01
Full Text Available Ralstonia solanacearum is the causal agent of the devastating bacterial wilt disease in many high value Solanaceae crops. R. solanacearum secretes around 70 effectors into host cells in order to promote infection. Plants have, however, evolved specialized immune receptors that recognize corresponding effectors and confer qualitative disease resistance. In the model species Arabidopsis thaliana, the paired immune receptors RRS1 (resistance to Ralstonia solanacearum 1 and RPS4 (resistance to Pseudomonas syringae 4 cooperatively recognize the R. solanacearum effector PopP2 in the nuclei of infected cells. PopP2 is an acetyltransferase that binds to and acetylates the RRS1 WRKY DNA-binding domain resulting in reduced RRS1-DNA association thereby activating plant immunity. Here, we surveyed the naturally occurring variation in PopP2 sequence among the R. solanacearum strains isolated from diseased tomato and pepper fields across the Republic of Korea. Our analysis revealed high conservation of popP2 sequence with only three polymorphic alleles present amongst 17 strains. Only one variation (a premature stop codon caused the loss of RPS4/RRS1-dependent recognition in Arabidopsis. We also found that PopP2 harbors a putative eukaryotic transcriptional repressor motif (ethylene-responsive element binding factor-associated amphiphilic repression or EAR, which is known to be involved in the recruitment of transcriptional co-repressors. Remarkably, mutation of the EAR motif disabled PopP2 avirulence function as measured by the development of hypersensitive response, electrolyte leakage, defense marker gene expression and bacterial growth in Arabidopsis. This lack of recognition was partially but significantly reverted by the C-terminal addition of a synthetic EAR motif. We show that the EAR motif-dependent gain of avirulence correlated with the stability of the PopP2 protein. Furthermore, we demonstrated the requirement of the PopP2 EAR motif for PTI
Control of Ralstonia Solanacearum The Causal Agent of Brown Rot in Potato Using Essential Oils
International Nuclear Information System (INIS)
Salem, E.A.
2011-01-01
Five essential oils, namely peppermint (Mentha piperita L.), caraway (Carium carvum L.), fennel (Foeniculum vulgare Mill.), lemongrass (Cymbopogon citratus Staph.) and thyme (Thymus vulgaris), were used separately against Ralstonia solanacearum; the causal agent of brown rot in potato. The most two effective oils (peppermint and thyme) were used in vitro and in vivo after testing their effects on potato tubers buds germination. Peppermint inhibited buds germination but thyme have no effects on buds germination. In vivo, the control of brown rot using thyme oil in glass house experiment reduced the percentage of brown rot infection to 30.6% and reduced the severity of disease from 5 to 3.
Energy Technology Data Exchange (ETDEWEB)
Din, N.; Ahmad, M.; Siddique, M.; Ali, A.; Naz, I.; Ullah, N.; Ahmad, F.
2016-11-01
Phytobiocides are a good alternative to chemicals in managing bacterial diseases including bacterial wilt of tomato caused by Ralstonia solanacearum. In the present research study, finely ground dried powders of seven widely available medicinal plants/weeds species viz., Peganum harmala (esfand or wild rue), Calotropis procera (sodom apple), Melia azedarach (white cedar), Allium sativum (garlic), Adhatoda vasica (malabar nut), Tagetes patula (marigold) and Nerium oleander (oleander) were assessed for their anti-microbial activity, both in-vitro (10% w/v) and in-vivo (10, 20, 30, and 40 g/kg of potted soil) against R. solanacearum. Aqueous extracts (prepared as 10% w/v, soaking for 48-72 h and filtering) of C. procera, A. vasica, and T. patula inhibited the in-vitro growth of the bacterial pathogen over 60% of that produced by the standard antibiotic streptomycin. A. sativum, N. oleander and P. harmala aqueous extracts were less effective while M. azedarach showed no effect against R. solanacearum. The higher dose (40 g/kg of soil) of C. procera, A. vasica and T. patula decreased disease severity quite effectively and increased yield and plant growth characters as much as the standard antibiotic did. No phytotoxicity of medicinal plants powder was observed on tomato plants. Alkaloids, flavonoids, tannins, saponins and terpenoids were detected in the aqueous extracts of T. patula and A. vasica whereas C. procera was found to have only alkaloids, flavonoids, tannins and saponins. Our data suggest that dried powders of T. patula, C. procera and A. vasica (40 g/kg of soil) could be used as an effective component in the integrated disease management programs against bacterial wilt of tomato. (Author)
Dalsing, Beth L; Truchon, Alicia N; Gonzalez-Orta, Enid T; Milling, Annett S; Allen, Caitilyn
2015-03-17
Genomic data predict that, in addition to oxygen, the bacterial plant pathogen Ralstonia solanacearum can use nitrate (NO3(-)), nitrite (NO2(-)), nitric oxide (NO), and nitrous oxide (N2O) as terminal electron acceptors (TEAs). Genes encoding inorganic nitrogen reduction were highly expressed during tomato bacterial wilt disease, when the pathogen grows in xylem vessels. Direct measurements found that tomato xylem fluid was low in oxygen, especially in plants infected by R. solanacearum. Xylem fluid contained ~25 mM NO3(-), corresponding to R. solanacearum's optimal NO3(-) concentration for anaerobic growth in vitro. We tested the hypothesis that R. solanacearum uses inorganic nitrogen species to respire and grow during pathogenesis by making deletion mutants that each lacked a step in nitrate respiration (ΔnarG), denitrification (ΔaniA, ΔnorB, and ΔnosZ), or NO detoxification (ΔhmpX). The ΔnarG, ΔaniA, and ΔnorB mutants grew poorly on NO3(-) compared to the wild type, and they had reduced adenylate energy charge levels under anaerobiosis. While NarG-dependent NO3(-) respiration directly enhanced growth, AniA-dependent NO2(-) reduction did not. NO2(-) and NO inhibited growth in culture, and their removal depended on denitrification and NO detoxification. Thus, NO3(-) acts as a TEA, but the resulting NO2(-) and NO likely do not. None of the mutants grew as well as the wild type in planta, and strains lacking AniA (NO2(-) reductase) or HmpX (NO detoxification) had reduced virulence on tomato. Thus, R. solanacearum exploits host NO3(-) to respire, grow, and cause disease. Degradation of NO2(-) and NO is also important for successful infection and depends on denitrification and NO detoxification systems. The plant-pathogenic bacterium Ralstonia solanacearum causes bacterial wilt, one of the world's most destructive crop diseases. This pathogen's explosive growth in plant vascular xylem is poorly understood. We used biochemical and genetic approaches to show
Denancé, N.; Ranocha, P.; Oria, N.; Barlet, X.; Rivière, M.P.; Yadeta, K.A.; Hoffmann, L.; Perreau, F.; Clément, G.; Maia-Grondard, A.; Berg, van den G.C.M.; Savelli, B.; Fournier, S.; Aubert, Y.; Pelletier, S.; Thomma, B.P.H.J.; Molina, A.; Jouanin, L.; Marco, Y.; Goffner, D.
2013-01-01
Inactivation of Arabidopsis WAT1 (Walls Are Thin1), a gene required for secondary cell-wall deposition, conferred broad-spectrum resistance to vascular pathogens, including the bacteria Ralstonia solanacearum and Xanthomonas campestris pv. campestris, and the fungi Verticillium dahliae and
Bhunchoth, A; Phironrit, N; Leksomboon, C; Chatchawankanphanich, O; Kotera, S; Narulita, E; Kawasaki, T; Fujie, M; Yamada, T
2015-04-01
To isolate and characterize novel bacteriophages infecting the phytopathogen, Ralstonia solanacearum, and to evaluate them as resources with potential uses in the biocontrol of bacterial wilt. Fourteen phages infecting R. solanacearum were isolated from soil samples collected in Chiang Mai, Thailand. The phages showed different host ranges when tested against 59 R. solanacearum strains isolated from Thailand and Japan. These phages were characterized as nine podoviruses and five myoviruses based on their morphology. Podovirus J2 in combination with another podovirus (φRSB2) lysed host cells very efficiently in contaminated soil. J2 treatment prevented wilting of tomato plants infected with a highly virulent R. solanacearum strain. Treatment with J2 effectively reduced the amount of the bacterial wilt pathogen in contaminated soil and prevented bacterial wilt of tomato in pot experiments. Myovirus J6 possessed jumbo phage features, giving a unique opportunity to study its utilization as a biocontrol agent. As exemplified by J2, the phages isolated in this study represent valuable resources with potential uses in biocontrol of bacterial wilt. A rare jumbo phage J6 served as a valuable subject to understand and utilize this new group of phages. © 2015 The Society for Applied Microbiology.
Flores Ocampo, Mitzi
2016-01-01
La vermicomposta es un tipo de abono orgánico basado en un proceso de biooxidación y estabilización de desechos orgánicos que involucran interacciones entre lombrices y microorganismos del suelo; su potencial como bioplaguicida contra fitopatógenos ha sido poco estudiado pero depende del tipo de materia orgánica con que se alimente a la lombriz. Pectobacterium carotovorum subsp. carotovorum y Ralstonia solanacearum son bacterias que causan enfermedades en Solanáceas, tanto en c...
Fujie, Makoto; Takamoto, Hirofumi; Kawasaki, Takeru; Fujiwara, Akiko; Yamada, Takashi
2010-02-01
We monitored growth and movement of Ralstonia solanacearum harboring the plasmid pRSS12 in tomato seedlings. The plasmid contains a gene for green fluorescent protein (GFP) and is stably maintained in R. solanacearum cells without selection pressure. Bacteria harboring the plasmid can be tracked in planta by visualizing GFP fluorescence. Stems of seedlings were infected with R. solanacearum cells transformed with pRSS12, and bacterial growth and movement, particularly around the vascular bundles, were monitored for more than 7 days. Our results showed that vascular bundles are independent of each other within the stem, and that it takes a long time for R. solanacearum cells to migrate from one vascular bundle to another. For real-time monitoring of bacteria in planta, tomato seedlings were grown on agar medium and bacterial suspension was applied to the root apex. The bacterial invasion process was monitored by fluorescent microscopy. Bacteria invaded taproots within 6 h, and movement of the bacteria was observed until 144 h after inoculation. In susceptible tomato cultivars, strong GFP fluorescence was observed in hypocotyls and lateral roots as well as the taproot. In resistant cultivars, however, GFP fluorescence was rarely observed on lateral roots. Our results show that this monitoring system can be used to assess bacterial pathogenicity efficiently. Copyright (c) 2009 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Aplicación de la técnica de PCR en la detección de Ralstonia solanacearum en campos paperos
Directory of Open Access Journals (Sweden)
Analía Sanabria
2013-01-01
Full Text Available La murchera de la papa causada por Ralstonia solanacearum es una amenaza permanente para el cultivo con consecuencias devastadoras en condiciones predisponentes. La incidencia de esta enfermedad en Uruguay es variable; desde la década de 1970 se registran brotes agudos periódicos difíciles de prevenir y controlar. Se ha detectado a R. solanacearumen todas las regiones de producción, lo que dificulta el mantenimiento de áreas libres de patógeno y la continuidad del cultivo. Dado que no existen agentes químicos efectivos, las estrategias de control apuntan a la prevención, recomendando la rotación de cultivos, la desinfección de herramientas y el uso de semilla certificada libre del patógeno. En este trabajo se optimizó la detección molecular de R. solanacearum en suelo mediante PCR con el objetivo de conocer la persistencia del patógeno en el campo. El método se aplicó al análisis de tres campos con diferentes antecedentes de murchera, y se demostró que el patógeno es capaz de permanecer viable por más de 10 años. También se determinaron las ventajas y limitaciones de esta metodología en su aplicación a muestras complejas. Estos resultados constituyen un importante aporte que genera conocimiento que permitirá a los productores delinear mejores estrategias para el manejo de la enfermedad al momento de planificar los cultivos.
Kwon, Jae Won; Kim, Shin Duk
2014-01-01
Bacillus subtilis JW-1 was isolated from rhizosphere soil as a potential biocontrol agent of bacterial wilt caused by Ralstonia solanacearum. Seed treatment followed by a soil drench application with this strain resulted in >80% reduction in bacterial wilt disease compared with that in the untreated control under greenhouse conditions. The antibacterial compound produced by strain JW-1 was purified by bioactivity-guided fractionation. Based on mass spectroscopy and nuclear magnetic resonance spectral data ((1)H, (13)C, (1)H-(1)H correlation spectroscopies, rotating frame nuclear Overhauser effect spectroscopy, and heteronuclear multiple-bond correlation spectroscopy), the structure of this compound was elucidated as a cyclic lipopeptide composed of a heptapeptide (Gln-Leu-Leu-Val-Asp-Leu-Leu) bonded to a β-hydroxy-iso-hexadecanoic acid arranged in a lactone ring system.
Recent Trends in Control Methods for Bacterial Wilt Diseases Caused by Ralstonia solanacearum
Yuliar; Nion, Yanetri Asi; Toyota, Koki
2015-01-01
Previous studies have described the development of control methods against bacterial wilt diseases caused by Ralstonia solanacearum. This review focused on recent advances in control measures, such as biological, physical, chemical, cultural, and integral measures, as well as biocontrol efficacy and suppression mechanisms. Biological control agents (BCAs) have been dominated by bacteria (90%) and fungi (10%). Avirulent strains of R. solanacearum, Pseudomonas spp., Bacillus spp., and Streptomyces spp. are well-known BCAs. New or uncommon BCAs have also been identified such as Acinetobacter sp., Burkholderia sp., and Paenibacillus sp. Inoculation methods for BCAs affect biocontrol efficacy, such as pouring or drenching soil, dipping of roots, and seed coatings. The amendment of different organic matter, such as plant residue, animal waste, and simple organic compounds, have frequently been reported to suppress bacterial wilt diseases. The combined application of BCAs and their substrates was shown to more effectively suppress bacterial wilt in the tomato. Suppression mechanisms are typically attributed to the antibacterial metabolites produced by BCAs or those present in natural products; however, the number of studies related to host resistance to the pathogen is increasing. Enhanced/modified soil microbial communities are also indirectly involved in disease suppression. New promising types of control measures include biological soil disinfection using substrates that release volatile compounds. This review described recent advances in different control measures. We focused on the importance of integrated pest management (IPM) for bacterial wilt diseases. PMID:25762345
Directory of Open Access Journals (Sweden)
Yuanman Tang
2017-11-01
Full Text Available Various classes of plant pathogenesis-related proteins have been identified in the past several decades. PR-Q, a member of the PR3 family encoding chitinases, has played an important role in regulating plant resistance and preventing pathogen infection. In this paper, we functionally characterized NtPR-Q in tobacco plants and found that the overexpression of NtPR-Q in tobacco Yunyan87 resulted in higher resistance to Ralstonia solanacearum inoculation. Surprisingly, overexpression of NtPR-Q led to the activation of many defense-related genes, such as salicylic acid (SA-responsive genes NtPR1a/c, NtPR2 and NtCHN50, JA-responsive gene NtPR1b and ET production-associated genes NtACC Oxidase and NtEFE26. Consistent with the role of NtPR-Q in multiple stress responses, NtPR-Q transcripts were induced by the exogenous hormones SA, ethylene and methyl jasmonate, which could enhance the resistance of tobacco to R. solanacearum. Collectively, our results suggested that NtPR-Q overexpression led to the up-regulation of defense-related genes and enhanced plant resistance to R. solanacearum infection.
Li, Zhikun; Zhu, Honghui
2010-03-01
To isolate a bacterial strain YPP-9, dominantly colonizing the rhizosphere of tomato using root exudate medium. In this study, we investigated the antagnism and disease-controling effect against Ralstonia solanacearum, evaluated the ability to colonize the rhizosphere of tomato, and further analyzed the phylogeny of YPP-9. To evaluate the antagnism against R. solanacearum and the biocontrol on tomato bacterial wilt by YPP-9 respectively employing plate culture method and pot experiment in green house. We analyzed the rhizosphere colonization of YPP-9 by PCR-denaturing gradient gel electrophoresis, and also identified the taxonomic position of YPP-9 using morphological and chemotaxonomic characteristics together with 16S rRNA gene phylogenetic analysis. YPP-9 suppressed the growth of R. solanacearum (strains SSF-4) in vitro with the inhibition zone of 5 mm. The disease-control efficiency against tomato bacterial wilt in pot was 63.4%. YPP-9 also colonized the rhizosphere of tomato well. The colonies were cream in colour after 24 h culture. Cells were gram-positive, rods (1.8 -4.1 microm x 0.9 - 1.1 microm) and formed endospores. Endospores were mainly ellipsoidal to cylindrical and lied in subterminal, and occasionally paracentral, positions in no swollen sporangia. No crystal protein. The pH range for YPP-9 growth was 5.5 - 8.5 with the optimum at pH 6.0, and the temperature for YPP-9 growth was 20 to 45 degrees with the optimum at 30 degrees. The results of BIOLOG GP2 showed that YPP-9 was Bacillus. Phylogenetic analysis of the 16S rRNA gene sequence revealed that YPP-9 was the most closely related to Bacillus fumarioli, with the sequence similarity of 97.7%. The sequence number was FJ231500. The DNA G + C content was 41.9%. The major menaquinone was MK-7. The dominant fatty acids in cell wall were C14 : 0 iso, C15 : 0 iso, C16 : 0 iso and C16 : 1omega 7c alcohol, with the contents of 28.27%, 19.59%, 12.93% and 10.88%, respectively. Bacterium YPP-9 strongly
Bryant, Ruth; Bew, Janice; Conyers, Christine; Stones, Robert; Alcock, Michael; Elphinstone, John
2013-01-01
Variable-number tandem-repeat (VNTR) analysis was used for high-resolution discrimination among Ralstonia solanacearum phylotype IIB sequevar 1 (PIIB-1) isolates and further evaluated for use in source tracing. Five tandem-repeat-containing loci (comprising six tandem repeats) discriminated 17 different VNTR profiles among 75 isolates from potato, geranium, bittersweet (Solanum dulcamara), tomato, and the environment. R. solanacearum isolates from crops at three unrelated outbreak sites where river water had been used for irrigation had distinct VNTR profiles that were shared with PIIB-1 isolates from infected bittersweet growing upriver of each site. The VNTR profiling results supported the implication that the source of R. solanacearum at each outbreak was contaminated river water. Analysis of 51 isolates from bittersweet growing in river water at different locations provided a means to evaluate the technique for studying the epidemiology of the pathogen in the environment. Ten different VNTR profiles were identified among bittersweet PIIB-1 isolates from the River Thames. Repeated findings of contiguous river stretches that produced isolates that shared single VNTR profiles supported the hypothesis that the pathogen had disseminated from infected bittersweet plants located upriver. VNTR profiles shared between bittersweet isolates from two widely separated Thames tributaries (River Ray and River Colne) suggested they were independently contaminated with the same clonal type. Some bittersweet isolates had VNTR profiles that were shared with potato isolates collected outside the United Kingdom. It was concluded that VNTR profiling could contribute to further understanding of R. solanacearum epidemiology and assist in control of future disease outbreaks. PMID:23892739
Pig slurry reduces the survival of Raltstonia solanacearum biovar 2 in soil
Gorissen, A.; Overbeek, van L.S.; Elsas, van J.D.
2004-01-01
The effect of added pig slurry and solarization on the survival of Ralstonia solanacearum biovar 2 strain 1609 in soil was analysed in soil microcosms and field plots. In addition, the invasion of potato plants by R. solanacearum and the development of disease symptoms were determined, as measures
International Nuclear Information System (INIS)
Hasan, S.; Haq, M. I.; Naz, F.; Tahir, M. I.
2016-01-01
Ralstonia solanacearum, the causal organism of bacterial wilt of solanaceous crops is a major limitation on the production of solanaceous crops worldwide. The present studies were carried out to explore the prevalence, severity, virulence and host specificity range of R. solanacearum in chili, tomato, eggplant and potato plants while biocontrol of this pathogen was studied on tomato. The isolation and the initial identification of bacterium were done on TTC and 523 media. Out of 32 isolates, 30 showed positive hypersensitive reaction (HR) with variable response and were confirmed as R. solanacearum by performing biochemical tests i.e. Gram staining, KOH, catalase oxidation, Kovacs oxidation, levan production from sucrose, lipase activity on tween 80 agar, production of fluorescent pigment, and oxidation/fermentation of glucose. Race identification studies showed that all the isolates belonged to Race 3 while biovar confirmation tests revealed that 4, 3 and 23 isolates belonged to biovar 1, biovar 2 and biovar 3, respectively. The isolates belonging to distinct biovar class were tested for their wideness of host range by challenging them to chili, tomato, eggplant and potato plants. It was observed that biovar 3 is the most aggressive and has widest host range as compared to counterparts. Biocontrol studies through antagonistic rhizobacteria resulted four antagonistic isolates; PRB10, PAP5, PAT1 and PTR6 having the highest biocontrol activity with 98.75%, 97.5%, 93.75% and 91.25% respectively. (author)
Detection of latent infection by Ralstonia solanacearum in potato ...
African Journals Online (AJOL)
STORAGESEVER
2008-06-03
Jun 3, 2008 ... solanacearum in potato tuber seed certification schemes more so in screening for presence of R. solanacearum in seed ... Bacterial wilt is, after late blight, the most important ... with respect to tuber-borne diseases such as bacterial wilt and those ... The potato crop was preceded by maize. Bacterial wilt ...
Proteome Analysis of Disease Resistance against Ralstonia solanacearum in Potato Cultivar CT206-10
Directory of Open Access Journals (Sweden)
Sangryeol Park
2016-02-01
Full Text Available Potato is one of the most important crops worldwide. Its commercial cultivars are highly susceptible to many fungal and bacterial diseases. Among these, bacterial wilt caused by Ralstonia solanacearum causes significant yield loss. In the present study, integrated proteomics and genomics approaches were used in order to identify bacterial wilt resistant genes from Rs resistance potato cultivar CT-206-10. 2-DE and MALDI-TOF/TOF-MS analysis identified eight differentially abundant proteins including glycine-rich RNA binding protein (GRP, tomato stress induced-1 (TSI-1 protein, pathogenesis-related (STH-2 protein and pentatricopeptide repeat containing (PPR protein in response to Rs infection. Further, semi-quantitative RT-PCR identified up-regulation in transcript levels of all these genes upon Rs infection. Taken together, our results showed the involvement of the identified proteins in the Rs stress tolerance in potato. In the future, it would be interesting to raise the transgenic plants to further validate their involvement in resistance against Rs in potato.
Directory of Open Access Journals (Sweden)
Karine Laste Macagnan
Full Text Available Poly(3-hydroxybutyrate (P(3HB is a biodegradable plastic biopolymer that accumulates as lipophilic inclusions in the cytoplasm of some microorganisms. The biotechnological process by which P(3HB is synthesized occurs in two phases. The first phase involves cell growth in a complex culture medium, while the second phase involves polymer accumulation in the presence of excess carbon sources. As such, the efficiency of the second phase depends on the first phase. The aim of this study was to evaluate culture media with different concentrations of sucrose and glucose and different pH values in the inoculum phase of Ralstonia solanacearum RS with the intention of identifying methods by which the biomass yield could be increased, subsequently enhancing the yield of P(3HB. The culture medium was formulated according to the experimental planning type of central composite rotational design 22. The independent variables were pH and sugar concentration (sucrose and glucose, and the dependent variables were OD600nm, dry cell weight (DCW, and P(3HB yield. The highest cell growth, estimated by the OD600nm (20.6 and DCW (5.35 values, was obtained when sucrose was used in the culture medium at a concentration above 35 g.L-1 in combination with an acidic pH. High polymer (45% accumulation was also achieved under these conditions. Using glucose, the best results for OD600nm (12.5 and DCW (2.74 were also obtained at acidic pH but with a sugar concentration at the minimum values evaluated. Due to the significant accumulation of polymer in the cells that were still in the growth phase, the accumulating microorganism P(3HB Ralstonia solanacearum RS can be classified as having type II metabolism in relation to the polymer accumulation phase, which is different from other Ralstonia spp. studied until this time.
Ralstonia solanacearum – a New Threat to Potato Production in Serbia
Directory of Open Access Journals (Sweden)
Svetlana Milijašević-Marčić
2013-12-01
Full Text Available A survey of ware potatoes (a total of 1127 samples from localities in Serbia during two consecutive years resulted in detection and identification of R. solanacearum in 17 tuber samples. The monitoring detected the causal agent of bacterial wilt and brown rot of potato in three districts of Vojvodina province. In 2011, the infection by R. solanacearum was confirmed in 7 samples of ware potato tubers (varieties – Saturna, Pirol, Hermes, Panda in West Bačka and South Bačka Districts. In 2012, the infection by R. solanacearum was confirmed in 10 potato tuber samples (Lady Claire, Desiree, Panda, Red Fantasy and Vineta varieties from two districts: South Bačka and Central Banat. Bacterial strains obtained from positive samples were identified as R. solanacearum biovar 2 using PCR/RFLP analysis, pathogenicity test on tomato transplants, and nutritional, enzymatic and biovar determination tests. To our best knowledge, these are the only findings of R. solanacearum infection in ware potatoes in Serbia. R. solanacearum was not detected in tomato or any other host plant tested in this study. Furthermore, the bacterium was not found in any of the water samples tested, including those originating from areas in which the bacterium was found in ware potato samples.
Tran, Tuan Minh; MacIntyre, April; Hawes, Martha; Allen, Caitilyn
2016-01-01
Plant root border cells have been recently recognized as an important physical defense against soil-borne pathogens. Root border cells produce an extracellular matrix of protein, polysaccharide and DNA that functions like animal neutrophil extracellular traps to immobilize pathogens. Exposing pea root border cells to the root-infecting bacterial wilt pathogen Ralstonia solanacearum triggered release of DNA-containing extracellular traps in a flagellin-dependent manner. These traps rapidly immobilized the pathogen and killed some cells, but most of the entangled bacteria eventually escaped. The R. solanacearum genome encodes two putative extracellular DNases (exDNases) that are expressed during pathogenesis, suggesting that these exDNases contribute to bacterial virulence by enabling the bacterium to degrade and escape root border cell traps. We tested this hypothesis with R. solanacearum deletion mutants lacking one or both of these nucleases, named NucA and NucB. Functional studies with purified proteins revealed that NucA and NucB are non-specific endonucleases and that NucA is membrane-associated and cation-dependent. Single ΔnucA and ΔnucB mutants and the ΔnucA/B double mutant all had reduced virulence on wilt-susceptible tomato plants in a naturalistic soil-soak inoculation assay. The ΔnucA/B mutant was out-competed by the wild-type strain in planta and was less able to stunt root growth or colonize plant stems. Further, the double nuclease mutant could not escape from root border cells in vitro and was defective in attachment to pea roots. Taken together, these results demonstrate that extracellular DNases are novel virulence factors that help R. solanacearum successfully overcome plant defenses to infect plant roots and cause bacterial wilt disease. PMID:27336156
Directory of Open Access Journals (Sweden)
Tuan Minh Tran
2016-06-01
Full Text Available Plant root border cells have been recently recognized as an important physical defense against soil-borne pathogens. Root border cells produce an extracellular matrix of protein, polysaccharide and DNA that functions like animal neutrophil extracellular traps to immobilize pathogens. Exposing pea root border cells to the root-infecting bacterial wilt pathogen Ralstonia solanacearum triggered release of DNA-containing extracellular traps in a flagellin-dependent manner. These traps rapidly immobilized the pathogen and killed some cells, but most of the entangled bacteria eventually escaped. The R. solanacearum genome encodes two putative extracellular DNases (exDNases that are expressed during pathogenesis, suggesting that these exDNases contribute to bacterial virulence by enabling the bacterium to degrade and escape root border cell traps. We tested this hypothesis with R. solanacearum deletion mutants lacking one or both of these nucleases, named NucA and NucB. Functional studies with purified proteins revealed that NucA and NucB are non-specific endonucleases and that NucA is membrane-associated and cation-dependent. Single ΔnucA and ΔnucB mutants and the ΔnucA/B double mutant all had reduced virulence on wilt-susceptible tomato plants in a naturalistic soil-soak inoculation assay. The ΔnucA/B mutant was out-competed by the wild-type strain in planta and was less able to stunt root growth or colonize plant stems. Further, the double nuclease mutant could not escape from root border cells in vitro and was defective in attachment to pea roots. Taken together, these results demonstrate that extracellular DNases are novel virulence factors that help R. solanacearum successfully overcome plant defenses to infect plant roots and cause bacterial wilt disease.
Isolation and Characterization of Ralstonia solanacearum Causing ...
African Journals Online (AJOL)
Prof. Ogunji
Soil samples were collected from seven states in Nigeria known for high incidence of tomato bacterial ... (Rs) is a soil borne bacterial pathogen and a major limiting ..... crops such as maize could also reduce inoculum density ... bacterial blight wilt. (Pseudomonas solanacearum). Annals Applied Biology 111: 125-133. Denny ...
Schandry, Niklas; de Lange, Orlando; Prior, Philippe; Lahaye, Thomas
2016-01-01
Ralstonia solanacearum, a species complex of bacterial plant pathogens divided into four monophyletic phylotypes, causes plant diseases in tropical climates around the world. Some strains exhibit a broad host range on solanaceous hosts, while others are highly host-specific as for example some banana-pathogenic strains. Previous studies showed that transcription activator-like (TAL) effectors from Ralstonia, termed RipTALs, are capable of activating reporter genes in planta, if these are preceded by a matching effector binding element (EBE). RipTALs target DNA via their central repeat domain (CRD), where one repeat pairs with one DNA-base of the given EBE. The repeat variable diresidue dictates base repeat specificity in a predictable fashion, known as the TALE code. In this work, we analyze RipTALs across all phylotypes of the Ralstonia solanacearum species complex. We find that RipTALs are prevalent in phylotypes I and IV but absent from most phylotype III and II strains (10/12, 8/14, 1/24, and 1/5 strains contained a RipTAL, respectively). RipTALs originating from strains of the same phylotype show high levels of sequence similarity (>98%) in the N-terminal and C-terminal regions, while RipTALs isolated from different phylotypes show 47-91% sequence similarity in those regions, giving rise to four RipTAL classes. We show that, despite sequence divergence, the base preference for guanine, mediated by the N-terminal region, is conserved across RipTALs of all classes. Using the number and order of repeats found in the CRD, we functionally sub-classify RipTALs, introduce a new simple nomenclature, and predict matching EBEs for all seven distinct RipTALs identified. We experimentally study RipTAL EBEs and uncover that some RipTALs are able to target the EBEs of other RipTALs, referred to as cross-reactivity. In particular, RipTALs from strains with a broad host range on solanaceous hosts cross-react on each other's EBEs. Investigation of sequence divergence between
Meng, Fanhong; Babujee, Lavanya; Jacobs, Jonathan M; Allen, Caitilyn
2015-01-01
While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2) subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.
Directory of Open Access Journals (Sweden)
Fanhong Meng
Full Text Available While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2 subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.
Popa, Crina; Li, Liang; Gil, Sergio; Tatjer, Laura; Hashii, Keisuke; Tabuchi, Mitsuaki; Coll, Núria S; Ariño, Joaquín; Valls, Marc
2016-06-03
Bacterial pathogens possess complex type III effector (T3E) repertoires that are translocated inside the host cells to cause disease. However, only a minor proportion of these effectors have been assigned a function. Here, we show that the T3E AWR5 from the phytopathogen Ralstonia solanacearum is an inhibitor of TOR, a central regulator in eukaryotes that controls the switch between cell growth and stress responses in response to nutrient availability. Heterologous expression of AWR5 in yeast caused growth inhibition and autophagy induction coupled to massive transcriptomic changes, unmistakably reminiscent of TOR inhibition by rapamycin or nitrogen starvation. Detailed genetic analysis of these phenotypes in yeast, including suppression of AWR5-induced toxicity by mutation of CDC55 and TPD3, encoding regulatory subunits of the PP2A phosphatase, indicated that AWR5 might exert its function by directly or indirectly inhibiting the TOR pathway upstream PP2A. We present evidence in planta that this T3E caused a decrease in TOR-regulated plant nitrate reductase activity and also that normal levels of TOR and the Cdc55 homologues in plants are required for R. solanacearum virulence. Our results suggest that the TOR pathway is a bona fide T3E target and further prove that yeast is a useful platform for T3E function characterisation.
Cardozo, Carolina; Rodríguez, Paola; Cotes, José Miguel; Marín, Mauricio
2010-03-01
The banana moko disease, caused by the bacterium Ralstonia solanacearum, is one of the most important phytopathological problems of the banana agribusiness in tropical countries. In Uraba and Magdalena (Colombia), the main exporting regions of banana in Colombia, this disease causes a destruction estimated in 16.5 ha/year. The bacterium presents an extremely high level of genetic variation that affects control measures. This is the first study of its variation in Colombia and was done with AFLP molecular markers on a population of 100 isolates from banana plants, soils and "weeds". The high level of genetic diversity, with Nei and Shannon indexes of h=0.32 and I=0.48, respectively, and the AMOVA, showed that this population is subestructured (Fst=0.66): the host is the main factor of differentiation. Even so, previous tests show that all varieties have pathogenicity on Musa.
Ecology, Epidemiology and Disease Management of Ralstonia syzygii in Indonesia.
Safni, Irda; Subandiyah, Siti; Fegan, Mark
2018-01-01
Ralstonia solanacearum species complex phylotype IV strains, which have been primarily isolated from Indonesia, Australia, Japan, Korea, and Malaysia, have undergone recent taxonomic and nomenclatural changes to be placed in the species Ralstonia syzygii . This species contains three subspecies; Ralstonia syzygii subsp. syzygii , a pathogen causing Sumatra disease of clove trees in Indonesia, Ralstonia syzygii subsp. indonesiensis , the causal pathogen of bacterial wilt disease on a wide range of host plants, and Ralstonia syzygii subsp. celebesensis , the causal pathogen of blood disease on Musa spp. In Indonesia, these three subspecies have devastated the cultivation of susceptible host plants which have high economic value. Limited knowledge on the ecology and epidemiology of the diseases has hindered the development of effective control strategies. In this review, we provide insights into the ecology, epidemiology and disease control of these three subspecies of Ralstonia syzygii .
Directory of Open Access Journals (Sweden)
Patrícia Baston Barretti
2008-06-01
Full Text Available A partir de 150 isolados de bactérias endofíticas obtidos de folhas, caules e raízes de tomateiros sadios, 53 destacaram-se quanto à habilidade em promover o crescimento de plantas de tomateiro (Solanum lycopersicum L.. Submetidos a uma nova seleção, os isolados UFV-E17, UFV-E22, UFV-E25, UFV-E26, UFV-E27, Bacillus cereus (UFV-E29, UFV-E49, UFLA 06-LS, UFLA 08-LS e UFLA 11-LS apresentaram maior promoção do crescimento. Avaliações semanais de altura e número de folhas e folíolos das plantas aconteceram durante 45 dias. Após a sexta avaliação, mensurou-se a área foliar e o peso da matéria fresca e seca da parte aérea e da raiz das plantas. O isolado UFV-E49 apresentou melhor resultado para altura, área foliar, número de folhas e peso da matéria fresca e seca, tanto da parte aérea quanto da raiz. Dos isolados selecionados, somente dois apresentaram efeito inibitório direto in vitro a Ralstonia solanacearum.Out of one hundred and fifty isolates of endophytic bacteria from leaves, stems and roots of healthy tomatoes (Solanum lycopersicum L., fifty three showed ability to promote tomato plant growth, among these, ten isolates UFV-E17, UFV-E22, UFV-E25, UFV-E26, UFV-E27, Bacillus cereus (UFV-E29, UFV-E49, UFLA 06-LS, UFLA 08-LS and UFLA 11-LS, provided the largest plant growth promotion. Weekly assessment of plant height and number of leaves and leaflets were carried out during 45 days. After the sixth evaluation, the leaf area and the fresh and dry weight of the aerial part of plants and of the roots were measured. Isolate UFV-E49 provided the largest values of height, leaf area, number of leaves and fresh and dry weight of the aerial part of plants as well as the root. From the selected isolates, only two presented antimicrobial activity against Ralstonia solanacearum.
Yim, Woojong; Seshadri, Sundaram; Kim, Kiyoon; Lee, Gillseung; Sa, Tongmin
2013-06-01
Bacteria of genus Methylobacterium have been found to promote plant growth and regulate the level of ethylene in crop plants. This work is aimed to test the induction of defense responses in tomato against bacterial wilt by stress ethylene level reduction mediated by the ACC deaminase activity of Methylobacterium strains. Under greenhouse conditions, the disease index value in Methylobacterium sp. inoculated tomato plants was lower than control plants. Plants treated with Methylobacterium sp. challenge inoculated with Ralstonia solanacearum (RS) showed significantly reduced disease symptoms and lowered ethylene emission under greenhouse condition. The ACC and ACO (1-aminocyclopropane-1-carboxylate oxidase) accumulation in tomato leaves were significantly reduced with Methylobacterium strains inoculation. While ACC oxidase gene expression was found higher in plants treated with R. solanacearum than Methylobacterium sp. treatment, PR proteins related to induced systemic resistance like β-1,3-glucanase, PAL, PO and PPO were increased in Methylobacterium sp. inoculated plants. A significant increase in β-1,3-glucanase and PAL gene expression was found in all the Methylobacterium spp. treatments compared to the R. solanacearum treatment. This study confirms the activity of Methylobacterium sp. in increasing the defense enzymes by modulating the ethylene biosynthesis pathway and suggests the use of methylotrophic bacteria as potential biocontrol agents in tomato cultivation. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Liu, Qiuping; Liu, Ying; Tang, Yuanman; Chen, Juanni; Ding, Wei
2017-01-01
WRKY transcription factors (TFs) modulate plant responses to biotic and abiotic stresses. Here, we characterized a WRKY IIc TF, NtWRKY50, isolated from tobacco ( Nicotiana tabacum ) plants. The results showed that NtWRKY50 is a nuclear-localized protein and that its gene transcript is induced in tobacco when inoculated with the pathogenic bacterium Ralstonia solanacearum . Overexpression of NtWRKY50 enhanced bacterial resistance, which correlated with enhanced SA and JA/ET signaling genes. However, silencing of the NtWRKY50 gene had no obvious effects on plant disease resistance, implying functional redundancy of NtWRKY50 with other TFs. In addition, it was found that NtWRKY50 can be induced by various biotic or abiotic stresses, such as Potato virus Y, Rhizoctonia solani, Phytophthora parasitica , hydrogen peroxide, heat, cold, and wounding as well as the hormones salicylic acid (SA), jasmonic acid (JA), and ethylene (ET). Importantly, additional analysis suggests that NtWRKY50 overexpression markedly promotes SA levels but prevents pathogen-induced JA production. These data indicate that NtWRKY50 overexpression leads to altered SA and JA content, increased expression of defense-related genes and enhanced plant resistance to R. solanacearum. These probably due to increased activity of endogenous NtWRKY50 gene or could be gain-of-function phenotypes by altering the profile of genes affected by NtWRKY50 .
Directory of Open Access Journals (Sweden)
Yong Zhang
2017-09-01
Full Text Available Hydroxycinnamic acids (HCAs are typical monocyclic phenylpropanoids, including cinnamic acid (Cin, coumaric acid (Cou, caffeic acid (Caf, ferulic acid (FA and their isomers, and involved in the interactions between pathogens and host plants. Here, we focused on the impact of HCAs on expression of type III secretion system (T3SS in Ralstonia solanacearum. FA significantly induced the expression of the T3SS and some type III effectors (T3Es genes in hrp-inducing medium, while did not the other HCAs. However, exogenously supplemented FA did not affect the T3SS expression in planta and the elicitation of the hypersensitive response (HR in tobacco leaves. Consistent with its central roles in pathogenicity, the FA-induced expression of the T3SS led to significant promotion on infection process of R. solanacearum in tomato plants under hydroponics cultivation. Moreover, the FA-induced expression of the T3SS was specifically mediated by the well-characterized signaling cascade PrhA-prhI/R-PrhJ-HrpG-HrpB, independent of the other known regulatory pathways. In summary, our results demonstrated that FA, a novel inducer of the T3SS in R. solanacearum, was able to promote its infection process in host plants under hydroponics condition.
Rezende, Adriana Magali de Freitas Alves
2011-01-01
O tomateiro comum (Solanum lycopersicum L.) é uma olerícola de grande importância econômica e social, se destacando no Brasil, pelas extensas áreas agrícolas cultivadas. O Brasil é o sexto maior produtor de tomate no mundo. No entanto, a murcha bacteriana, causada pela bactéria Ralstonia solanacearum (Smith) Yabuuchi está entre as doenças de maior importância e de difícil controle, não existindo ainda medidas adequadas que possam ser recomendadas. Com objetivo de determinar um controle biológ...
Ahmad, Abdelmonim Ali; Stulberg, Michael J; Huang, Qi
2017-01-01
We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum , indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant), and nine of the prophage's 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant), respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes ( pilT, egl, pehC, hrPB, and phcA ), and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a lysogenic phage and
Ansar Hussain; Xia Li; Yahong Weng; Zhiqin Liu; Muhammad Furqan Ashraf; Ali Noman; Sheng Yang; Muhammad Ifnan; Shanshan Qiu; Yingjie Yang; Deyi Guan; Shuilin He
2018-01-01
The WRKY web, which is comprised of a subset of WRKY transcription factors (TFs), plays a crucial role in the regulation of plant immunity, however, the mode of organization and operation of this network remains obscure, especially in non-model plants such as pepper (Capsicum annuum). Herein, CaWRKY22, a member of a subgroup of IIe WRKY proteins from pepper, was functionally characterized in pepper immunity against Ralstonia Solanacearum. CaWRKY22 was found to target the nuclei, and its trans...
Xue, Qing-Yun; Yin, Yan-Ni; Yang, Wei; Heuer, Holger; Prior, Philippe; Guo, Jian-Hua; Smalla, Kornelia
2011-03-01
Bacterial wilt caused by Ralstonia solanacearum is a serious threat to crop production in China. A collection of 319 R. solanacearum strains isolated from 14 different diseased host plants collected in 15 Chinese provinces was investigated by BOX fingerprints in order to test the influence of the site and the host plant on their genetic diversity. Phylotype, fliC-RFLP patterns and biovar were determined for all strains and the sequevar for 39 representative strains. The majority of strains belonged to the Asian phylotype I, shared identical fliC-RFLP patterns and were assigned to four biovars (bv3:123; bv4:162; bv5:3; and bv6:11). Twenty strains were phylotype II, assigned to biovar 2, and had distinct fliC-RFLP patterns. BOX-PCR fingerprints generated from the genomic DNA of each strain revealed a high diversity of the phylotype I strains, where 28 types of BOX fingerprints could be distinguished. While many BOX clusters comprised isolates from different provinces and several host plants, some groups contained isolates that were plant or site specific. All phylotype II isolates originating from 10 provinces belonged to sequevar 1 and displayed identical BOX patterns as the potato brown rot strains from various regions of the world. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Fahime Safdarpour
2017-12-01
Full Text Available Introduction: Phytopathogenic microorganisms affect plant health and burden a major threat to food production and ecosystem stability. Increasing the use of chemical pesticides for plant diseases control causes several negative effects on human and environment health. Furthermore, increasing public awareness about the side effects of them led to a research to find alternatives for these products. One of the alternative methods is bio-control utilizing plant associated antagonistic microorganisms. Materials and methods: In this study, 80 endophytic bacteria were isolated from tomato tissues. Their antagonistic activity screened based on agar diffusion test, against tomato bacterial wilt disease (Ralstonia solanacearum. They were identified based on the morphological, biochemical properties and 16s rRNA sequence analyses. These strains were evaluated in greenhouse and tested for their ability to induce the production of defense-related enzymes in plants e.g. Peroxidase (PO, polyphenoloxidase (PPO and phenolics based on spectrophotometer method. Results: Results showed FS67, FS167 and FS184 strains had maximum inhibition zone forming. They identified as Pseudomonas mossellii, P. fuorescence and P. brassicacearum respectively. FS67 and FS167 strains significantly reduced disease in greenhouse. There was a significant increase in the activity of PO, PPO and phenolics in tomato plants treated with FS67, FS167 and pathogen. Discussion and conclusion: The present study has shown that P. mosselli and P. fuorescence might have the potential to control R. solanacearum. However, the good results obtained in vitro cannot be gained the same as those in greenhouse or field conditions. So, further experiments are needed to determine the effectiveness of these isolates under field conditions.This work support the view that increased defense enzymes activities could be involved, at least in part, in the beneficial effects of endophytic bacteria on plants growth
Directory of Open Access Journals (Sweden)
Abdelmonim Ali Ahmad
2017-12-01
Full Text Available We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum, indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant, and nine of the prophage’s 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant, respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes (pilT, egl, pehC, hrPB, and phcA, and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a
Ahmad, Abdelmonim Ali; Stulberg, Michael J.; Huang, Qi
2017-01-01
We previously characterized a filamentous lysogenic bacteriophage, ϕRs551, isolated directly from the race 3 biovar 2 phylotype IIB sequevar 1 strain UW551 of Ralstonia solanacearum grown under normal culture conditions. The genome of ϕRs551 was identified with 100% identity in the deposited genomes of 11 race 3 biovar 2 phylotype IIB sequevar 1 strains of R. solanacearum, indicating evolutionary and biological importance, and ORF14 of ϕRs551 was annotated as a putative type-2 repressor. In this study, we determined the effect of the prophage and its ORF14 on the virulence and competitive fitness of its carrier strain UW551 by deleting the orf14 gene only (the UW551 orf14 mutant), and nine of the prophage’s 14 genes including orf14 and six out of seven structural genes (the UW551 prophage mutant), respectively, from the genome of UW551. The two mutants were increased in extracellular polysaccharide production, twitching motility, expression of targeted virulence and virulence regulatory genes (pilT, egl, pehC, hrPB, and phcA), and virulence, suggesting that the virulence of UW551 was negatively regulated by ϕRs551, at least partially through ORF14. Interestingly, we found that the wt ϕRs551-carrying strain UW551 of R. solanacearum significantly outcompeted the wt strain RUN302 which lacks the prophage in tomato plants co-inoculated with the two strains. When each of the two mutant strains was co-inoculated with RUN302, however, the mutants were significantly out-competed by RUN302 for the same colonization site. Our results suggest that ecologically, ϕRs551 may play an important role by regulating the virulence of and offering a competitive fitness advantage to its carrier bacterial strain for persistence of the bacterium in the environment, which in turn prolongs the symbiotic relationship between the phage ϕRs551 and the R. solanacearum strain UW551. Our study is the first toward a better understanding of the co-existence between a lysogenic phage and
Genetic mapping of a major dominant gene for resistance to Ralstonia solanacearum in eggplant.
Lebeau, A; Gouy, M; Daunay, M C; Wicker, E; Chiroleu, F; Prior, P; Frary, A; Dintinger, J
2013-01-01
Resistance of eggplant against Ralstonia solanacearum phylotype I strains was assessed in a F(6) population of recombinant inbred lines (RILs) derived from a intra-specific cross between S. melongena MM738 (susceptible) and AG91-25 (resistant). Resistance traits were determined as disease score, percentage of wilted plants, and stem-based bacterial colonization index, as assessed in greenhouse experiments conducted in Réunion Island, France. The AG91-25 resistance was highly efficient toward strains CMR134, PSS366 and GMI1000, but only partial toward the highly virulent strain PSS4. The partial resistance found against PSS4 was overcome under high inoculation pressure, with heritability estimates from 0.28 to 0.53, depending on the traits and season. A genetic map was built with 119 AFLP, SSR and SRAP markers positioned on 18 linkage groups (LG), for a total length of 884 cM, and used for quantitative trait loci (QTL) analysis. A major dominant gene, named ERs1, controlled the resistance to strains CMR134, PSS366, and GMI1000. Against strain PSS4, this gene was not detected, but a significant QTL involved in delay of disease progress was detected on another LG. The possible use of the major resistance gene ERs1 in marker-assisted selection and the prospects offered for academic studies of a possible gene for gene system controlling resistance to bacterial wilt in solanaceous plants are discussed.
Directory of Open Access Journals (Sweden)
Wuryandari Yenny
2016-01-01
Full Text Available Chili (Capsicum annuum L. is one of the vegetable commodities with high economic value. Until now, the necessity rate of chili is still high but the production is still low. One of the obstacles, which highly influence chili production, is wilt disease due to Ralstonia solanacearum and Fusarium oxysporum. This study aims at identifying the best fluorescent pseudomonads isolate in suppressing the development of the primary wilt disease due to Ralstonia solanacearum and F. oxysprorum in the field. This study employs Completely Randomized Design that comprises 3 treatments. The three treatments are the type of fluorescent pseudomonads which is Pf-122 isolate, Pf-160 isolate, and Pf-B isolate. The observation parameter on suppressing the disease development is perceived from incubation period of the initial appearance of symptoms, disease index and the change of stem tissue color. The result of the study shows that the longest incubation period is treatment with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate. The chili is treated with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate, the initial appearance of symptoms at the 8th day after inoculation. In the treatment with fluorescent pseudomonads of Pf-122 isolate and Pf-160 isolate compared to control, is able to delay the appearance of symptom for 3 days. The disease development starts from 10th to 30th day, the treatment with Pf-122 isolate shows the slowest development compared to other treatment and control. In the last observation, the disease index with treatment of Pf-122 isolate is the lowest which is 37%, then it is followed by Pf-B and Pf-160 which are 39% and 40% respectively, whereas in the control it reaches 67%. For the color change on stem tissue, there is no real difference of the three treatments of fluorescent pseudomonads application but it differs and smaller from the control.
Poussier, Stéphane; Thoquet, Philippe; Trigalet-Demery, Danièle; Barthet, Séverine; Meyer, Damien; Arlat, Matthieu; Trigalet, André
2003-08-01
Ralstonia solanacearum is a plant pathogenic bacterium that undergoes a spontaneous phenotypic conversion (PC) from a wild-type pathogenic to a non-pathogenic form. PC is often associated with mutations in phcA, which is a key virulence regulatory gene. Until now, reversion to the wild-type pathogenic form has not been observed for PC variants and the biological significance of PC has been questioned. In this study, we characterized various alterations in phcA (eight IS element insertions, three tandem duplications, seven deletions and a base substitution) in 19 PC mutants from the model strain GMI1000. In five of these variants, reversion to the pathogenic form was observed in planta, while no reversion was ever noticed in vitro whatever culture media used. However, reversion was observed for a 64 bp tandem duplication in vitro in the presence of tomato root exudate. This is the first report showing a complete cycle of phenotypic conversion/reversion in a plant pathogenic bacterium.
1999-01-01
Kahili ginger (Hedychium gardnerianum) is an invasive weed in tropical forests in Hawaii and elsewhere. Bacterial wilt caused by the ginger strain of Ralstonia(=Pseudomonas) solanacearum systemically infects edible ginger (Zingiber officinale) and ornamental gingers (Hedychium spp.), causing wilt in infected plants. The suitability of R. solanacearum as a biological control agent for kahili ginger was investigated by inoculating seedlings and rooted cuttings of native forest plants, ornamental ginger, and solanaceous species to confirm host specificity. Inoculation via stem injection or root wounding with a bacterial–water suspension was followed by observation for 8 weeks. Inoculations on H. gardnerianum were then carried out in ohia-lehua (Metrosideros polymorpha) wet forests of Hawaii Volcanoes National Park to determine the bacterium's efficacy in the field. No native forest or solanaceous species developed wilt or other symptoms during the study. The bacterium caused limited infection near the inoculation site on H. coronarium, Z. zerumbet, Heliconia latispatha, and Musa sapientum. However, infection did not become systemic in any of these species, and normal growth resumed following appearance of initial symptoms. All inoculated H. gardnerianum plants developed irreversible chlorosis and severe wilting 3–4 weeks following inoculation. Systemic infection also caused death and decay of rhizomes. Most plants were completely dead 16–20 weeks following inoculation. The destructiveness of the ginger strain of R. solanacearum to edible ginger has raised questions regarding its use for biological control. However, because locations of kahili ginger infestations are often remote, the risk of contaminating edible ginger plantings is unlikely. The ability of this bacterium to cause severe disease in H. gardnerianum in the field, together with its lack of virulence in other ginger species, contributes to its potential as a biological control agent.
Directory of Open Access Journals (Sweden)
Ram Devi Timila
2016-12-01
Full Text Available Bacterial wilt caused by Ralstonia solanacearum E.F. Smith is one of the destructive diseases of solanaceous vegetables specially tomato (Lycopersicon esculentum L. and eggplant (Solanum melongena L.. Experiments were conducted to determine biovar types existing among the strains or isolates of Nepal and variation in virulence in some vegetables belonging to solanaceae family. A total of 39 isolates infecting tomato, eggplant, chilli and potato collected from different parts of Nepal were analyzed for biovar types on the basis of 3 disaccharides and 3 hexose alcohols oxidation test. Experiments were conducted to determine variation in virulence or aggressiveness of some of the isolates under screen house conditions using three host differentials such as Pusa Ruby (susceptible, Bishesh (moderately resistant and Srijana (resistant tomato cultivars. Of the 39 isolates, 23 were biovar III, three biovar II, three biovar IV, and one was biovar I. Nine isolates could not be differentiated into any of the five biovars. For breeding and epidemiological purposes it is very important to analyze the variability of aggressiveness. A total of 5 isolates collected from different places were included in the test. Isolates from Bhaktapur was found the most virulent causing wilt in the variety Bishesh (moderately resistant. Other isolates had the negative impact with zero wilt on the differentials used. Isolates from Jungekhola of Dhading district did not induce wilt even on susceptible variety (Pusa Ruby, but exhibited only senescence reaction. The result indicated that there is some slight variation among the isolates tested. Some effective management tactics might be needed in those locations where highly aggressive or virulent strain of bacterial wilt is prevalent, because resistant variety may not be stable in such locations.
Directory of Open Access Journals (Sweden)
Shili Li
2016-06-01
Full Text Available Protocatechualdehyde (PCA is an important plant-derived natural product that has been associated with a wide variety of biological activities and has been widely used in medicine as an antioxidant, anti-aging and an anti-inflammatory agent. However, fewer reports concerning its antibacterial effects on plant-pathogenic bacteria exist. Therefore, in this study, protocatechualdehyde was evaluated for its antibacterial activity against plant pathogens along with the mechanism of its antibacterial action. PCA at 40 μg/mL was highly active against R. solanacearum and significantly inhibited its growth. The minimum bactericidal concentration and minimum inhibitory concentration values for PCA were 40 μg/mL and 20 μg/mL, respectively. Further investigation of the mechanism of action of PCA via transmission electron microscopy and biological assays indicated that the destruction of the cell structure, the shapes and the inhibition of biofilm formation were important. In addition, the application of PCA effectively reduced the incidence of bacterial wilt on tobacco under greenhouse conditions, and the control efficiency was as high as 92.01% at nine days after inoculation. Taken together, these findings suggest that PCA exhibits strong antibacterial activity against R. solanacearum and has the potential to be applied as an effective antibacterial agent for controlling bacterial wilt caused by R. solanacearum.
Liu, Lijuan; Sun, Chengliang; Liu, Xingxing; He, Xiaolin; Liu, Miao; Wu, Hao; Tang, Caixian; Jin, Chongwei; Zhang, Yongsong
2016-01-01
The inorganic nitrogenous amendments calcium cyanamide (CC), ammonia water (AW), and a mixture of ammonium bicarbonate with lime (A+L) are popularly used as fumigants to control soil-borne disease in China. However, it is unclear which of these fumigants is more effective in controlling R. solanacearum. This present study compared the efficiencies of the three nitrogenous amendments listed above at four nitrogen levels in suppressing the survival of R. solanacearum in soil. The CC showed the best ability to suppress R. solanacearum due to its highest capacity to increase soil and NO2− contents and pH. However, AW was more suitable to controlling bacterial wilt caused by R. solanacearum because it had a lower cost and its application rate of 0.25 g N kg−1 soil could effectively suppress the survival of R. solanacearum. Additionally, soil microbial activity and community populations were restored to their initial state four weeks after the application of each fumigant, indicating that the three fumigants had few detrimental impacts on soil microbial activity and community structure with an exception of the suppression of R. solanacearum. The present study provides guidance for the selection of a suitable alkaline nitrogenous amendment and its application rate in controlling bacterial wilt. PMID:26738601
Liu, Lijuan; Sun, Chengliang; Liu, Xingxing; He, Xiaolin; Liu, Miao; Wu, Hao; Tang, Caixian; Jin, Chongwei; Zhang, Yongsong
2016-01-01
The inorganic nitrogenous amendments calcium cyanamide (CC), ammonia water (AW), and a mixture of ammonium bicarbonate with lime (A+L) are popularly used as fumigants to control soil-borne disease in China. However, it is unclear which of these fumigants is more effective in controlling R. solanacearum. This present study compared the efficiencies of the three nitrogenous amendments listed above at four nitrogen levels in suppressing the survival of R. solanacearum in soil. The CC showed the best ability to suppress R. solanacearum due to its highest capacity to increase soil and NO2- contents and pH. However, AW was more suitable to controlling bacterial wilt caused by R. solanacearum because it had a lower cost and its application rate of 0.25 g N kg-1 soil could effectively suppress the survival of R. solanacearum. Additionally, soil microbial activity and community populations were restored to their initial state four weeks after the application of each fumigant, indicating that the three fumigants had few detrimental impacts on soil microbial activity and community structure with an exception of the suppression of R. solanacearum. The present study provides guidance for the selection of a suitable alkaline nitrogenous amendment and its application rate in controlling bacterial wilt.
A duplex PCR assay for the detection of Ralstonia solanacearum phylotype II strains in Musa spp.
Directory of Open Access Journals (Sweden)
Gilles Cellier
Full Text Available Banana wilt outbreaks that are attributable to Moko disease-causing strains of the pathogen Ralstonia solanacearum (Rs remain a social and economic burden for both multinational corporations and subsistence farmers. All known Moko strains belong to the phylotype II lineage, which has been previously recognized for its broad genetic basis. Moko strains are paraphyletic and are distributed among seven related but distinct phylogenetic clusters (sequevars that are potentially major threats to Musaceae, Solanaceae, and ornamental crops in many countries. Although clustered within the Moko IIB-4 sequevar, strains of the epidemiologically variant IIB-4NPB do not cause wilt on Cavendish or plantain bananas; instead, they establish a latent infection in the vascular tissues of plantains and demonstrate an expanded host range and high aggressiveness toward Solanaceae and Cucurbitaceae. Although most molecular diagnostic methods focus on strains that wilt Solanaceae (particularly potato, no relevant protocol has been described that universally detects strains of the Musaceae-infecting Rs phylotype II. Thus, a duplex PCR assay targeting Moko and IIB-4NPB variant strains was developed, and its performance was assessed using an extensive collection of 111 strains representing the known diversity of Rs Moko-related strains and IIB-4NPB variant strains along with certain related strains and families. The proposed diagnostic protocol demonstrated both high accuracy (inclusivity and exclusivity and high repeatability, detected targets on either pure culture or spiked plant extracts. Although they did not belong to the Moko clusters described at the time of the study, recently discovered banana-infecting strains from Brazil were also detected. According to our comprehensive evaluation, this duplex PCR assay appears suitable for both research and diagnostic laboratories and provides reliable detection of phylotype II Rs strains that infect Musaceae.
NCBI nr-aa BLAST: CBRC-ACAR-01-1107 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1107 ref|NP_519445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solana...cearum GMI1000] emb|CAD15026.1| probable lipid a biosynthesis transmembrane protein [Ralstonia solanacearum] NP_519445.1 6.1 29% ...
NCBI nr-aa BLAST: CBRC-SCER-15-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SCER-15-0000 ref|NP_520947.1| PROBABLE FIMBRIAL ASSEMBLY TRANSMEMBRANE PROTEIN... [Ralstonia solanacearum GMI1000] emb|CAD16533.1| probable fimbrial assembly transmembrane protein [Ralstonia solanacearum] NP_520947.1 1.3 24% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0649 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0649 ref|NP_521460.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17129.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521460.1 1e-133 79% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0657 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0657 ref|NP_521459.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17128.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521459.1 6e-91 75% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0098 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0098 ref|NP_522097.1| PROBABLE SUGAR-PROTON SYMPORTER TRANSMEMBRANE PR...OTEIN [Ralstonia solanacearum GMI1000] emb|CAD17687.1| probable sugar-proton symporter transmembrane protein [Ralstonia solanacearum] NP_522097.1 0.38 30% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-2796 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2796 ref|NP_521847.1| PUTATIVE HEMIN-BINDING OUTER MEMBRANE TRANSMEMBR...ANE PROTEIN [Ralstonia solanacearum GMI1000] emb|CAD17437.1| putative hemin-binding outer membrane transmembrane protein [Ralstonia solanacearum] NP_521847.1 0.003 33% ...
Characterization and DNA-binding specificities of Ralstonia TAL-like effectors
Li, Lixin
2013-07-01
Transcription activator-like effectors (TALEs) from Xanthomonas sp. have been used as customizable DNA-binding modules for genome-engineering applications. Ralstonia solanacearum TALE-like proteins (RTLs) exhibit similar structural features to TALEs, including a central DNA-binding domain composed of 35 amino acid-long repeats. Here, we characterize the RTLs and show that they localize in the plant cell nucleus, mediate DNA binding, and might function as transcriptional activators. RTLs have a unique DNA-binding architecture and are enriched in repeat variable di-residues (RVDs), which determine repeat DNA-binding specificities. We determined the DNA-binding specificities for the RVD sequences ND, HN, NP, and NT. The RVD ND mediates highly specific interactions with C nucleotide, HN interacts specifically with A and G nucleotides, and NP binds to C, A, and G nucleotides. Moreover, we developed a highly efficient repeat assembly approach for engineering RTL effectors. Taken together, our data demonstrate that RTLs are unique DNA-targeting modules that are excellent alternatives to be tailored to bind to user-selected DNA sequences for targeted genomic and epigenomic modifications. These findings will facilitate research concerning RTL molecular biology and RTL roles in the pathogenicity of Ralstonia spp. © 2013 The Author.
Directory of Open Access Journals (Sweden)
Pierre Lefeuvre
Full Text Available Because it is suspected that gene content may partly explain host adaptation and ecology of pathogenic bacteria, it is important to study factors affecting genome composition and its evolution. While recent genomic advances have revealed extremely large pan-genomes for some bacterial species, it remains difficult to predict to what extent gene pool is accessible within or transferable between populations. As genomes bear imprints of the history of the organisms, gene distribution pattern analyses should provide insights into the forces and factors at play in the shaping and maintaining of bacterial genomes. In this study, we revisited the data obtained from a previous CGH microarrays analysis in order to assess the genomic plasticity of the R. solanacearum species complex. Gene distribution analyses demonstrated the remarkably dispersed genome of R. solanacearum with more than half of the genes being accessory. From the reconstruction of the ancestral genomes compositions, we were able to infer the number of gene gain and loss events along the phylogeny. Analyses of gene movement patterns reveal that factors associated with gene function, genomic localization and ecology delineate gene flow patterns. While the chromosome displayed lower rates of movement, the megaplasmid was clearly associated with hot-spots of gene gain and loss. Gene function was also confirmed to be an essential factor in gene gain and loss dynamics with significant differences in movement patterns between different COG categories. Finally, analyses of gene distribution highlighted possible highways of horizontal gene transfer. Due to sampling and design bias, we can only speculate on factors at play in this gene movement dynamic. Further studies examining precise conditions that favor gene transfer would provide invaluable insights in the fate of bacteria, species delineation and the emergence of successful pathogens.
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID
PRODUCCIÓN DE POLI-β -HIDROXIBUTIRATO (PHB β POR Ralstonia eutropha ATCC 17697
Directory of Open Access Journals (Sweden)
Barbosa Marcela
2005-06-01
Full Text Available Ralstonia eutropha es la bacteria más utilizada en la producción de poli-β-hidroxibutirato (PHB por su capacidad de acumular polímero hasta en un 80% de su peso seco. En el presente trabajo se realizaron fermentaciones por lote alimentado en dos etapas a escala 3 litros usando tres concentraciones de fructosa (5, 10 y 15 g/l. En la primera etapa, manteniendo constante la relación carbono-nitrógeno en 6.85 g C/g N, se buscó obtener una alta concentración celular; en la segunda etapa las células obtenidas se limitaron en la fuente de nitrógeno para permitir la acumulación del biopolímero. La mejor concentración para producir el material es 5 g/l en la cual se obtuvo un porcentaje de acumulación del 66.2%, una velocidad de crecimiento específico inicial de 0.5171 h-1 y una productividad de 0.1245 g PHB/ l h.
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Ralstonia solanacearum] ... Length = 97 ... Query: 16 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICE...NALAKLDKAPLYVT 75 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICENA...LAKLDKAPLYVT Sbjct: 1 ... EIDSWDLYIALQNGENLVVVDGRSAEAFEREHIPGAINIPHRTICENALAKLDKAPLYVT 60 ...
Identification of virulence factors and type III effectors of Phylotype I ...
Indian Academy of Sciences (India)
HP2000
R. solanacearum finds its way into the plant through wounds in the roots and .... 10% (c) Acidic residues should be absent within the first twelve amino acids. .... PilA has been used to study the genetic diversity in soil bacterium ..... the GALA type III effector family contributes to Ralstonia solanacearum adaptation on different.
Directory of Open Access Journals (Sweden)
Yang Lu
2016-01-01
Full Text Available Bacterial wilt is a serious soilborne disease of Solanaceae crops which is caused by Ralstonia solanacearum. The important role of biochar in enhancing disease resistance in plants has been verified; however, the underlying mechanism remains not fully understood. In this study, two different biochars, made from peanut shell (BC1 and wheat straw (BC2, were added to Ralstonia solanacearum-infected soil to explore the interrelation among biochar, tomato bacterial wilt, and soil microbial properties. The results showed that both BC1 and BC2 treatments significantly reduced the disease index of bacterial wilt by 28.6% and 65.7%, respectively. The populations of R. solanacearum in soil were also significantly decreased by biochar application. Ralstonia solanacearum infection significantly reduced the densities of soil bacteria and actinomycetes and increased the ratio of soil fungi/bacteria in the soil. By contrast, BC1 and BC2 addition to pathogen-infected soil significantly increased the densities of soil bacteria and actinomycetes but decreased the density of fungi and the ratios of soil fungi/bacteria and fungi/actinomycetes. Biochar treatments also increased soil neutral phosphatase and urease activity. Furthermore, higher metabolic capabilities of microorganisms by biochar application were found at 96 and 144 h in Biolog EcoPlates. These results suggest that both peanut and wheat biochar amendments were effective in inhibiting tomato bacterial wilt caused by R. solanacearum. The results suggest a relationship between the disease resistance of the plants and the changes in soil microbial population densities and activity.
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ERASE ... PROTEIN [Ralstonia solanacearum GMI1000] ... Length = 202 ... Query: 2 ... PDSTLTLISHPLCP...FVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR 61 ... PDSTLTLISHPLCPFVQRAA...IVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR Sbjct: 1 ... PDSTLTLISHPLCPFVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLL
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TEIN ... [Ralstonia solanacearum GMI1000] ... Length = 101 ... Query: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR Sbjct: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANTGDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ...
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h = 142 ... Query: 321 PQETCSLFFVEAIQSARKRLWITTPYFIPDEXXXXXXXXXXXXXXXXXILIPARPDHRVV 380 ... PQETCS...LFFVEAIQSARKRLWITTPYFIPDE ... ILIPARPDHRVV Sbjct: 1 ... PQETCSLFFVEAIQSARKRL... ... CARDIOLIPIN SYNTHETASE TRANSMEMBRANE PROTEIN [Ralstonia ... solanacearum] ... Lengt
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Ralstonia solanacearum] ... Length = 154 ... Query: 2 ... VQIRPFRSGDELALHAVFYSXXXXXXXXXXXXXXXXXXXPADHD...TAQWAERMRRIQPFVA 61 ... VQIRPFRSGDELALHAVFYS ... PADHD...TAQWAERMRRIQPFVA Sbjct: 1 ... VQIRPFRSGDELALHAVFYSAVHQLAAAHYTAAQLAAWAPADHDTAQWAERMRRIQPFVA 60 ... Query: 122 E
Aldenir de Oliveira Alves
2012-01-01
A murcha bacteriana do pimentão, causada por Ralstonia solanacearum (Rs) raça 1, é uma fitobacteriose importante em Pernambuco e outros estados do Brasil. Este trabalho teve como objetivos testar o efeito de óleos vegetais e do silício (Si) no controle alternativo desta doença, seus efeitos diretos sobre Rs e verificar os possíveis mecanismos envolvidos nestes processos. Os óleos essenciais de bergamota, canela, capim limão, copaíba, eucalipto citriodora, eucalipto globulus, funcho, hortel...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ECTION DURING STARVATION OR OXYDATIVE STRESS ... TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacea...rum] ... ref|NP_520808.1| PUTATIVE DNA PROTECTION DURING ... STARVATION OR OXYDATIVE STRESS TR
Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture
?lvarez, Bel?n; Biosca, Elena G.
2017-01-01
Bacterial wilt diseases caused by Ralstonia solanacearum, R. pseudosolanacearum, and R. syzygii subsp. indonesiensis (former R. solanacearum species complex) are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the a...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...
NCBI nr-aa BLAST: CBRC-LAFR-01-2095 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-2095 ref|NP_519386.1| PROBABLE SN-GLYCEROL-3-PHOSPHATE TRANSMEMBRANE A...BC TRANSPORTER PROTEIN [Ralstonia solanacearum GMI1000] emb|CAD14967.1| probable sn-glycerol-3-phosphate transme
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA
Lifescience Database Archive (English)
Full Text Available |pid:none) Cupriavidus taiwanensis str. LM... 34 4.1 AE015928_2526( AE015928 |pid:none) Bacteroides thetaiot...168 |pid:none) Ralstonia solanacearum strain I... 35 3.1 CU633749_1834( CU633749
ORF Alignment: NC_003296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA
Water relations of Pseudomonas solanacearum
African Journals Online (AJOL)
GREGORY
2010-08-30
Aug 30, 2010 ... pathogens of plants, especially, Erwinia chrysanthemi. (Mildenhall et al., 1988; Prior et al., 1994; Gouesbet et al., 1995; Gouesbet et al., 1996). This helps to determine how they survive in dry soil for long periods as saprophytes. Experiments undertaken here on P. solanacearum give a glimpse of what may ...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS
Guinard, Jérémy; Latreille, Anne; Guérin, Fabien; Poussier, Stéphane
2016-01-01
ABSTRACT Bacterial wilt caused by the Ralstonia solanacearum species complex (RSSC) is considered one of the most harmful plant diseases in the world. Special attention should be paid to R. pseudosolanacearum phylotype I due to its large host range, its worldwide distribution, and its high evolutionary potential. So far, the molecular epidemiology and population genetics of this bacterium are poorly understood. Until now, the genetic structure of the RSSC has been analyzed on the worldwide and regional scales. Emerging questions regarding evolutionary forces in RSSC adaptation to hosts now require genetic markers that are able to monitor RSSC field populations. In this study, we aimed to evaluate the multilocus variable-number tandem-repeat analysis (MLVA) approach for its ability to discriminate genetically close phylotype I strains and for population genetics studies. We developed a new MLVA scheme (MLVA-7) allowing us to genotype 580 R. pseudosolanacearum phylotype I strains extracted from susceptible and resistant hosts and from different habitats (stem, soil, and rhizosphere). Based on specificity, polymorphism, and the amplification success rate, we selected seven fast-evolving variable-number tandem-repeat (VNTR) markers. The newly developed MLVA-7 scheme showed higher discriminatory power than the previously published MLVA-13 scheme when applied to collections sampled from the same location on different dates and to collections from different locations on very small scales. Our study provides a valuable tool for fine-scale monitoring and microevolution-related study of R. pseudosolanacearum phylotype I populations. IMPORTANCE Understanding the evolutionary dynamics of adaptation of plant pathogens to new hosts or ecological niches has become a key point for the development of innovative disease management strategies, including durable resistance. Whereas the molecular mechanisms underlying virulence or pathogenicity changes have been studied thoroughly, the
Biological and biochemical studies on irradiated potato tubers
International Nuclear Information System (INIS)
Salem, E.A.F.M
2008-01-01
The present investigation aimed to study and overcome two important diseases which attacks potato plant, using some chemical and physical treatments. The first disease was pre harvest brown rot caused by ralstonia solanacearum and the second was post harvest dry rot caused by fusarium oxysporum. The results are summarized as follows: firstly brown rot : 1- Foliar treatment of salicylic acid or calcium chloride on potato plants leads to increasing in plant height and number of potato tubers, since salicylic acid give the highest value of plant height and also calcium chloride give the highest number of potato tubers. Also, this treatment leads to insignificant decreasing in number of potato tubers infected by brown rot. 2- The bacteria ralstonia solanacearum isolated from infected tubers obtained from the project of brown rot, Ministry of agriculture, Egypt, added with irrigate water to the pots this bacteria could infect healthy potato plant and the symptoms of brown rot observed on tubers also pathogenicity test was carried out using seedling of tomato cultivar Gs plants and wilting of tomato plant observed after 10-15 days from injection with R.solanacearum. 3- Concerning D 10 -value determined from the relation between dose rate of gamma ray (k-rad) and log count of bacterial number it was found that the D 10 -value for R.solanacearum was 0.25 kGy
Kozdroj, J; Trevors, JT; van Elsas, JD
Two species of Pseudomonas chromosomally tagged with gfp, which had shown antagonistic activity against the tomato pathogen Ralstonia solanacearum in a previous study, were assessed for their impact in the rhizosphere of maize. Plant growth characteristics, numbers of indigenous heterotrophic
Evaluation of edible ginger and turmeric cultivars for root-knot nematode resistance
Edible ginger and turmeric roots are important agricultural commodities for the State of Hawaii. Bacterial wilt, Ralstonia solanacearum, and root-knot nematodes, Meloidogyne spp. are major factors hindering optimum production. An evaluation of tolerance and resistance to M. incognita was undertake...
Antagonistic activity of Bacillus subtilis SB1 and its biocontrol effect on tomato bacterial wilt
A potential biocontrol agent of bacterial wilt, Bacillus subtilis SB1, isolated from tomato roots, showed a broad-spectrum of antimicrobial activity in in vitro experiments. It inhibited the growth of many plant pathogens, including Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, Fusarium ox...
Assessment of transformability of bacteria associated with tomato and potato plants
Overbeek, van L.S.; Ray, J.L.; Elsas, van J.D.
2007-01-01
Transformation of plant-associated bacteria by plant DNA has never been demonstrated in agricultural fields. In total 552 bacterial isolates from stems of Ralstonia solanacearum-infected and healthy tomato plants and from stems and leaves of healthy potato plants were tested for natural genetic
Nigerian Journal of Biotechnology - Vol 29 (2015)
African Journals Online (AJOL)
Isolation and Characterization of Ralstonia solanacearum Causing Bacterial Wilt of Tomato in Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AR Popoola, SA Ganiyu, OA Enikuomehin, JG Bodunde, OB Adedibu, HA Durosomo, OA Karunwi, 1 – 10.
(SRAP) markers linked to bacterial wilt resistance genes i
African Journals Online (AJOL)
SAM
2014-03-19
Mar 19, 2014 ... Bacterial wilt caused by Ralstonia solanacearum is one of the most economically important diseases affecting potato (Solanum tuberosum). It is necessary to develop more molecular markers for potential use in potato genetic research. A highly resistant primitive cultivated species Solanum phureja was.
Janse, J.D.; Bergsma-Vlami, M.M.; Wenneker, M.
2009-01-01
De quarantaineziekte bruinrot van aardappel, veroorzaakt door de bacterie Ralstonia (voorheen : Pseudomonas solanacearum) werd in Nederland voor het eerst met zekerheid aangetroffen in 1992. Het betrof een geïsoleerd geval in Zuid-Limburg, dat later verbonden bleek te zijn met een eerder opgetreden
A new mulberry wilt disease (MWD) was recently identified in Hangzhou, Zhejiang province, China. Typical symptoms of the disease are dark brown discolorations in vascular tissues, leaf wilt, defoliation, and tree decline. Unlike the bacterial wilt disease caused by Ralstonia solanacearum, the leaf w...
Conserved Responses in a War of Small Molecules between a Plant-Pathogenic Bacterium and Fungi.
Spraker, Joseph E; Wiemann, Philipp; Baccile, Joshua A; Venkatesh, Nandhitha; Schumacher, Julia; Schroeder, Frank C; Sanchez, Laura M; Keller, Nancy P
2018-05-22
Small-molecule signaling is one major mode of communication within the polymicrobial consortium of soil and rhizosphere. While microbial secondary metabolite (SM) production and responses of individual species have been studied extensively, little is known about potentially conserved roles of SM signals in multilayered symbiotic or antagonistic relationships. Here, we characterize the SM-mediated interaction between the plant-pathogenic bacterium Ralstonia solanacearum and the two plant-pathogenic fungi Fusarium fujikuroi and Botrytis cinerea We show that cellular differentiation and SM biosynthesis in F. fujikuroi are induced by the bacterially produced lipopeptide ralsolamycin (synonym ralstonin A). In particular, fungal bikaverin production is induced and preferentially accumulates in fungal survival spores (chlamydospores) only when exposed to supernatants of ralsolamycin-producing strains of R. solanacearum Although inactivation of bikaverin biosynthesis moderately increases chlamydospore invasion by R. solanacearum , we show that other metabolites such as beauvericin are also induced by ralsolamycin and contribute to suppression of R. solanacearum growth in vitro Based on our findings that bikaverin antagonizes R. solanacearum and that ralsolamycin induces bikaverin biosynthesis in F. fujikuroi , we asked whether other bikaverin-producing fungi show similar responses to ralsolamycin. Examining a strain of B. cinerea that horizontally acquired the bikaverin gene cluster from Fusarium , we found that ralsolamycin induced bikaverin biosynthesis in this fungus. Our results suggest that conservation of microbial SM responses across distantly related fungi may arise from horizontal transfer of protective gene clusters that are activated by conserved regulatory cues, e.g., a bacterial lipopeptide, providing consistent fitness advantages in dynamic polymicrobial networks. IMPORTANCE Bacteria and fungi are ubiquitous neighbors in many environments, including
Mahbou-Somo-Toukam , Gabriel
2010-01-01
The knowledge of genetic diversity of R. solanacearum as well as the knowledge of genetic determinism of pepper resistance are critical for elaborating a strategy against this ubiquist bacterium. They will facilitate the choice and direction of fighting methods and the development of well adapted tools for quarantine measures. In a modern approach of genetics more and more based on plant models, Solanaceaes occupy a place of pioneer. On another hand the emerging breakdown of resistances seems...
Directory of Open Access Journals (Sweden)
Francisco Ferraz Laranjeira
2012-05-01
Full Text Available Tomato plants are susceptible to bacterial wilting, which causes production losses varying from 10 to 100 %. A method for controlling this disease is the use of grafting on resistant rootstocks. This work had the objective of evaluating tomato genotypes for the resistance to Ralstonia solanacearum and the grafting technique as an alternative for the bacterial wilt control in the region of Recôncavo Baiano, Brazil. To evaluate the resistance to R. solanacearum, four local genotypes, collected in different regions of Bahia, the cv. Santa Clara as a susceptible treatment, and the Hawaii 7996 (H7996, as a resistant treatment were studied. For the evaluation of grafting method for control of bacterial wilt, the H7996 was used as rootstock, and the cvs. Santa Clara, Santa Cruz Kada, and Débora Plus were used as the scion plants. Both experiments were evaluated in an area infested with R. solanacearum, for a period of 65 days for the selection of the rootstocks and 45 days for the evaluation of the grafting method. Only the H7996 can be recommended as a R. solanacearum resistant rootstock. The other genotypes showed susceptibility to the pathogen. The grafting on the H7996 did not show incompatibility with the scion tomato cultivars tested and reached 100 % control of the bacterial wilt disease, for all treatments, suggesting that this method can be used as an alternative for the bacterial wilt control, allowing the production of susceptible tomato cultivars in areas infested with R. solanacearum A suscetibilidade do tomateiro à murcha bacteriana (Ralstonia solanacearum causa perdas que vão de 10 a 100 % na produção e uma das alternativas de controle que vem sendo utilizada é a enxertia com porta-enxerto resistente. Este trabalho teve o objetivo avaliar genótipos de tomateiro quanto à resistência a R. solanacearum e a enxertia como alternativa para o controle da murcha bacteriana do tomateiro na região do Recôncavo Baiano. Para avalia
Hu, F P; Young, J M; Triggs, C M; Park, D C; Saul, D J
2001-12-01
Sequence data for 16S rDNA of the type strains of Acidovorax avenae subsp. avenae, A. avenae subsp. cattleyae, A. avenae subsp. citrulli, A. konjaci and Herbaspirillum rubrisubalbicans were compared with GenBank library accessions of Burkholderia spp., Comamonas sp., Ralstonia solanacearum and Variovorax sp. Maximum Parsimony analysis produced two clusters: 1. Acidovorax spp., Comamonas sp., and Variovorax sp. (all in the Comamonadaceae), and 2. Burkholderia spp., Ralstonia solanacearum, and Herbaspirillum rubrisubalbicans. Maximum Likelihood analysis produced only one cluster (of the Comamonadaceae). Using nutritional and laboratory tests, all Acidovorax spp., Burkholderia spp., and Herbaspirillum rubrisubalbicans were discriminated in distinct clusters at the species level, and could be identified by selected determinative tests. There were no phenotypic tests constituted as a circumscription of the genera and which permitted the allocation of strains to genera. Strain identification as species allowed allocation to genera only by inference. The nomenclatural implications of these data are discussed.
Directory of Open Access Journals (Sweden)
Ana Tarin Gutiérrez-Ibáñez
2013-01-01
Full Text Available Título en ingles: Detection of Ca Liberibacter solanacearum and phytoplasma in potato crop (Solanum tuberosum L. in Toluca Valley Título corto: Detección de Ca Liberibacter solanacearum y fitoplasmas Resumen En México y Centro América se han detectado tubérculos de papa con manchado interno. Recientemente en Texas EUA a esta enfermedad se le ha denominado “Zebra Chip” (ZC o rayado de la papa, los síntomas foliares se asemejan al síndrome denominado “Punta Morada de la Papa” (PMP o enfermedad del “amarillamiento por psilidos” la cual es asociada con la presencia de “Candidatus Liberibacter solanacearum”. El objetivo de esta investigación fue detectar la presencia de esta bacteria y de fitoplasmas en plantas de papa que presentaban la coloración purpura de los foliolos. Durante el ciclo primavera – verano 2011 y 2012 se hizo un muestreo en los municipios de Tenango del Valle, Zinacantepec, Villa de Allende y San José del Rincón, del Estado de México. La detección de ambos patógenos se realizó mediante la reacción en cadena de la polimerasa (PCR con los iniciadores específicos para fitoplasmas: P1/P7, R16mF2/R16mR1 y para Ca Liberibacter solanacearum: OA2/Oi2c, resultando el 35,8% de las plantas positivas para fitoplasmas y el 11,6% para la bacteria. Los resultados indican que en algunas regiones productoras de papa del Estado de México, los dos presuntos agentes causales del síndrome de PMP, fitoplasmas y Ca. Liberibacter solanacearum, pueden estar asociados. Palabras clave: Candidatus Liberibacter solanacearum; Fitoplasma; punta morada. Abstract In Mexico and Central America have been detected stained potato tubers with internal browning; recently in Texas, USA, this disease has been called "Zebra Chip" (ZC or striped potato, foliar symptoms resemble the syndrome called "Potato Purple Top" (PPT or "psyllid yellows" disease which is associated with the presence of "Candidatus liberibacter solanacearum
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. TRUPTI ASOLKAR. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 55-66 RESEARCH ARTICLE. Identification of virulence factors and type III effectors of phylotype I, Indian Ralstonia solanacearum strains Rs-09-161 and Rs-10-244 · TRUPTI ASOLKAR ...
Improving cost-effectiveness of brown rot control: the value of bio-economic modelling
Breukers, A.; Werf, van der W.; Mourits, M.C.M.; Oude Lansink, A.G.J.M.
2007-01-01
Since 1995, the Dutch potato production chain has been hit by several outbreaks of brown rot, a quarantine disease caused by Ralstonia solanacearum race 3, biovar 2. To avoid establishment of brown rot in the potato production chain and avert the consequences on potato export, the Dutch government
Intestinal Ralstonia pickettii augments glucose intolerance in obesity
DEFF Research Database (Denmark)
Udayappan, Shanthadevi D; Kovatcheva-Datchary, Petia; Bakker, Guido J
2017-01-01
of insulin resistance in obesity. Here, we report that bacterial DNA is present in mesenteric adipose tissue of obese but otherwise healthy human subjects. Pyrosequencing of bacterial 16S rRNA genes revealed that DNA from the Gram-negative species Ralstonia was most prevalent. Interestingly, fecal abundance...... had reduced glucose tolerance. In addition, circulating levels of endotoxin were increased in R. pickettii-treated mice. In conclusion, this study suggests that intestinal Ralstonia is increased in obese human subjects with T2DM and reciprocally worsens glucose tolerance in DIO mice....
Effect of selected essential oil plants on bacterial wilt disease ...
African Journals Online (AJOL)
Objective: Bacterial wilt disease caused by Ralstonia solanacearum is a major constrain to production of potatoes (Solanum tuberosum). Control of bacterial wilt is very difficult as there are no effective curative chemicals. This study was aimed at investigating the potential roles of essential oil plants in control of the disease.
Bacterial Wilt in China: History, Current Status, and Future Perspectives
Jiang, Gaofei; Wei, Zhong; Xu, Jin; Chen, Huilan; Zhang, Yong; She, Xiaoman; Macho, Alberto P.; Ding, Wei; Liao, Boshou
2017-01-01
Bacterial wilt caused by plant pathogenic Ralstonia spp. is one of the most important diseases affecting the production of many important crops worldwide. In China, a large scientific community has been dedicated to studying bacterial wilt and its causative agent, Ralstonia pseudosolanacearum and R. solanacearum. Most of their work was published in Chinese, which has hindered international communication and collaboration in this field. In this review, we summarize the status of knowledge on geographical distribution, diversity, and host range of Ralstonia spp., as well as, the impact of bacterial wilt on important crops and disease control approaches, in China. We present areas of research and publications by Chinese scientists and propose the promotion of collaborative research within China and with the international community. PMID:28955350
Inheritance and identification of SCAR marker linked to bacterial wilt ...
African Journals Online (AJOL)
In the present work, the combinations (F1) were crossed between highly resistant and susceptible to bacterial wilt eggplant parents and its F2, BC1 segregation population plants were inoculated with race1 of Ralstonia solanacearum in greenhouse. In this paper, we reported that the inheritance of bacterial wilt resistance in ...
Intestinal Ralstonia pickettii augments glucose intolerance in obesity.
Directory of Open Access Journals (Sweden)
Shanthadevi D Udayappan
Full Text Available An altered intestinal microbiota composition has been implicated in the pathogenesis of metabolic disease including obesity and type 2 diabetes mellitus (T2DM. Low grade inflammation, potentially initiated by the intestinal microbiota, has been suggested to be a driving force in the development of insulin resistance in obesity. Here, we report that bacterial DNA is present in mesenteric adipose tissue of obese but otherwise healthy human subjects. Pyrosequencing of bacterial 16S rRNA genes revealed that DNA from the Gram-negative species Ralstonia was most prevalent. Interestingly, fecal abundance of Ralstonia pickettii was increased in obese subjects with pre-diabetes and T2DM. To assess if R. pickettii was causally involved in development of obesity and T2DM, we performed a proof-of-concept study in diet-induced obese (DIO mice. Compared to vehicle-treated control mice, R. pickettii-treated DIO mice had reduced glucose tolerance. In addition, circulating levels of endotoxin were increased in R. pickettii-treated mice. In conclusion, this study suggests that intestinal Ralstonia is increased in obese human subjects with T2DM and reciprocally worsens glucose tolerance in DIO mice.
Mechanism of host substrate acetylation by a YopJ family effector.
Zhang, Zhi-Min; Ma, Ka-Wai; Gao, Linfeng; Hu, Zhenquan; Schwizer, Simon; Ma, Wenbo; Song, Jikui
2017-07-24
The Yersinia outer protein J (YopJ) family of bacterial effectors depends on a novel acetyltransferase domain to acetylate signalling proteins from plant and animal hosts. However, the underlying mechanism is unclear. Here, we report the crystal structures of PopP2, a YopJ effector produced by the plant pathogen Ralstonia solanacearum, in complex with inositol hexaphosphate (InsP 6 ), acetyl-coenzyme A (AcCoA) and/or substrate Resistance to Ralstonia solanacearum 1 (RRS1-R) WRKY . PopP2 recognizes the WRKYGQK motif of RRS1-R WRKY to position a targeted lysine in the active site for acetylation. Importantly, the PopP2-RRS1-R WRKY association is allosterically regulated by InsP 6 binding, suggesting a previously unidentified role of the eukaryote-specific cofactor in substrate interaction. Furthermore, we provide evidence for the reaction intermediate of PopP2-mediated acetylation, an acetyl-cysteine covalent adduct, lending direct support to the 'ping-pong'-like catalytic mechanism proposed for YopJ effectors. Our study provides critical mechanistic insights into the virulence activity of YopJ class of acetyltransferases.
LENUS (Irish Health Repository)
Ryan, Michael P
2011-08-30
Abstract Background Ralstonia pickettii is a nosocomial infectious agent and a significant industrial contaminant. It has been found in many different environments including clinical situations, soil and industrial High Purity Water. This study compares the phenotypic and genotypic diversity of a selection of strains of Ralstonia collected from a variety of sources. Results Ralstonia isolates (fifty-nine) from clinical, industrial and environmental origins were compared genotypically using i) Species-specific-PCR, ii) PCR and sequencing of the 16S-23S rRNA Interspatial region (ISR) iii) the fliC gene genes, iv) RAPD and BOX-PCR and v) phenotypically using biochemical testing. The species specific-PCR identified fifteen out of fifty-nine designated R. pickettii isolates as actually being the closely related species R. insidiosa. PCR-ribotyping of the 16S-23S rRNA ISR indicated few major differences between the isolates. Analysis of all isolates demonstrated different banding patterns for both the RAPD and BOX primers however these were found not to vary significantly. Conclusions R. pickettii species isolated from wide geographic and environmental sources appear to be reasonably homogenous based on genotypic and phenotypic characteristics. R. insidiosa can at present only be distinguished from R. pickettii using species specific PCR. R. pickettii and R. insidiosa isolates do not differ significantly phenotypically or genotypically based on environmental or geographical origin.
Isolasi dan Karakterisasi Ralstonia syzygii
Directory of Open Access Journals (Sweden)
Yanuar Danaatmadja
2009-07-01
Full Text Available Ralstonia syzygii is one of important pathogens of cloves. This study was aimed at obtaining pure culture of R. syzygi from diseased plant tissue samples. The acterium was isolated from infected clove plantations in Ungaran, Central Java. It had the ability to make clove seedlings show symptoms and then die 41 days after inoculation. The reisolated bacterium also showed its ability to kill clove seedlings after 17 days. The bacterium is gram negative, able to ultilize glucose, sucrose, maltose, mannitol, sorbitol, dulcitol, and glycerol, able to hydrolyze starch, grow well at 27oC, able to catalyze and release water and oxygen from hydrogen peroxyde (H2O2 and aerobically. Ralstonia syzygii merupakan salah satu patogen penting pada tanaman cengkeh. Penelitian ini dilakukan untuk mendapakan isolat murni R syzygii dari jaringan tanaman terinfeksi. Bakteri diisolasi dari pertanaman cengkeh sakit yang berasal dari daerah Ungaran, Jawa Tengah. Bakteri menunjukkan kemampuan untuk menyebabkan bibit tanaman cangkeh sakit dan kemudian mati 41 hsi. Bakteri hasil reisolasi juga menunjukkan kemampuannya menyebabkan sakit dan kematian pada bibit tanaman cengkeh setelah 17 hsi. Bakteri yang diperoleh bersifat gram negatif, mampu memanfaatkan glukosa, sukrosa, maltosa, manitol, sorbitol, dulsitol, dan gliserol, mampu menghidrolisis pati, tumbuh baik pada suhu 27o C, mampu mengkatalisis dan melepaskan air dan oksigen dari hydrogen peroxide (H2O2 dan bersifat aerob.
Biological Control Of The Egyptian Brown Rot In Potato (Solanum Tuberosum L.)
International Nuclear Information System (INIS)
Salem, E.A.; Askora, A. M.
2012-01-01
Pseudomonas fluorescence, P. aeruginosa, Bacillus subtillus and streptomyces spp. Were used in control of Ralstonia solanacearum, the casual agent of brown rot in potato. In vitro, antagonistic activities showed that streptomyces spp. was the most antagonistic followed by P. fluorescence, Bacillus subtilus and P. aeruginosa respectively. Also, in vivo, biological control of R. solanacearum showed that Streptomyces spp. was found to reduce the percentage of brown rot infection to 5% followed by P. fluorescence, Bacillus subtilus and P. aeruginosa reducing the percentage of infection to 15 , 25 and 40%, respectively. Also, the disease severity when using Streptomyces spp. and P. fluorescence was reduced from 5 to 1 and reduced from 5 to 2 when using Bacillus subtilus and P. aeruginosa.
Directory of Open Access Journals (Sweden)
K. M. Sarikyan
2015-01-01
Full Text Available On an experimental basis of the Scientific Center of vegetable, melon and industrial crops (Republic of Armenia 20 accessions of the world germplasm of Capsicum annuum L. (sweet pepper, chili provided by the World Vegetable Center (AVRDC have been studied. The accessions resistant to such diseases as verticillium wilt (Verticillium albo-atrum Reincke, bacterial wilt (Ralstonia solanacearum (= Pseudomonas solanacearum, tobacco mosaic virus (TMV and cucumber mosaic virus (CMV, blossom end rot of fruit, and tip-burn have been selected. These genotypes of chili and sweet pepper are the promising initial material in breeding for resistance to common diseases. In collaboration with other breeders, five varieties of peppers were developed and released: sweet pepper cultivars Natalie, Emily, Miles, and chili cultivars Zita and Gita.
Introduction: Ralstonia spp., a heterotrophic bacterium that are isolated from produce processing environments as part of the native microflora, have strong potentials for formaing biofilms on various surfaces. When co-cultured, Escherichia coli O157:H7 (EcO157) and Ralstonia spp. displayed a synerg...
International Nuclear Information System (INIS)
Chew, W C; Lau, A M S; Kang, C S; Hashim, M; Battay, A E
2014-01-01
A case study on pre-symptom stage of plant disease infection using ground based hyperspectral remote sensing was conducted. The objectives of the study are: (1) to validate the existence of pre-symptom stage of Ralstonia Solanacearum infection in Solanum Melongena L. (eggplant), and (2) to determine the induced electromagnetic spectral response for infected eggplant. From the experiment, the pre-symptom duration of Ralstonia Solanacearum infection in the case of eggplant was estimated (with the artificial photosynthetic stress conditions were adopted in the experiment to induce measurable changes in daily hyperspectral measurement of disease infected eggplant samples during the pre-symptom stage) as four days which is the critical period for practicing effective treatments. Vegetation indices namely, (1) Chlorophyll Absorption Integral (CAI), (2) Photochemical Radiation Index (PRI), and (3) Normalized Difference Vegetation Index (NDVI) have successfully shown noticeable progress of index value from the infected sample plant (with 100% light stress condition) throughout the study. Yet, other infected sample plants with moderate light stress conditions (50% or 75%) did not result any similar progress of index value from the daily leaf scale hyperspectral measurements. Apparently, extreme light stress can induce significant changes at visible portion in hyperspectral measurements for a disease infected eggplant during the pre-symptom stage
root colonized by Glomus mosseae and Ralstonia solanacearum
African Journals Online (AJOL)
Yomi
2012-03-27
Mar 27, 2012 ... Ngakou et al., 2007), plant nutrition support (Mahmood and Rizvi, 2010), and salt stress (Shokri and Maadi,. 2009). Safir (1968) was the first to report the study on interaction of plant pathogenic fungi and species of AMF, followed by many reports confirming the reduction of disease severity as a result of ...
Directory of Open Access Journals (Sweden)
Nur Prihatiningsih
2011-02-01
Full Text Available Bacterial wilt on tomato caused by Ralstonia solanacearum is a crucial disease, because it can reduce yield until 50%. The aims of this research were: 1 to find out biopesticide formula for Bacillus sp.growth, 2 to test Bacillus sp. against R. solanacearum in vitro, 3 to test potassium fertilizer combined with Bacillus sp. for enhancing tomato resistance to the bacterial wilt disease. The research was conducted in 2 steps i.e to test the persistence of Bacillus sp. in biopesticide formula, and to test the best combination of both potassium and the Bacillus sp. biopesticide. The results showed that Bacillus B298 was the best isolate in its persistence on the biopesticide formula of organic growth medium+CaCO3+CMC 1%+mannitol 1%, and in inhibiting R. solanacearum. The best biopesticide formula for the Bacillus sp. persistence was growth organic media+ CaCO3+CMC 1%+mannitol 1%. Bacillus sp. was able to increase tomato resistance to the bacterial wilt disease from the category of susceptible to be tolerant and becoming resistant.
Directory of Open Access Journals (Sweden)
ABDJAD ASIH NAWANGSIH
2011-06-01
Full Text Available Biological control of bacterial wilt pathogen (Ralstonia solanacearum of tomato using endophytic bacteria is one of the alternative control methods to support sustainable agriculture. This study was conducted to select and characterize endophytic bacteria isolated from healthy tomato stems and to test their ability to promote plant growth and suppress bacterial wilt disease. Among 49 isolates successfully isolated, 41 were non-plant pathogenic. Green house test on six selected isolates based on antagonistic effect on R. solanacearum or ability to suppress R. solanacearum population in dual culture assays obtained BC4 and BL10 isolates as promising biocontrol agents. At six weeks after transplanting, plants treated with BC4 isolate showed significantly lower disease incidence (33% than that of control (83%. Plants height was not significantly affected by endophytic bacterial treatments. Based on 16S rRNA sequence, BC4 isolate had 97% similarity with Staphylococcus epidermidis (accession number EU834240.1, while isolate BL10 had 98% similarity with Bacillus amyloliquefaciens strain JK-SD002 (accession number AB547229.1.
Ranjan, R K; Singh, Dinesh; Baranwal, V K
2016-11-01
Ralstonia solanacearum (Smith) Yabuuchi et al. and Erwinia carotovora subsp. carotovora (Jones) Bergey et al. (Pectobacterium carotovorum subsp. carotovorum) are the two major bacterial pathogens of potato causing brown rot (wilt) and soft rot diseases, respectively, in the field and during storage. Reliable and early detection of these pathogens are keys to avoid occurrence of these diseases in potato crops and reduce yield loss. In the present study, multiplex polymerase chain reaction (PCR) protocol was developed for simultaneous detection of R. solanacearum and E. carotovora subsp. carotovora from potato tubers. A set of oligos targeting the pectatelyase (pel) gene of E. carotovora subsp. carotovora and the universal primers based on 16S r RNA gene of R. solanacearum were used. The standardized multiplex PCR protocol could detect R. solanacearum and E. carotovora subsp. carotovora up to 0.01 and 1.0 ng of genomic DNA, respectively. The protocol was further validated on 96 stored potato tuber samples, collected from different potato-growing states of India, viz. Uttarakhand, Odisha, Meghalaya and Delhi. 53.1 % tuber samples were positive for R. solanacearum, and 15.1 % of samples were positive for E. carotovora subsp. carotovora, and both the pathogens were positive in 26.0 % samples when BIO-PCR was used. This method offers sensitive, specific, reliable and fast detection of two major bacterial pathogens from potato tubers simultaneously, particularly pathogen-free seed certification in large scale.
Biological Control of Bacterial Wilt in South East Asia
Arwiyanto, Triwidodo
2014-01-01
Bacterial wilt disease caused by Ralstonia solanacearum destroys many crops of different plant families in South East Asia despite many researches about the disease, and the availability of developed control method in other parts of the world. There is no chemical available for the bacterial wilt pathogen and biological control is then chosen as an alternative to save the crops. Most of the biological control studies were based on antagonism between biological control agent and the pathogen. ...
Ralstonia mannitolilytica infection in renal transplant recipient: First report
Directory of Open Access Journals (Sweden)
Mukhopadhyay C
2003-01-01
Full Text Available Ralstonia mannitolilytica is being increasingly identified as an opportunist pathogen in immunocompromised patients. We report the first case of post renal transplant infection by R. mannitolilytica, in a 14-year-old recipient. The graft and the patient were saved with prompt microbiological identification, sensitivity testing and subsequent administration of appropriate antibiotic.
PATOGENISITAS BAKTERI LAYU PISANG (RALSTONIA SP. PADA BEBERAPA TANAMAN LAIN
Directory of Open Access Journals (Sweden)
Titik Nur Aeny1 .
2011-10-01
Pathogenicity of banana wilt bacteria (Ralstonia sp. on several other plants. This experiment was conducted to investigate the pathogenicity of bacterial wilt of banana pathogen (Ralstonia sp. isolated from infected plants in Lampung on tomato, chili pepper, eggplant, and ginger. The experiment was conducted in Laboratory of Plant Protection Department, Faculty of Agricultural University of Lampung, from May 1999 to February 2000. Treatments in this experiment were arranged in a completely randomized design with four replications. The treatments were tomato, eggplant, chili pepper, and ginger. Banana was used as the control. The results of this experiment showed that up to 30 days after inoculation, the bacteria isolated from banana found in Lampung was not able to cause symptom on tomato, chili pepper, eggplant, nor ginger. However, this bacteria caused wilting on banana eight days after inoculation; the incubation period of this bacteria on banana was eight days.
Chen, Le; Jian, Shanshan; Bi, Jinhua; Li, Yunlong; Chang, Zhizhou; He, Jian; Ye, Xiaomei
2016-05-01
Tomato plant waste (TPW) was used as the feedstock of a batch anaerobic reactor to evaluate the effect of anaerobic digestion on Ralstonia solanacearum and Phytophthora capsici survival. Batch experiments were carried out for TS (total solid) concentrations of 2%, 4% and 6% respectively, at mesophilic (37±1°C) and room (20-25°C) temperatures. Results showed that higher digestion performance was achieved under mesophilic digestion temperature and lower TS concentration conditions. The biogas production ranged from 71 to 416L/kg VS (volatile solids). The inactivation of anaerobic digestion tended to increase as digestion performance improved. The maximum log copies reduction of R. solanacearum and P. capsici detected by quantitative PCR (polymerase chain reaction) were 3.80 and 4.08 respectively in reactors with 4% TS concentration at mesophilic temperatures. However, both in mesophilic and room temperature conditions, the lowest reduction of R. solanacearum was found in the reactors with 6% TS concentration, which possessed the highest VFA (volatile fatty acid) concentration. These findings indicated that simple accumulation of VFAs failed to restrain R. solanacearum effectively, although the VFAs were considered poisonous. P. capsici was nearly completely dead under all conditions. Based on the digestion performance and the pathogen survival rate, a model was established to evaluate the digestate biosafety. Copyright © 2015. Published by Elsevier B.V.
Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop
2015-01-01
Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048
Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture
Directory of Open Access Journals (Sweden)
Belén Álvarez
2017-07-01
Full Text Available Bacterial wilt diseases caused by Ralstonia solanacearum, R. pseudosolanacearum, and R. syzygii subsp. indonesiensis (former R. solanacearum species complex are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the advantage of being environmentally friendly. Advances in bacterial wilt biocontrol include an increasing interest in bacteriophage-based treatments as a promising re-emerging strategy. Bacteriophages against the bacterial wilt pathogens have been described with either lytic or lysogenic effect but, they were proved to be active against strains belonging to R. pseudosolanacearum and/or R. syzygii subsp. indonesiensis, not to the present R. solanacearum species, and only two of them demonstrated successful biocontrol potential in planta. Despite the publication of three patents on the topic, until now no bacteriophage-based product is commercially available. Therefore, there is still much to be done to incorporate valid bacteriophages in an integrated management program to effectively fight bacterial wilt in the field.
Bacteriophage-Based Bacterial Wilt Biocontrol for an Environmentally Sustainable Agriculture.
Álvarez, Belén; Biosca, Elena G
2017-01-01
Bacterial wilt diseases caused by Ralstonia solanacearum , R. pseudosolanacearum , and R. syzygii subsp. indonesiensis (former R. solanacearum species complex) are among the most important plant diseases worldwide, severely affecting a high number of crops and ornamentals. Difficulties of bacterial wilt control by non-biological methods are related to effectiveness, bacterial resistance and environmental impact. Alternatively, a great many biocontrol strategies have been carried out, with the advantage of being environmentally friendly. Advances in bacterial wilt biocontrol include an increasing interest in bacteriophage-based treatments as a promising re-emerging strategy. Bacteriophages against the bacterial wilt pathogens have been described with either lytic or lysogenic effect but, they were proved to be active against strains belonging to R. pseudosolanacearum and/or R. syzygii subsp. indonesiensis , not to the present R. solanacearum species, and only two of them demonstrated successful biocontrol potential in planta . Despite the publication of three patents on the topic, until now no bacteriophage-based product is commercially available. Therefore, there is still much to be done to incorporate valid bacteriophages in an integrated management program to effectively fight bacterial wilt in the field.
Pérez-Rojas, Fernanda; León-Quispe, Jorge; Galindo-Cabello, Nadia
2015-01-01
Una de las formas de control de fitopatógenos es a través del uso de microorganismos antagonistas. El compost, un producto orgánico es fuente de microorganismos capaces de producir metabolitos secundarios de interés agrícola. Se aislaron y evaluaron mediante cultivos in vitro la capacidad antagonista de 85 actinomicetos frente a fitopatógenos que afectan a Solanum tuberosum. De los aislados, 23.5% tuvieron actividad antagonista a Ralstonia solanacearum, 16.4% a Pectobacterium carotovorum, 43....
Directory of Open Access Journals (Sweden)
Guy Blomme
2017-07-01
Full Text Available Bacterial diseases of bananas and enset have not received, until recently, an equal amount of attention compared to other major threats to banana production such as the fungal diseases black leaf streak (Mycosphaerella fijiensis and Fusarium wilt (Fusarium oxysporum f. sp. cubense. However, bacteria cause significant impacts on bananas globally and management practices are not always well known or adopted by farmers. Bacterial diseases in bananas and enset can be divided into three groups: (1 Ralstonia-associated diseases (Moko/Bugtok disease caused by Ralstonia solanacearum and banana blood disease caused by R. syzygii subsp. celebesensis; (2 Xanthomonas wilt of banana and enset, caused by Xanthomonas campestris pv. musacearum and (3 Erwinia-associated diseases (bacterial head rot or tip-over disease Erwinia carotovora ssp. carotovora and E. chrysanthemi, bacterial rhizome and pseudostem wet rot (Dickeya paradisiaca formerly E. chrysanthemi pv. paradisiaca. Other bacterial diseases of less widespread importance include: bacterial wilt of abaca, Javanese vascular wilt and bacterial fingertip rot (probably caused by Ralstonia spp., unconfirmed. This review describes global distribution, symptoms, pathogenic diversity, epidemiology and the state of the art for sustainable disease management of the major bacterial wilts currently affecting banana and enset.
Jha, Babita; Rao, Mugdha; Prasad, K.; Jha, Anal K.
2018-05-01
The present work encompasses the fabrication of biocompatible silver nanoparticles from the leaves of the medicinal plant Piper betle using green chemistry approach. The synthesized nanoparticles were characterized by different standard techniques like: UV-visible spectroscopy, X-ray diffraction, scanning electron microscopy and Fourier transformed infrared spectroscopy. The antimicrobial efficacy of the silver nanoparticles was assessed against human and plant pathogens namely Ralstonia solanacearum, Burkholderia gladioli, Escherichia coli and Sacchromyces cerevisiae by agar well diffusion method. The obtained results clearly indicate its possible use as an alternative to antibiotics and pesticides in near future.
Enhanced biofilm formation in dual-species culture of Listeria monocytogenes and Ralstonia insidiosa
In the environment, many microorganisms coexist in communities as biofilms. The objective of this study was to investigate the interactions between Listeria monocytogenes and Ralstonia insidiosa in dual species biofilms. Biofilm development was measured using crystal violet in 96-well microtiter pla...
Solar energy system reduces time taken to inhibit microbial growth in soil
Energy Technology Data Exchange (ETDEWEB)
Phitthayarachasak, Thanathep; Thepa, Sirichai; Kongkiattikajorn, Jirasak [Energy Technology Division, School of Energy Environment and Materials, King Mongkut' s University of Technology Thonburi, 126 Prachauthid Road, Tungkru, Bangkok 10140 (Thailand)
2009-11-15
This research studied how to reduce the time consumption and to increase and improve the efficiency of the solarization process. The asymmetry compound parabolic concentrator (ACPC) was developed to produce boiling water to be utilized while the solarization process was in operation. This could decrease the time consumed in the solarization process from 4 to 6 weeks to 4 h, with a temperature of approximately 41.25 C at the various depth levels, not exceeding 50 cm. The test to inhibit the growth of Ralstonia solanacearum, the causative agent of wilt in crops leaves, indicated that R. solanacearum was reduced from the total bacterial population of 10.9 x 10{sup 8} colony forming unit/g soil (cfu g{sup -1}) at soil surface to 9.0 x 10{sup 7}, 7.5 x 10{sup 4} and 4.1 x 10{sup 3} cfu g{sup -1} within 1, 2 and 4 h, respectively. (author)
Directory of Open Access Journals (Sweden)
Suane Coutinho Cardoso
2006-01-01
Full Text Available A técnica de enxertia é utilizada em algumas hortaliças, principalmente em áreas infestadas, para atribuir resistência a patógenos do solo, minimizando as perdas de produção de cultivares suscetíveis. Este trabalho teve como objetivo avaliar o desenvolvimento e a produtividade de plantas de tomateiro enxertadas em híbrido, tido como resistente a Ralstonia solanacearum, em comparação a pés-francos. O experimento foi desenvolvido em viveiro (produção de mudas e enxertia e em céu aberto, no município de Cruz das Almas, Bahia, no período de outubro de 2003 a fevereiro de 2004. Utilizou-se o método de enxertia de fenda cheia, com o híbrido 'Hawaii 7996' como porta-enxerto e as cultivares Santa Clara, Santa Cruz Kada e Débora Plus, suscetíveis a R. solanacearum, como enxerto. O delineamento experimental foi em blocos ao acaso, com seis tratamentos (3 enxertados e 3 pés-francos, 5 repetições e 6 plantas por parcela útil. Avaliaram-se os caracteres: diâmetro do caule, altura da planta e da primeira inflorescência, distância entre inflorescências e produtividade comercial de frutos. O desenvolvimento das plantas, a produção total e a massa média dos frutos foram semelhantes para os tratamentos enxertados em relação a seus respectivos pés-francos e não houve incompatibilidade entre porta-enxerto e enxerto. A cultivar Santa Cruz Kada foi mais sensível às condições agroecológicas do município de Cruz das Almas, refletindo negativamente na produção e no peso médio dos frutos. Observou-se na enxertia com o híbrido 'Hawaii 7996' potencial para viabilizar a produção de tomateiros comerciais suscetíveis à murcha bacteriana, em áreas infestadas com R. solanacearum.Grafts have been used in horticultural crops, to overcome soilborne plant pathogens, and thus minimize yield losses of susceptible cultivars. This work aimed at to evaluate growth and yield of tomato plants grafted on to a hybrid resistant to Ralstonia
Directory of Open Access Journals (Sweden)
Morahem Ashengroph
2014-04-01
Full Text Available Introduction: The biological synthesis of nanoparticles has gained enormous importance due to the development of clean and environmentally-friendly processes. Silver is highly toxic to microbial cells, Nevertheless, it has been reported that several microorganisms are silver resistance and corroborate the microbial reduction of water soluble Ag+ to Ag0 nanoparticles. In this study, native strains of bacteria screen for use as biocatalysts for extracellular synthesis of silver nanoparticles. Materials and methods: Eight different strains of bacteria exhibiting high silver tolerance were isolated from collecting soil samples from copper and gold mines and characterized using morphological observations and preliminary biochemical tests. The bacterial strains in the presence of 1 g/l Ag+ solution at pH 7 were incubated at 28º C for 48 h in an orbital shaker. The silver nanoparticles formation was investigated by visual observations (changing the color of the reaction solution, spectroscopic techniques and microscopic observations. Results: Among the 8 strains giving high Ag+ tolerance, the strain SM8, isolated from the Sarcheshmeh Copper Mine, Kerman, showed the capability of promoting the formation extracellular Ag nanoparticles. The strain was selected and identified as Ralstonia sp. SM8 (GenBank accession number KF264453 based on morphological and biochemical characteristics and its molecular phylogenetic analysis. Results obtained by visual observations, spectral data achieved from UV–vis, XRD spectrum and SEM micrographs revealed the extracellular formation of spherical silver nanoparticles in the size range of 20-50 nm with the culture supernatants of Ralstonia sp. SM8. Discussion and conclusion: Based on the results obtained, fast and extracellular synthesis of silver nanoparticles, without the need for complicated extraction steps, can be taken by using the culture supernatants of Ralstonia sp. SM8. The current study is the first report
A dual resistance gene system prevents infection by three distinct pathogens.
Narusaka, Mari; Kubo, Yasuyuki; Shiraishi, Tomonori; Iwabuchi, Masaki; Narusaka, Yoshihiro
2009-10-01
Colletotrichum higginsianum causes typical anthracnose lesions on the leaves, petioles, and stems of cruciferous plants. Inoculation of Arabidopsis thaliana ecotype Columbia leaves with C. higginsianum results in fungal growth and disease symptoms reminiscent of those induced in other cruciferous plants. We performed map-based cloning and natural variation analysis of 19 A. thaliana ecotypes to identify a dominant resistance locus against C. higginsianum. We found that the A. thaliana RCH2 (for recognition of C. higginsianum) locus encodes two NB-LRR proteins, both of which are required for resistance to C. higginsianum in the A. thaliana ecotype Ws-0. Both proteins are well-characterized R proteins involved in resistance against bacterial pathogens; RRS1 (resistance to Ralstonia solanacearum 1) confers resistance to strain Rs1000 of R. solanacearum and RPS4 to Pseudomonas syringae pv. tomato strain DC3000 expressing avrRps4 (Pst-avrRps4). Furthermore, we found that both RRS1-Ws and RPS4-Ws genes are required for resistance to Pst-avrRps4 and to Rs1002 R. solanacearum. We therefore demonstrate that a pair of neighboring genes, RRS1-Ws and RPS4-Ws, function cooperatively as a dual R-gene system against at least three distinct pathogens.
Directory of Open Access Journals (Sweden)
Marangoni C.
2001-01-01
Full Text Available With the aim of producing polyhydroxyalkanoates, a study of the influence of culture conditions (nitrogen and carbon sources and temperature on the growth of Ralstonia eutropha in stirred flasks was carried out and the use of some low-cost sources (hydrolyzed lactose, inverted sugar and corn steep liquor as evaluated. The best specific growth rate was obtained when inverted sugar was utilized as the substrate (mumax = 0.26 h-1. Two different phases in the assimilation of the carbon source were observed when hydrolyzed lactose was present, suggesting the assimilation first of glucose and then of galactose. To confirm the growth of Ralstonia eutropha using galactose as the only carbon source, experiments were carried out and the results showed that this bacterium is able to grow in the presence of this sugar at a growth rate of 0.13 h-1. The use of galactose by Ralstonia eutropha for its growth has not been reported in the literature until now. Corn steep liquor was found to be a viable alternative nitrogen source to ammonium sulfate. The results of experiments carried out at 30°C and 34°C were similar.
Prasath, Duraisamy; Karthika, Raveendran; Habeeba, Naduva Thadath; Suraby, Erinjery Jose; Rosana, Ottakandathil Babu; Shaji, Avaroth; Eapen, Santhosh Joseph; Deshpande, Uday; Anandaraj, Muthuswamy
2014-01-01
Bacterial wilt in ginger (Zingiber officinale Rosc.) caused by Ralstonia solanacearum is one of the most important production constraints in tropical, sub-tropical and warm temperature regions of the world. Lack of resistant genotype adds constraints to the crop management. However, mango ginger (Curcuma amada Roxb.), which is resistant to R. solanacearum, is a potential donor, if the exact mechanism of resistance is understood. To identify genes involved in resistance to R. solanacearum, we have sequenced the transcriptome from wilt-sensitive ginger and wilt-resistant mango ginger using Illumina sequencing technology. A total of 26387032 and 22268804 paired-end reads were obtained after quality filtering for C. amada and Z. officinale, respectively. A total of 36359 and 32312 assembled transcript sequences were obtained from both the species. The functions of the unigenes cover a diverse set of molecular functions and biological processes, among which we identified a large number of genes associated with resistance to stresses and response to biotic stimuli. Large scale expression profiling showed that many of the disease resistance related genes were expressed more in C. amada. Comparative analysis also identified genes belonging to different pathways of plant defense against biotic stresses that are differentially expressed in either ginger or mango ginger. The identification of many defense related genes differentially expressed provides many insights to the resistance mechanism to R. solanacearum and for studying potential pathways involved in responses to pathogen. Also, several candidate genes that may underline the difference in resistance to R. solanacearum between ginger and mango ginger were identified. Finally, we have developed a web resource, ginger transcriptome database, which provides public access to the data. Our study is among the first to demonstrate the use of Illumina short read sequencing for de novo transcriptome assembly and comparison in
Prasath, Duraisamy; Karthika, Raveendran; Habeeba, Naduva Thadath; Suraby, Erinjery Jose; Rosana, Ottakandathil Babu; Shaji, Avaroth; Eapen, Santhosh Joseph; Deshpande, Uday; Anandaraj, Muthuswamy
2014-01-01
Bacterial wilt in ginger (Zingiber officinale Rosc.) caused by Ralstonia solanacearum is one of the most important production constraints in tropical, sub-tropical and warm temperature regions of the world. Lack of resistant genotype adds constraints to the crop management. However, mango ginger (Curcuma amada Roxb.), which is resistant to R. solanacearum, is a potential donor, if the exact mechanism of resistance is understood. To identify genes involved in resistance to R. solanacearum, we have sequenced the transcriptome from wilt-sensitive ginger and wilt-resistant mango ginger using Illumina sequencing technology. A total of 26387032 and 22268804 paired-end reads were obtained after quality filtering for C. amada and Z. officinale, respectively. A total of 36359 and 32312 assembled transcript sequences were obtained from both the species. The functions of the unigenes cover a diverse set of molecular functions and biological processes, among which we identified a large number of genes associated with resistance to stresses and response to biotic stimuli. Large scale expression profiling showed that many of the disease resistance related genes were expressed more in C. amada. Comparative analysis also identified genes belonging to different pathways of plant defense against biotic stresses that are differentially expressed in either ginger or mango ginger. The identification of many defense related genes differentially expressed provides many insights to the resistance mechanism to R. solanacearum and for studying potential pathways involved in responses to pathogen. Also, several candidate genes that may underline the difference in resistance to R. solanacearum between ginger and mango ginger were identified. Finally, we have developed a web resource, ginger transcriptome database, which provides public access to the data. Our study is among the first to demonstrate the use of Illumina short read sequencing for de novo transcriptome assembly and comparison in
Hydrogen Peroxide- and Nitric Oxide-mediated Disease Control of Bacterial Wilt in Tomato Plants
Directory of Open Access Journals (Sweden)
Jeum Kyu Hong
2013-12-01
Full Text Available Reactive oxygen species (ROS generation in tomato plants by Ralstonia solanacearum infection and the role of hydrogen peroxide (H₂O₂ and nitric oxide in tomato bacterial wilt control were demonstrated. During disease development of tomato bacterial wilt, accumulation of superoxide anion (O₂− and H₂O₂ was observed and lipid peroxidation also occurred in the tomato leaf tissues. High doses of H₂O₂and sodium nitroprusside (SNP nitric oxide donor showed phytotoxicity to detached tomato leaves 1 day after petiole feeding showing reduced fresh weight. Both H₂O₂and SNP have in vitro antibacterial activities against R. solanacearum in a dose-dependent manner, as well as plant protection in detached tomato leaves against bacterial wilt by 10⁶ and 10⁷ cfu/ml of R. solanacearum. H₂O₂- and SNP-mediated protection was also evaluated in pots using soil-drench treatment with the bacterial inoculation, and relative ‘area under the disease progressive curve (AUDPC’ was calculated to compare disease protection by H₂O₂ and/or SNP with untreated control. Neither H₂O₂ nor SNP protect the tomato seedlings from the bacterial wilt, but H₂O₂+ SNP mixture significantly decreased disease severity with reduced relative AUDPC. These results suggest that H₂O₂ and SNP could be used together to control bacterial wilt in tomato plants as bactericidal agents.
Embryo Localization Enhances the Survival of Acidovorax citrulli in Watermelon Seeds.
Dutta, Bhabesh; Schneider, Raymond W; Robertson, Clark L; Walcott, Ronald R
2016-04-01
Acidovorax citrulli, the causal agent of bacterial fruit blotch (BFB) of cucurbits has been observed to survive for >34 years in stored melon and watermelon seeds. To better understand this remarkable longevity, we investigated the bacterium's tolerance to desiccation and the effect of bacterial localization in different watermelon seed tissues on its survival. We compared the ability of A. citrulli to tolerate desiccation on filter paper discs and on host (watermelon) and nonhost (cabbage, corn and tomato) seeds to two seedborne (Xanthomonas campestris pv. campestris and Pantoea stewartii subsp. stewartii) and one soilborne (Ralstonia solanacearum) plant-pathogenic bacteria. A. citrulli survival on dry filter paper (>12 weeks) was similar to that of X. campestris pv. campestris but longer than P. stewartii subsp. stewartii. Ralstonia solanacearum survived longer than all other bacteria tested. On all seeds tested, A. citrulli and X. campestris pv. campestris populations declined by 5 orders of magnitude after 12 weeks of incubation at 4°C and 50% relative humidity, while R. solanacearum populations declined by 3 orders. P. stewartii subsp. stewartii was not recovered after 12 weeks of incubation. To determine the effect of tissue localization on bacterial survival, watermelon seeds infested with A. citrulli by flower stigma inoculation (resulting in bacterial localization in the embryo/endosperm) or by ovary pericarp inoculations (resulting in bacterial localization under the testa) were treated with peroxyacetic acid or chlorine (Cl2) gas. Following these treatments, a significantly higher reduction in BFB seed-to-seedling transmission was observed for seeds generated by ovary pericarp inoculation (≥89.5%) than for those generated by stigma inoculation (≤76.5%) (Pseed coat, suggesting that tissue localization is important for bacterial survival in seed. This observation was confirmed when P. stewartii subsp. stewartii survived significantly longer in stigma
Directory of Open Access Journals (Sweden)
Céline Pesce
2017-06-01
Full Text Available Xanthomonas translucens is the causal agent of bacterial leaf streak, the most common bacterial disease of wheat and barley. To cause disease, most xanthomonads depend on a highly conserved type III secretion system, which translocates type III effectors into host plant cells. Mutagenesis of the conserved type III secretion gene hrcT confirmed that the X. translucens type III secretion system is required to cause disease on the host plant barley and to trigger a non-host hypersensitive response (HR in pepper leaves. Type III effectors are delivered to the host cell by a surface appendage, the Hrp pilus, and a translocon protein complex that inserts into the plant cell plasma membrane. Homologs of the Xanthomonas HrpF protein, including PopF from Ralstonia solanacearum and NolX from rhizobia, are thought to act as a translocon protein. Comparative genomics revealed that X. translucens strains harbor a noncanonical hrp gene cluster, which rather shares features with type III secretion systems from Ralstonia solanacearum, Paraburkholderia andropogonis, Collimonas fungivorans, and Uliginosibacterium gangwonense than other Xanthomonas spp. Surprisingly, none of these bacteria, except R. solanacearum, encode a homolog of the HrpF translocon. Here, we aimed at identifying a candidate translocon from X. translucens. Notably, genomes from strains that lacked hrpF/popF/nolX instead encode another gene, called hpaT, adjacent to and co-regulated with the type III secretion system gene cluster. An insertional mutant in the X. translucens hpaT gene, which is the first gene of a two-gene operon, hpaT-hpaH, was non-pathogenic on barley and did not cause the HR or programmed cell death in non-host pepper similar to the hrcT mutant. The hpaT mutant phenotypes were partially complemented by either hpaT or the downstream gene, hpaH, which has been described as a facilitator of translocation in Xanthomonas oryzae. Interestingly, the hpaT mutant was also complemented
Bi, Changhao; Su, Peter; Müller, Jana; Yeh, Yi-Chun; Chhabra, Swapnil R; Beller, Harry R; Singer, Steven W; Hillson, Nathan J
2013-11-13
The chemoautotrophic bacterium Ralstonia eutropha can utilize H2/CO2 for growth under aerobic conditions. While this microbial host has great potential to be engineered to produce desired compounds (beyond polyhydroxybutyrate) directly from CO2, little work has been done to develop genetic part libraries to enable such endeavors. We report the development of a toolbox for the metabolic engineering of Ralstonia eutropha H16. We have constructed a set of broad-host-range plasmids bearing a variety of origins of replication, promoters, 5' mRNA stem-loop structures, and ribosomal binding sites. Specifically, we analyzed the origins of replication pCM62 (IncP), pBBR1, pKT (IncQ), and their variants. We tested the promoters P(BAD), T7, P(xyls/PM), P(lacUV5), and variants thereof for inducible expression. We also evaluated a T7 mRNA stem-loop structure sequence and compared a set of ribosomal binding site (RBS) sequences derived from Escherichia coli, R. eutropha, and a computational RBS design tool. Finally, we employed the toolbox to optimize hydrocarbon production in R. eutropha and demonstrated a 6-fold titer improvement using the appropriate combination of parts. We constructed and evaluated a versatile synthetic biology toolbox for Ralstonia eutropha metabolic engineering that could apply to other microbial hosts as well.
Directory of Open Access Journals (Sweden)
Jeum Kyu Hong
2016-10-01
Full Text Available Bacterial wilt and grey mould in tomato plants are economically destructive bacterial and fungal diseases caused by Ralstonia solanacearum and Botrytis cinerea, respectively. Various approaches including chemical and biological controls have been attempted to arrest the tomato diseases so far. In this study, in vitro growths of bacterial R. solanacearum and fungal B. cinerea were evaluated using four different vitamins including thiamine (vitamin B1, niacin (vitamin B3, pyridoxine (vitamin B6, and menadione (vitamin K3. In planta efficacies of the four vitamin treatments on tomato protection against both diseases were also demonstrated. All four vitamins showed different in vitro antibacterial activities against R. solanacearum in dose-dependent manners. However, treatment with 2 mM thiamine was only effective in reducing bacterial wilt of detached tomato leaves without phytotoxicity under lower disease pressure (10⁶ colony-forming unit [cfu]/ml. Treatment with the vitamins also differentially reduced in vitro conidial germination and mycelial growth of B. cinerea. The four vitamins slightly reduced the conidial germination, and thiamine, pyridoxine and menadione inhibited the mycelial growth of B. cinerea. Menadione began to drastically suppress the conidial germination and mycelial growth by 5 and 0.5 mM, respectively. Grey mould symptoms on the inoculated tomato leaves were significantly reduced by pyridoxine and menadione pretreatments one day prior to the fungal challenge inoculation. These findings suggest that disease-specific vitamin treatment will be integrated for eco-friendly management of tomato bacterial wilt and grey mould.
Hong, Jeum Kyu; Kim, Hyeon Ji; Jung, Heesoo; Yang, Hye Ji; Kim, Do Hoon; Sung, Chang Hyun; Park, Chang-Jin; Chang, Seog Won
2016-10-01
Bacterial wilt and grey mould in tomato plants are economically destructive bacterial and fungal diseases caused by Ralstonia solanacearum and Botrytis cinerea , respectively. Various approaches including chemical and biological controls have been attempted to arrest the tomato diseases so far. In this study, in vitro growths of bacterial R. solanacearum and fungal B. cinerea were evaluated using four different vitamins including thiamine (vitamin B1), niacin (vitamin B3), pyridoxine (vitamin B6), and menadione (vitamin K3). In planta efficacies of the four vitamin treatments on tomato protection against both diseases were also demonstrated. All four vitamins showed different in vitro antibacterial activities against R. solanacearum in dose-dependent manners. However, treatment with 2 mM thiamine was only effective in reducing bacterial wilt of detached tomato leaves without phytotoxicity under lower disease pressure (10 6 colony-forming unit [cfu]/ml). Treatment with the vitamins also differentially reduced in vitro conidial germination and mycelial growth of B. cinerea . The four vitamins slightly reduced the conidial germination, and thiamine, pyridoxine and menadione inhibited the mycelial growth of B. cinerea . Menadione began to drastically suppress the conidial germination and mycelial growth by 5 and 0.5 mM, respectively. Grey mould symptoms on the inoculated tomato leaves were significantly reduced by pyridoxine and menadione pretreatments one day prior to the fungal challenge inoculation. These findings suggest that disease-specific vitamin treatment will be integrated for eco-friendly management of tomato bacterial wilt and grey mould.
Directory of Open Access Journals (Sweden)
Suane C. Cardoso
2006-03-01
Full Text Available The use of organic matter that improves the physical, chemical and biological soil properties has been studied as an inducer of suppressiveness to soilborne plant pathogens. The objective of this work was to evaluate the effect of different sources and concentrations of organic matter on tomato bacterial wilt control. Two commercially available organic composts and freshly cut aerial parts of pigeon pea (Cajanus cajan and crotalaria (Crotalaria juncea were incorporated, in concentrations of 10, 20 and 30 % (v/v, into soil infested with Ralstonia solanacearum. The soil with the fresh organic matter of pigeon pea and crotalaria was incubated for 30 and 60 days before planting. Tomato seedlings of cv. Santa Clara were transplanted into polyethylene bags with 3 kg of the planting substrate (infested soil + organic matter. The wilting symptoms and percentage of flowering plants were evaluated for 45 days. All evaluated concentrations with incorporation and incubation for 30 days of aerial parts of pigeon pea and crotalaria controlled 100% tomato bacterial wilt. With 60 days of incubation, only the 10 % concentration of pigeon pea and crotalaria did not control the disease. These results suggest that soil incorporation of fresh aerial parts of pigeon pea and crotalaria is an effective method for bacterial wilt control.A utilização de materiais orgânicos que melhoram as características físicas, químicas e biológicas do solo vem sendo estudada como indutora de supressividade a fitopatógenos habitantes do solo. Este trabalho teve como objetivo avaliar o efeito de diferentes fontes e concentrações de matéria orgânica no controle da murcha bacteriana do tomateiro. Foram avaliados dois compostos orgânicos comerciais e a matéria fresca cortada da parte aérea de guandu (Cajanus cajan e de crotalária (Crotalaria juncea, nas concentrações 10, 20 e 30 % (v/v, incorporados no solo infestado com Ralstonia solanacearum. O solo que recebeu a parte
Directory of Open Access Journals (Sweden)
João Bosco C. Silva
2001-07-01
Full Text Available O tratamento sanitário de substratos é uma operação importante no processo de produção de mudas e no cultivo de plantas em vasos ou outros contentores. Tradicionalmente tem-se utilizado o gás brometo de metila como agente desinfetante. Entretanto, a produção deste gás deverá ser abolida até o ano 2010, forçando-se a busca de novas opções. Desenvolveu-se na Embrapa Hortaliças um equipamento que utiliza o vapor de água à baixa pressão, produzido por uma caldeira industrial, com capacidade para evaporar 30 L/h de água, para aquecer o substrato contido em uma caixa metálica cilíndrica com capacidade de 2000 L. O vapor é aplicado no fundo da caixa que contém uma camada de brita coberta com uma tela metálica de malha de 2 mm, que favorece a distribuição uniforme do vapor por toda a massa de substrato. O tempo de aquecimento é de aproximadamente 3 horas e o calor armazenado durante este período mantém a massa de substrato aquecida a temperaturas pasteurizantes, por até 4 horas após a aplicação do vapor. Para testar a eficácia do sistema avaliou-se a sobrevivência dos patógenos Ralstonia solanacearum, Fusarium oxysporum, Sclerotinia sclerotiorum e Rhizoctonia solani. Aplicou-se vapor por uma hora, não considerando o período de aquecimento, e coletaram-se as amostras após uma, duas, três ou quatro horas o início da aplicação de vapor. O tratamento por uma hora, em adição ao período de aquecimento, resultou na eliminação dos patógenos.The disinfestation of substrate is an important process for transplanting production and for plant cultivation in pots or boxes. Traditionally, metyl bromide gas has been employed to eliminate microorganisms. However the production of bromide gas in Brazil will be interrupted by the year 2010 and it is necessary to search for new options. We have devised an equipment that utilizes hot steam water at low pressure produced into a boiler machine with the capacity of evaporating
Biofilm formation on abiotic surfaces in fresh produce processing facilities might play a role in foodborne outbreaks by providing protective microniches for pathogenic bacteria. Our previous study showed that a strain of Ralstonia insidiosa isolated from a fresh produce processing plant could enhan...
Park, Joonhong; Kukor, Jerome J.; Abriola, Linda M.
2002-01-01
In Ralstonia pickettii PKO1, a denitrifying toluene oxidizer that carries a toluene-3-monooxygenase (T3MO) pathway, the biodegradation of toluene and trichloroethylene (TCE) by the organism is induced by TCE at high concentrations. In this study, the effect of TCE preexposure was studied in the context of bacterial protective response to TCE-mediated toxicity in this organism. The results of TCE degradation experiments showed that cells induced by TCE at 110 mg/liter were more tolerant to TCE...
Praburaman, Loganathan; Jang, Jum-Suk; Muthusamy, Govarthanan; Arumugam, Sengottaiyan; Manoharan, Koildhasan; Cho, Kwang-Min; Min, Cho; Kamala-Kannan, Seralathan; Byung-Taek, Oh
2016-09-01
The study reports a simple, inexpensive, and eco-friendly synthesis of copper oxide nanoparticles (CuONPs) using Piper betle leaf extract. Formation of CuONPs was confirmed by UV-visible spectroscopy at 280 nm. Transmission electron microscopy (TEM) images showed that the CuONPs were spherical, with an average size of 50-100 nm. The scanning electron microscopy (SEM)-energy dispersive spectroscopy (EDS) peak was observed approximately at 1 and 8 keV. The X-ray diffraction (XRD) studies indicated that the particles were crystalline in nature. CuONPs effectively inhibited the growth of phytopathogens Ralstonia solanacearum and Xanthomonas axonopodis. The cytotoxic effect of the synthesized CuONPs was analyzed using rat splenocytes. The cell viability was decreased to 94% at 300 μg/mL.
Directory of Open Access Journals (Sweden)
Carlos A Lopes
2011-06-01
Full Text Available A batata-semente é comercializada no Brasil em diferentes tamanhos, conforme determinação do MAPA, variando do tipo 0 (zero, com tubérculos acima de 60 mm, até o tipo V, com tubérculos menores que 23 mm. Neste trabalho, foi avaliado o efeito do tamanho do tubérculo da batata-semente na manifestação da murcha bacteriana nas cultivares Agata, BRS Ana, Asterix e Bintje, em campo naturalmente infestado com Ralstonia solanacearum, em Brasília-DF. Foram usados tubérculos pequenos, médios e grandes, com aproximadamente 30, 50 e 90 mm em média, tamanhos correspondentes respectivamente aos tipos IV, II e 0 das normas do MAPA. Diferenças significativas quanto à incidência da doença foram encontradas entre cultivares: BRS Ana e Asterix não diferiram entre si e foram mais resistentes que Agata e Bintje que, por sua vez, tampouco diferiram entre si. As diferenças entre tamanhos de tubérculos e as interações entre cultivar e tamanho de tubérculos não foram significativas. Portanto concluiu-se que o tamanho de tubérculos dentro dos limites avaliados neste trabalho, não interferiu na manifestação da doença em testes de avaliação para resistência à murcha bacteriana.Potato seed tubers in Brazil are commercialized in different sizes as determined by the Ministry of Agriculture, Livestock and Food Supply. The sizes are classified in types, which vary from type 0 (zero, tubers above 60 mm, up to type V, tubers below 23 mm. In this work, we evaluated the influence of seed tuber size on the incidence of bacterial wilt on cultivars Agata, BRS Ana, Asterix, and Bintje, grown in a field naturally infested with Ralstonia solanacearum, in Brasilia, Brazil. We used small, medium and large tubers, measuring in average 30, 50 and 90 mm, which correspond respectively to types IV, II and 0 according to the Brazilian legislation. Significant differences in bacterial wilt incidences were detected among cultivars: BRS Ana and Asterix did not
Directory of Open Access Journals (Sweden)
Liane Cristine Rebouças Demosthenes
2011-01-01
Full Text Available A murcha bacteriana, causada por Ralstonia solanacearum, é uma das doenças mais importantes do gênero Capsicum no Brasil. No Amazonas, as condições de elevada temperatura e umidade favorecem o desenvolvimento da doença. O objetivo deste trabalho foi avaliar a resistência à murcha bacteriana de germoplasma, selvagem e comercial, de Capsicum spp. Foram avaliados 22 acessos de Capsicum em casa de vegetação. A inoculação foi feita mediante ferimento das raízes, seguido de adição no solo, ao redor das plantas, de suspensão bacteriana na concentração de 10(8 ufc mL-1. A avaliação foi feita diariamente a partir do quarto dia após a inoculação, em função desenvolvimento dos sintomas. A partir das médias de progresso dos sintomas foi construída a área abaixo da curva de progresso da doença (AACPD, e os dados submetidos ao teste de Scott-Knott ao nível de 5% de probabilidade, utilizando o programa estatístico SAEG 9.1. Foram selecionados os acessos 30, 20 e 17, da espécie C. chinense, como resistentes à murcha bacteriana para ensaios futuros em programas de melhoramento genético.The bacterial wilt caused by Ralstonia solanacearum is one of the most important in the genus Capsicum in Brazil. In the state of Amazonas, high temperatures and humidity favor the development of the disease. The objective of this work was to evaluate resistance in germoplasm of wild and commercial Capsicum spp. to bacterial wilt. Twenty two accesses of Capsicum spp. were evaluated in greenhouse conditions. The inoculation was made by means of wounds in the roots, followed by addition of bacterial suspension in the concentration of 10(8 ufc ml-1 in the soil, around the plants. Plant evaluation was made daily after the fourth day of the inoculation (DAI considering the symptoms progress. From the average progress of symptoms was constructed the area under the disease progress curve (AUDPC, and the data submitted to the Scott-Knott test at 5% of
Directory of Open Access Journals (Sweden)
Gauri A. Achari
2014-01-01
Full Text Available Eggplant (Solanum melongena L. is one of the solanaceous crops of economic and cultural importance and is widely cultivated in the state of Goa, India. Eggplant cultivation is severely affected by bacterial wilt caused by Ralstonia solanacearum that colonizes the xylem tissue. In this study, 167 bacteria were isolated from the xylem of healthy eggplant, chilli, and Solanum torvum Sw. by vacuum infiltration and maceration. Amplified rDNA restriction analysis (ARDRA grouped these xylem residing bacteria (XRB into 38 haplotypes. Twenty-eight strains inhibited growth of R. solanacearum and produced volatile and diffusible antagonistic compounds and plant growth promoting substances in vitro. Antagonistic strains XB86, XB169, XB177, and XB200 recorded a biocontrol efficacy greater than 85% against BW and exhibited 12%–22 % increase in shoot length in eggplant in the greenhouse screening. 16S rRNA based identification revealed the presence of 23 different bacterial genera. XRB with high biocontrol and plant growth promoting activities were identified as strains of Staphylococcus sp., Bacillus sp., Streptomyces sp., Enterobacter sp., and Agrobacterium sp. This study is the first report on identity of bacteria from the xylem of solanaceous crops having traits useful in cultivation of eggplant.
S Duggal; R Gur; R Nayar; S R Rongpharpi; D Jain; R K Gupta
2013-01-01
Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and sep...
Directory of Open Access Journals (Sweden)
Mírian Josefina Baptista
2006-03-01
Full Text Available A murcha-bacteriana causada por Ralstonia solanacearum é uma das principais doenças da cultura da batata. A solarização tem sido estudada como opção para a desinfestação do solo e tem potencial para o controle da murcha bacteriana. A técnica é indicada para uso nas estações quentes do ano pois depende de condições climáticas adequadas. Devido ao período de plantio de determinadas culturas, é interessante avaliar o uso da solarização em outras épocas do ano e associada a outras técnicas para garantir sua eficiência. A biofumigação é a desinfestação do solo através da adição de matéria orgânica que, durante sua decomposição, libera substâncias tóxicas aos fitopatógenos. Neste trabalho avaliou-se durante o outono (maio a junho os efeitos da adição de cama de aves (biofumigação e da solarização na incidência natural da murcha-bacteriana e na produtividade da batata, através dos tratamentos: adição de cama de aves (20 t/ha, uréia (100 kg/ha, aplicação de brometo de metila e solo sem tratamento (testemunha, todos solarizados ou não solarizados. Avaliou-se a produção de tubérculos totais e comerciais e, a partir da incidência de murcha-bacteriana, foi feito o cálculo da área abaixo da curva de progresso da doença (AACPD. Na área infestada, apenas o uso do brometo de metila proporcionou reduções significativas na incidência da murcha-bacteriana. No entanto, a aplicação de brometo de metila e a adição de cama de aves em associação com a solarização possibilitaram produção significativamente maior de tubérculos de batata em relação à testemunha. Os efeitos da solarização associada à biofumigação com cama de aves sobre a produtividade da batata em área infestada com R. solanacearum devem ser melhor investigados.Bacterial wilt caused by Ralstonia solanacearum is one of the most important diseases of the potato. Soil solarization has been studied as an option for soilborne
Duggal, S; Gur, R; Nayar, R; Rongpharpi, S R; Jain, D; Gupta, R K
2013-01-01
Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.
Directory of Open Access Journals (Sweden)
S Duggal
2013-01-01
Full Text Available Ralstonia paucula (formerly classified as CDC (Centre for Disease Control group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.
Origin and evolution of GALA-LRR, a new member of the CC-LRR subfamily: from plants to bacteria?
Directory of Open Access Journals (Sweden)
Andrey V Kajava
Full Text Available The phytopathogenic bacterium Ralstonia solanacearum encodes type III effectors, called GALA proteins, which contain F-box and LRR domains. The GALA LRRs do not perfectly fit any of the previously described LRR subfamilies. By applying protein sequence analysis and structural prediction, we clarify this ambiguous case of LRR classification and assign GALA-LRRs to CC-LRR subfamily. We demonstrate that side-by-side packing of LRRs in the 3D structures may control the limits of repeat variability within the LRR subfamilies during evolution. The LRR packing can be used as a criterion, complementing the repeat sequences, to classify newly identified LRR domains. Our phylogenetic analysis of F-box domains proposes the lateral gene transfer of bacterial GALA proteins from host plants. We also present an evolutionary scenario which can explain the transformation of the original plant LRRs into slightly different bacterial LRRs. The examination of the selective evolutionary pressure acting on GALA proteins suggests that the convex side of their horse-shoe shaped LRR domains is more prone to positive selection than the concave side, and we therefore hypothesize that the convex surface might be the site of protein binding relevant to the adaptor function of the F-box GALA proteins. This conclusion provides a strong background for further functional studies aimed at determining the role of these type III effectors in the virulence of R. solanacearum.
Directory of Open Access Journals (Sweden)
ELIZABETH ROJAS FERNÁNDEZ
Full Text Available Los polihidroxialcanoatos (PHAs son poliésteres intracelulares sintetizados por diferentes especies bacterianas, las cuales los acumulan como gránulos cuando se encuentran en condiciones limitantes de nutrientes esenciales para su crecimiento como el oxígeno, nitrógeno y carbono, son biodegradables y, dependiendo de su composición química y estructural, pueden ser empleados en aplicaciones semejantes a los polímeros [1].En la actualidad, este tipo de biopolímeros presentan un mayor costo comparado con los derivados del petróleo, pero el uso de fuentes renovables y el aprovechamiento de subproductos agroindustriales para la generación de nuevos productos es una alternativa ecológica de importancia mundial. En la presente investigación se estudió la producción de polihidroxialcanoatos (PHA mediante fermentación bacteriana de glucosa, obtenida a partir de harina de yuca HMC1 empleando Ralstonia eutropha en un medio con cinco relaciones carbono/nitrógeno(12:1, 16:1, 20:1, 24:1, 28:1. Se obtuvo como resultado, que la relación carbono/nitrógeno de 20 es la que más favorece la acumulación intracelular de biopolímero, con la cual se alcanza una producción de 0,62 g/L de PHA. El PHA sintetizado se caracterizó por medio de calorimetría diferencial de barrido (DSC, Análisis Termogravimetrico (TGA, Espectroscopía de Infrarrojo con Transformada de Fourier (IR-FT y Microscopía electrónica de Barrido (SEM, concluyendo que el biopolímero obtenido fue polihidroxibutirato (PHB.
Eggers, Jessica; Steinbüchel, Alexander
2014-01-01
The model organism for polyhydroxybutyrate (PHB) biosynthesis, Ralstonia eutropha H16, possesses multiple isoenzymes of granules coating phasins as well as of PHB depolymerases, which degrade accumulated PHB under conditions of carbon limitation. In this study, recombinant Escherichia coli BL21(DE3) strains were used to study the impact of selected PHB depolymerases of R. eutropha H16 on the growth behavior and on the amount of accumulated PHB in the absence or presence of phasins. For this p...
Induction of in vitro mutation for resistance to potato brown rot (ralstonia solanacearum) disease
International Nuclear Information System (INIS)
Ragab, A. I.; Hassan, I. O. I.; Soliman, M. H.; Gamal El-din, A.
2012-12-01
Six genotypes were selected from M 1 V 2 generation on the bases on their high yield for assessment of genetic variability using protein and RAPD analysis. The results of RAPD analysis showed that 11 primers generated 56 distinct bands of which 31 (55.4%) were polymorphic. The similarity indices of the six mutants of potato and their parents ranged from 70 to 91%. The highest genetic similarity 91% was found between D 20 mutant and Do (Diamant parent), on the other hand, the lowest genetic similarity 705 was found between S 30, S 40 mutants and their parent S 0 (Spunta). In the artificial experiment under in vitro condition, the irradiated and non-irradiated plant lets of potato were cultured on medium inoculates of the selected genotypes form irradiated population of Diamant and Spunta Cultivar were susceptible except S 20 mutant which was resistant. Protein analysis showed that S 20 genotype (Resistant Mutant) displayed 2 negative unique bands that might be responsible for resistance to R. solanacea rum. (Author)
Classification of plant associated bacteria using RIF, a computationally derived DNA marker.
Directory of Open Access Journals (Sweden)
Kevin L Schneider
Full Text Available A DNA marker that distinguishes plant associated bacteria at the species level and below was derived by comparing six sequenced genomes of Xanthomonas, a genus that contains many important phytopathogens. This DNA marker comprises a portion of the dnaA replication initiation factor (RIF. Unlike the rRNA genes, dnaA is a single copy gene in the vast majority of sequenced bacterial genomes, and amplification of RIF requires genus-specific primers. In silico analysis revealed that RIF has equal or greater ability to differentiate closely related species of Xanthomonas than the widely used ribosomal intergenic spacer region (ITS. Furthermore, in a set of 263 Xanthomonas, Ralstonia and Clavibacter strains, the RIF marker was directly sequenced in both directions with a success rate approximately 16% higher than that for ITS. RIF frameworks for Xanthomonas, Ralstonia and Clavibacter were constructed using 682 reference strains representing different species, subspecies, pathovars, races, hosts and geographic regions, and contain a total of 109 different RIF sequences. RIF sequences showed subspecific groupings but did not place strains of X. campestris or X. axonopodis into currently named pathovars nor R. solanacearum strains into their respective races, confirming previous conclusions that pathovar and race designations do not necessarily reflect genetic relationships. The RIF marker also was sequenced for 24 reference strains from three genera in the Enterobacteriaceae: Pectobacterium, Pantoea and Dickeya. RIF sequences of 70 previously uncharacterized strains of Ralstonia, Clavibacter, Pectobacterium and Dickeya matched, or were similar to, those of known reference strains, illustrating the utility of the frameworks to classify bacteria below the species level and rapidly match unknown isolates to reference strains. The RIF sequence frameworks are available at the online RIF database, RIFdb, and can be queried for diagnostic purposes with RIF
Directory of Open Access Journals (Sweden)
Renato Carrer Filho
2009-09-01
Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested
Karakterisasi Parsial Streptomyces spp., Agens Pengendali Hayati Peyakit Lincat Tembakau
Directory of Open Access Journals (Sweden)
Triwidodo Arwiyanto
2007-12-01
Full Text Available Local isolates of Streptomyces spp. were proven could suppress "lincat disease" of tobacco in the field. Six isolates were chosen for partial characterization of their bacteriological properties as based for the next experiments purposes. The results indicated that the isolates produce miselium with spore chains, gram positive, aerob, catalase and oxidase positive. The isolates also hydrolize starch, gelatine and esculine; produce lecithinase enzyme, reduce nitrate to nitrite, do not produce melanine pigment, did not produce hydrogen sulfide. The isolates were sensitive against streptomycine and rifampicin; able to use several carbon and nitrogen sources tested. Capable to grow on several medium pH, from 4,3 to 8,0. The isolates were able to grow from 5° C to 45° C; able to grow on medium containing 4% to 7% NaCl and ion the medium containing 0,1% of phenol. Plant pathogenicity test result showed negative responses which indicated that the used isolates were non plant pathogenic. The ability in suppressing lincat pathogen (Ralstonia solanacearum and Meloidogyne incognita in vitro was vary between isolates. Streptomyces spp, isolat lokal terbukti dapat menekan penyakit lunvat tembakau di lapangan. Sebanyak enam isolat dipilih untuk dicirikan sebagai sifat-sifat bakteriologinya sehingga dapat digunakan sebagai dasar dalam penelitian berikutnya. Penelitian dilakukan terhadap sifat morfologi, fisiologi dan sifat biokimia. Hasil penelitian menunjukkan bahwa isolat yang diteliti menghasilkan miselium yang memproduksi rangkaian spora, Gram positif, aerob, katalase dan oksidase positif. Isolat-isolat tersebut menghidrolisis pati, gelatin, eskulin; membentuk ensim lechitinase, mereduksi nitrat menjadi nitrit, tidak menghasilkan pigmen melanin, tidak membentuk hidrogen sulfida. Isolat yang diteliti peka terhadap antibiotik streptomisin dan nifampisin; mampu menggunakan beberapa sumber karbon dan sumber nitrogen yang diujikan, Kisaran pH untuk
Hernández-Montelongo, Jacobo; Nascimento, Vicente F; Murillo, Duber; Taketa, Thiago B; Sahoo, Prasana; de Souza, Alessandra A; Beppu, Marisa M; Cotta, Monica A
2016-01-20
In this work, nanofilms of hyaluronan/chitosan (HA/CHI) assembled layer by layer were synthesized; their application as a potential antimicrobial material was demonstrated for the phytopathogen Xylella fastidiosa, a gram-negative bacterium, here used as a model. For the synthesis, the influence of pH and ionic strength of these natural polymer stem-solutions on final characteristics of the HA/CHI nanofilms was studied in detail. The antibacterial effect was evaluated using widefield fluorescence microscopy. These results were correlated with the chemical properties of the nanofilms, studied by FTIR and Raman spectroscopy, as well as with their morphology and surface properties characterized using SEM and AFM. The present findings can be extended to design and optimize HA/CHI nanofilms with enhanced antimicrobial behavior for other type of phytopathogenic gram-negative bacteria species, such as Xanthomonas citri, Xanthomas campestri and Ralstonia solanacearum. Copyright © 2015 Elsevier Ltd. All rights reserved.
New Polyphenols from a Deep Sea Spiromastix sp. Fungus, and Their Antibacterial Activities
Directory of Open Access Journals (Sweden)
Siwen Niu
2015-04-01
Full Text Available Eleven new polyphenols namely spiromastols A–K (1–11 were isolated from the fermentation broth of a deep sea-derived fungus Spiromastix sp. MCCC 3A00308. Their structures were determined by extensive NMR data and mass spectroscopic analysis in association with chemical conversion. The structures are classified as diphenyl ethers, diphenyl esters and isocoumarin derivatives, while the n-propyl group in the analogues is rarely found in natural products. Compounds 1–3 exhibited potent inhibitory effects against a panel of bacterial strains, including Xanthomanes vesicatoria, Pseudomonas lachrymans, Agrobacterium tumefaciens, Ralstonia solanacearum, Bacillus thuringensis, Staphylococcus aureus and Bacillus subtilis, with minimal inhibitory concentration (MIC values ranging from 0.25 to 4 µg/mL. The structure-activity relationships are discussed, while the polychlorinated analogues 1–3 are assumed to be a promising structural model for further development as antibacterial agents.
Ouyang, L J; Li, L M
2016-08-01
N-acyl-homoserine lactones (AHLs) are metabolites of mostly gram-negative bacteria and are critical signaling molecules in bacterial quorum-sensing systems. At threshold concentrations, AHLs can activate the expression of pathogenic genes and induce diseases. Therefore, reducing AHL concentrations is a key point of disease control in plants. AHL-lactonase, which is expressed by aiiA, is widespread in Bacillus sp and can hydrolyze AHLs. In the present study, we cloned aiiA from Bacillus subtilis by PCR. A plant expression vector of aiiA was constructed and name Pcam-PPP3-aiiA, in which expression of aiiA was controlled by the pathogen-inducible plant promoter PPP3. The recombinant plasmid was transferred into Eucalyptus × urophylla × E. grandis by an Agrobacterium-mediated transformation. PCR and Southern blotting showed that aiiA was successfully integrated into the E. urophylla × E. grandis genome and its expression was induced by Ralstonia solanacearum 12 h after inoculation, as shown by reverse transcription-PCR. The transcription efficacy of aiiA increased 43.88-, 30.65-, and 18.95-fold after inoculation with R. solanacearum, Erwinia carotovora ssp. zeae (Sabet) and Cylindrocladium quinqueseptatum, respectively as shown by RT-real-time PCR. Transgenic E.urophylla × E.grandis expressing the AIIA protein exhibited significantly enhanced disease resistance compared to non-transgenic plants by delaying the onset of wilting and reducing the disease index.
Hernández-Blanco, Camilo; Feng, Dong Xin; Hu, Jian; Sánchez-Vallet, Andrea; Deslandes, Laurent; Llorente, Francisco; Berrocal-Lobo, Marta; Keller, Harald; Barlet, Xavier; Sánchez-Rodríguez, Clara; Anderson, Lisa K.; Somerville, Shauna; Marco, Yves; Molina, Antonio
2007-01-01
Cellulose is synthesized by cellulose synthases (CESAs) contained in plasma membrane–localized complexes. In Arabidopsis thaliana, three types of CESA subunits (CESA4/IRREGULAR XYLEM5 [IRX5], CESA7/IRX3, and CESA8/IRX1) are required for secondary cell wall formation. We report that mutations in these proteins conferred enhanced resistance to the soil-borne bacterium Ralstonia solanacearum and the necrotrophic fungus Plectosphaerella cucumerina. By contrast, susceptibility to these pathogens was not altered in cell wall mutants of primary wall CESA subunits (CESA1, CESA3/ISOXABEN RESISTANT1 [IXR1], and CESA6/IXR2) or POWDERY MILDEW–RESISTANT5 (PMR5) and PMR6 genes. Double mutants indicated that irx-mediated resistance was independent of salicylic acid, ethylene, and jasmonate signaling. Comparative transcriptomic analyses identified a set of common irx upregulated genes, including a number of abscisic acid (ABA)–responsive, defense-related genes encoding antibiotic peptides and enzymes involved in the synthesis and activation of antimicrobial secondary metabolites. These data as well as the increased susceptibility of ABA mutants (abi1-1, abi2-1, and aba1-6) to R. solanacearum support a direct role of ABA in resistance to this pathogen. Our results also indicate that alteration of secondary cell wall integrity by inhibiting cellulose synthesis leads to specific activation of novel defense pathways that contribute to the generation of an antimicrobial-enriched environment hostile to pathogens. PMID:17351116
Solvent production by engineered Ralstonia eutropha: channeling carbon to biofuel.
Chakravarty, Jayashree; Brigham, Christopher J
2018-06-01
Microbial production of solvents like acetone and butanol was a couple of the first industrial fermentation processes to gain global importance. These solvents are important feedstocks for the chemical and biofuel industry. Ralstonia eutropha is a facultatively chemolithoautotrophic bacterium able to grow with organic substrates or H 2 and CO 2 under aerobic conditions. This bacterium is a natural producer of polyhydroxyalkanoate biopolymers. Recently, with the advances in the development of genetic engineering tools, the range of metabolites R. eutropha can produce has enlarged. Its ability to utilize various carbon sources renders it an interesting candidate host for synthesis of renewable biofuel and solvent production. This review focuses on progress in metabolic engineering of R. eutropha for the production of alcohols, terpenes, methyl ketones, and alka(e)nes using various resources. Biological synthesis of solvents still presents the challenge of high production costs and competition from chemical synthesis. Better understanding of R. eutropha biology will support efforts to engineer and develop superior microbial strains for solvent production. Continued research on multiple fronts is required to engineer R. eutropha for truly sustainable and economical solvent production.
Directory of Open Access Journals (Sweden)
Luciano Façanha Marques
2010-01-01
Full Text Available A murcha bacteriana, causada por Ralstonia solanacearum, é a principal doença vascular de plantas em todo o mundo. O agente causal é uma bactéria que ocorre em todas as regiões do Brasil, predominando em condições de umidade e temperatura elevadas, fatores propícios aodesenvolvimento do patógeno. Este agente causal é de difícil controle, pois sobrevive nos mais diversos hospedeiros, especialmente Solanaceas, além de outras famílias de importância alimentar, condimentar e medicinal. O uso de espécies do gênero Solanum na enxertia convencional e minienxertia em tomateiro Lycopersicon esculentum é limitada em função da incompatibilidade. Neste trabalho, utilizou-se o método da microenxertia para obtenção de plantas resistentes a doenças como a murcha bacteriana, tendo como cavalo a espécie Solanum palinacanthum Dun. Utilizaram-se dois métodos de microenxertia: convencional em T-invertido e corte em bisel. Foram testados meios de culturas para execução das duas práticas demicropropagação; para isso, realizou-se experimento em diferentes condições ambientais, com presença e ausência de luminosidade e diferentes tratamentos correspondentes a teores de açúcares e sais, submetidos a cinco avaliações com intervalos semanais. Melhor resultado foi encontrado quando se utilizou microenxertia em T-invertido e meio de cultura constituído de sais de MS1/8 de força acrescido de 30 g L-1 de sacarose.The bacterial wilt, caused by Ralstonia solanacearum, is the most important vascular disease among plants in the world. The causal agent is a strain of bacteria found in all regions of Brazil, mainly in places with high humidity and temperature. This bacterium is difficult to control with chemical products, being able to survive in diverse hosts, especially in species of Solanaceae as well as other families of great food, condimental, or medicinal importance. The use of species of the genus Solanum has been attempted, but the
Biofilm forming bacteria resident to food processing facilities are a food safety concern due to the potential of biofilms to harbor foodborne bacterial pathogens. When cultured together, Ralstonia insidiosa, a strong biofilm former frequently isolated from produce processing environments, has been ...
biotechnological studies on the irradiated potato (solanum tuberosum) with gamma rays
International Nuclear Information System (INIS)
Hassan, I.O.I.
2011-01-01
Bacterial wilt or brown rot disease caused by Ralstonia solanacearum causes extensive annual losses of different crops especially potato crop. It is considered as one of the limiting factors for potato production and exportation in Egypt. Therefore, the main purposes of this study were to investigate the effect of gamma rays on two potato cultivars (Diamant and Spunta). And, to obtain new genotypes of potato resistant to bacterial wilt disease. This study was carried out in the field and Biotechnology laboratory of the Plant Res. Dept., Nuclear Res. Center, Inshas, Egypt and Genetics Dept., Faculty of Agricultural., Cairo Univ., during 2008-2011. In the field experiment, dry tubers of potato cultivars were irradiated by different doses of gamma rays (20, 30 and 40 Gy) to study the effect of gamma rays on the vegetative and yield traits. The results showed that there are no significant differences between cultivars for all studied traits except a number of tubers per plant trait. Also, there are only highly significant and significant differences between treatments for weight of tubers per plant and number of tubers per plant traits, respectively. However, there are only significant differences between the interactions of cultivars and treatments for plant height and weight of tubers per plant traits. Six genotypes were selected from M 1 V 2 generation depending on high yield for RAPD analysis to determine their genetic variability from its parents at molecular level using 11 primers. The results of RAPD analysis showed that 11 primers generated 56 distinct bands of which 31 (55.4%) were considered as polymorphic. The similarity indices of six genotypes of potato and its parents ranged from 70 to 91%. The highest genetic similarity 91% was found between D20 genotype and its parent D0 (Diamant control). On the other hand, the lowest genetic similarity 70% was found between S30, S40 genotypes and its parent S0 (Spunta control). In the artificial infection experiment
Tropical plant pathology: at home and abroad.
Thurston, H D
2001-01-01
I first describe my introduction to plant pathology and early experiences with employment, the environment, diseases, pests, and various plant pathologists. Then I recount a decade of stimulating studies at the University of Minnesota and the route I followed to a career in international agriculture with the Rockefeller Foundation in Colombia and later at Cornell University. My appreciation for and knowledge of traditional farmers and sustainable agriculture occurred as a slow awakening. Comments are made regarding problems, principles, and satisfactions associated with the improvement of efforts to aid food production in developing countries. My curious love affair with root and tuber crops, especially cassava, is explained and readily defended. My favorite pathogens, Phytophthora infestans and Ralstonia solanacearum, among others, are considered. The pleasures and satisfactions of teaching, writing, and sabbatical leaves are related. Finally, thoughts on the balance between basic and applied research in plant pathology are offered with significant nervousness about the future of our discipline.
Zhu, Zhen; Zhang, Guoyi; Luo, Yi; Ran, Wei; Shen, Qirong
2012-05-01
This work was aimed to produce lipopeptides by Bacillus amyloliquefaciens XZ-173 in solid state fermentation using agro-industrial byproducts. A central composite design was used to get the highest lipopeptides production. Results revealed that the optimal conditions for maximum lipopeptides production were 1.79% starch and 1.91% yeast extract by employing 5.58 g soybean flour and 3.67 g rice straw as the solid substrate with initial pH 7.5, moisture content 55% and a 10% inoculum level at 30°C for 2 days. Under these conditions, the experimental yield of lipopeptides reached 50.01 mg/gds, which was very close to the predicted value (49.91 mg/gds). At high concentration, the lipopeptides extracted from fermented substrates showed strong antibiotic activity against Rhizoctonia solani and Ralstonia solanacearum and certain emulsification but good emulsion stability. This is the first report on lipopeptides production that uses rice straw as a major substrate. Copyright © 2012 Elsevier Ltd. All rights reserved.
Nguyen, Hoa Thi; Yu, Nan Hee; Park, Ae Ran; Park, Hae Woong; Kim, In Seon; Kim, Jin-Cheol
2017-10-28
This study aimed to isolate and characterize antibacterial metabolites from Pharbitis nil seeds and investigate their antibacterial activity against various plant pathogenic bacteria. The methanol extract of P. nil seeds showed the strongest activity against Xanthomonas arboricola pv. pruni (Xap) with a minimum inhibition concentration (MIC) value of 250 μg/ml. Among the three solvent layers obtained from the methanol extract of P. nil seeds, only the butanol layer displayed the activity with an MIC value of 125 μg/ml against Xap. An antibacterial fraction was obtained from P. nil seeds by repeated column chromatography and identified as pharbitin, a crude resin glycoside, by instrumental analysis. The antibacterial activity of pharbitin was tested in vitro against 14 phytopathogenic bacteria, and it was found to inhibit Ralstonia solanacearum and four Xanthomonas species. The minimum inhibitory concentration values against the five bacteria were 125-500 μg/ml for the n-butanol layer and 31.25-125 μg/ml for pharbitin. In a detached peach leaf assay, it effectively suppressed the development of bacterial leaf spot, with a control value of 87.5% at 500 μg/ml. In addition, pharbitin strongly reduced the development of bacterial wilt on tomato seedlings by 97.4% at 250 μg/ml, 7 days after inoculation. These findings suggest that the crude extract of P. nil seeds can be used as an alternative biopesticide for the control of plant diseases caused by R. solanacearum and Xanthomonas spp. This is the first report on the antibacterial activity of pharbitin against phytopathogenic bacteria.
Directory of Open Access Journals (Sweden)
hanyang ecai
2015-09-01
Full Text Available As Ca2+ sensors and effectors, calcium-dependent protein kinases (CDPKs play important roles in regulating the downstream components of calcium signaling, which are ubiquitously involved in plant growth, development, and response to environmental cues. However, no CDPKs have been characterized in Capsicum annuum thus far. Herein, a comprehensive analysis of genes encoding pepper CDPKs and CDPK-related protein kinases (CRKs was performed, and 31 CDPK genes and five closely related kinase genes were identified, which were phylogenetically divided into four distinct subfamilies and unevenly distributed across nine chromosomes. Conserved sequence and exon-intron structures were found to be shared by pepper CDPKs within the same subfamily, and the expansion of the CaCPK family in pepper was found to be due to segmental duplication events. Five CDPKs in the Capsicum annuum variety CM334 were found to be mutated in the Chiltepin variety, and one CDPK present in CM334 was lost in Chiltepin. The majority of CDPK and CRK genes were expressed in different pepper tissues and developmental stages, and 10, 12, and eight CDPK genes were transcriptionally modified by salt, heat, and Ralstonia solanacearum stresses, respectively. Furthermore, these genes were found to respond specifically to one stress as well as respond synergistically to two stresses or three stresses, suggesting that these CDPK genes might be involved in the specific or synergistic response of pepper to salt, heat, and R. solanacearum. Our results lay the foundation for future functional characterization of pepper CDPK and its closely related gene families.
Paenibacillus solanacearum sp. nov., isolated from rhizosphere soil of a tomato plant.
Cho, Hayoung; Heo, Jun; Ahn, Jae-Hyung; Weon, Hang-Yeon; Kim, Jeong-Seon; Kwon, Soon-Wo; Kim, Soo-Jin
2017-12-01
The taxonomic position of a bacterial strain designated T16R-228 T , isolated from a rhizosphere soil sample of a tomato plant collected from a farm in Buyeo, Chungcheongnam-do, Republic of Korea, was determined using a polyphasic approach. On the basis of morphological, genetic and chemotaxonomic characteristics, it was determined to belong to the genus Paenibacillus. It was an aerobic, Gram-stain-positive, non-motile, catalase-negative, oxidase-negative rod with peritrichous flagella. The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, hydroxyl- phosphatidylethanolamine and one unidentified polar lipid. Menaquiones were MK-7. Predominant cellular fatty acids were anteiso-C15 : 0, C16 : 0 and iso-C16 : 0. DNA G+C content was 56.8 mol%. The phylogenetic tree constructed based on the 16S rRNA gene sequences showed the strain formed a clade with P. mucilaginosus VKPM B-7519 T , P. edaphicus T7 T , P. ehimensis KCTC 3748 T , P. koreensis YC300 T , P. tianmuensis B27 T and P. elgii SD17 T , showing the highest sequence similarity with P. mucilaginosus VKPM B-7519 T (96.5 %). The polyphasic data supported that strain T16R-228 T was clearly distinguished from its closely related species and represents a novel species of the genus Paenibacillus for which the name Paenibacillus solanacearum is proposed. The type strain is T16R-228 T (=KACC 18654 T =NBRC 111896 T ).
Energy Technology Data Exchange (ETDEWEB)
Kim, Eun-Jung; Son, Hyeoncheol Francis [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); Kim, Sangwoo [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); School of Nono-Bioscience and Chemical Engineering, Ulsan National Institute of Science and Technology (UNIST), Ulsan 689-798 (Korea, Republic of); Ahn, Jae-Woo [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of); Kim, Kyung-Jin, E-mail: kkim@knu.ac.kr [Structural and Molecular Biology Laboratory, School of Life Sciences and Biotechnology, Kyungpook National University, Daehak-ro 80, Buk-ku, Daegu 702-701 (Korea, Republic of)
2014-02-14
Highlights: • We determined a crystal structure of β-keto thiolase from Ralstonia eutropha H16 (ReBktB). • Distinct substrate binding mode ReBktB was elucidated. • Enzymatic kinetic parameters of ReBktB were revealed. - Abstract: ReBktB is a β-keto thiolase from Ralstonia eutropha H16 that catalyzes condensation reactions between acetyl-CoA with acyl-CoA molecules that contains different numbers of carbon atoms, such as acetyl-CoA, propionyl-CoA, and butyryl-CoA, to produce valuable bioproducts, such as polyhydroxybutyrate, polyhydroxybutyrate-hydroxyvalerate, and hexanoate. We solved a crystal structure of ReBktB at 2.3 Å, and the overall structure has a similar fold to that of type II biosynthetic thiolases, such as PhbA from Zoogloea ramigera (ZrPhbA). The superposition of this structure with that of ZrPhbA complexed with CoA revealed the residues that comprise the catalytic and substrate binding sites of ReBktB. The catalytic site of ReBktB contains three conserved residues, Cys90, His350, and Cys380, which may function as a covalent nucleophile, a general base, and second nucleophile, respectively. For substrate binding, ReBktB stabilized the ADP moiety of CoA in a distinct way compared to ZrPhbA with His219, Arg221, and Asp228 residues, whereas the stabilization of β-mercaptoethyamine and pantothenic acid moieties of CoA was quite similar between these two enzymes. Kinetic study of ReBktB revealed that K{sub m}, V{sub max}, and K{sub cat} values of 11.58 μM, 1.5 μmol/min, and 102.18 s{sup −1}, respectively, and the catalytic and substrate binding sites of ReBktB were further confirmed by site-directed mutagenesis experiments.
Production of polyhydroxy alkanoates by Ralstonia eutropha from volatile fatty acids
Energy Technology Data Exchange (ETDEWEB)
Yun, Jung Hyun; Sawant, Shailesh S.; Kim, Beom Soo [Chungbuk National University, Cheongju (Korea, Republic of)
2013-12-15
Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible thermoplastics that can be synthesized in various microorganisms. Volatile fatty acids (VFAs) are produced by anaerobic treatment of organic wastes that can be utilized as inexpensive substrates for PHA synthesis. In this study, several Ralstonia eutropha strains were grown on the mixture of VFAs (acetic, propionic, and butyric acid) as its carbon and energy source for growth and PHA synthesis. R. eutropha KCTC 2658 accumulated PHAs up to 50% of dry cell weight from total 5 g/L of mixed VFAs (acetic acid : propionic acid : butyric acid=1 : 2 : 2). In batch culture of R. eutropha KCTC2658 in a 5 L fermentor, a homopolymer of poly(3-hydroxybutyrate) [P(3HB)] was produced from 20 g/L glucose as a sole carbon source with dry cell weight of 8.4 g/L and PHA content of 30%. In fed-batch culture, two feeding strategies, pulse or pH-stat, were applied to add VFAs to the fermentor. When VFAs were fed using pH-stat feeding strategy after 40 h, a copolymer of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) [P(3HB-co-3HV)] was produced with dry cell weight of 8.1 g/L, PHA content of 50%, and 3HV fraction of 20 mol%.
Production of polyhydroxy alkanoates by Ralstonia eutropha from volatile fatty acids
International Nuclear Information System (INIS)
Yun, Jung Hyun; Sawant, Shailesh S.; Kim, Beom Soo
2013-01-01
Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible thermoplastics that can be synthesized in various microorganisms. Volatile fatty acids (VFAs) are produced by anaerobic treatment of organic wastes that can be utilized as inexpensive substrates for PHA synthesis. In this study, several Ralstonia eutropha strains were grown on the mixture of VFAs (acetic, propionic, and butyric acid) as its carbon and energy source for growth and PHA synthesis. R. eutropha KCTC 2658 accumulated PHAs up to 50% of dry cell weight from total 5 g/L of mixed VFAs (acetic acid : propionic acid : butyric acid=1 : 2 : 2). In batch culture of R. eutropha KCTC2658 in a 5 L fermentor, a homopolymer of poly(3-hydroxybutyrate) [P(3HB)] was produced from 20 g/L glucose as a sole carbon source with dry cell weight of 8.4 g/L and PHA content of 30%. In fed-batch culture, two feeding strategies, pulse or pH-stat, were applied to add VFAs to the fermentor. When VFAs were fed using pH-stat feeding strategy after 40 h, a copolymer of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) [P(3HB-co-3HV)] was produced with dry cell weight of 8.1 g/L, PHA content of 50%, and 3HV fraction of 20 mol%
Enhanced biofilm formation in dual-species culture of Listeria monocytogenes and Ralstonia insidiosa
Directory of Open Access Journals (Sweden)
Yunfeng Xu
2017-09-01
Full Text Available In the natural environments microorganisms coexist in communities as biofilms. Since foodborne pathogens have varying abilities to form biofilms, investigation of bacterial interactions in biofilm formation may enhance our understanding of the persistence of these foodborne pathogens in the environment. Thus the objective of this study was to investigate the interactions between Listeria monocytogenes and Ralstonia insidiosa in dual species biofilms. Biofilm development after 24 h was measured using crystal violet in 96-well microtiter plate. Scanning electron microscopy and cell enumeration were employed after growth on stainless steel coupons. When compared with their single species counterparts, the dual species biofilms exhibited a significant increase in biofilm biomass. The number of L. monocytogenes in co-culture biofilms on stainless steel also increased significantly. However, there was no effect on the biofilm formation of L. monocytogenes when cultured with R. insidiosa separated by a semi-permeable membrane-linked compartment or cultured in R. insidiosa cell-free supernatant, indicating that direct cell-cell contact is critical for this interaction.
Biological Control of Bacterial Wilt in South East Asia
Directory of Open Access Journals (Sweden)
Triwidodo Arwiyanto
2014-12-01
Full Text Available Bacterial wilt disease caused by Ralstonia solanacearum destroys many crops of different plant families in South East Asia despite many researches about the disease, and the availability of developed control method in other parts of the world. There is no chemical available for the bacterial wilt pathogen and biological control is then chosen as an alternative to save the crops. Most of the biological control studies were based on antagonism between biological control agent and the pathogen. The biological control agents were intended to reduce the initial inoculum of the pathogen. The effort to minimize the initial inoculum of the pathogen by baiting with the use of hypersensitive host-plant was only reliable when conducted in the greenhouse experiments. Various microorganisms have been searched as possible biological control agents, for instance avirulent form of the pathogen, soil or rhizosphere bacteria (Bacillus spp. and fluorescent pseudomonads, actinomycetes (Streptomyces spp., yeast (Pichia uillermondii, Candida ethanolica, and a consortium of microorganisms known as effective microorganisms (EM. None of these biological control agents has been used in field application and they need further investigation in order to effectively control bacterial wilt. Opportunities and challenges in developing biological control to combat bacterial wilt are discussed in the paper. Penyakit layu bakteri yang disebabkan oleh Ralstonia solanacearum menghancurkan banyak tanaman dalam famili yang berbeda di Asia Tenggara meskipun telah banyak penelitian tentang metode pengendaliannya. Penyakit ini sulit dikendalikan karena banyaknya variabilitas patogen dan belum tersedianya sumber ketahanan yang mapan. Di samping itu, sampai saat ini belum ada bahan kimia yang tersedia untuk patogen layu bakteri ini sehingga pengendalian biologi kemudian dipilih sebagai cara alternatif untuk menyelamatkan tanaman. Sebagian besar penelitian pengendalian biologi didasarkan
Mijnendonckx, Kristel; van Houdt, Rob; Provoost, Ann; Bossus, Albert; Ott, C. Mark; Venkateswaran, Kasthuri; Leys, Natalie
The craving of modern man to explore life beyond earth presents a lot of challenges. The control of microbial contamination of the confined manned spacecraft is an important aspect that has to be taken into account in this journey. Because the human body contains a huge amount of microorganisms, the crew itself is the most important contamination source. But contamination can also originate from residing environmental microorganisms or from materials that are supplied from the Earth. These microbial contaminations can cause problems for the astronauts -well documented to have a decreased immunity -and the infrastructure of the space station. In this study, 14 different Cupriavidus metallidurans and Ralstonia pickettii strains, isolated from such space-related environments, where characterised in detail. These unique strains were isolated from drinking water that returned from ISS (3), from the cooling water system of the American ISS segment (4), from a swab sample of the Mars Odyssey Orbitor surface prior to flight (4), and from an air sample taken in the space assembly facility PHSF during Mars exploration Rover assembly (3). Their resistance to heavy metals and antibiotics was screened. The C. metallidurans isolates were more resistant to Zn2+ and Hg+ but more sensitive to Ni2+ than the R. pickettii strains. The MIC values for Cu2+ ranged from 1,5mM to 12mM, for Co2+ from 1,58mM to 12,63mM and for Cd2+ from 0,25mM to 1mM. For Ni2+ , the MIC values were between 2 and 8mM, except for the strain C. metallidurans IV (0502478) that was able to grow on Ni+2 concentrations up to 48mM. A metal of special interest was Ag+ because it is used to sanitize ISS drinking water. The strains isolated from air and surface samples showed a MIC value ranging from 0,35µM to 4µM. The isolates from the water samples had MIC values from 0,3µM to 2µM, which is lower than (or comparable with) the lowest limit of the silver concentration used in the ISS (1,9µM -4,6µM). However, all
Jugder, Bat-Erdene; Lebhar, Helene; Aguey-Zinsou, Kondo-Francois; Marquis, Christopher P
2016-01-01
The soluble hydrogenase (SH) from Ralstonia eutropha H16 is a promising candidate enzyme for H2-based biofuel application as it favours H2 oxidation and is relatively oxygen-tolerant. In this report, bioprocess development studies undertaken to produce and purify an active SH are described, based on the methods previously reported [1], [2], [3], [4]. Our modifications are: •Upstream method optimizations were undertaken on heterotrophic growth media and cell lysis involving ultrasonication.•Two anion exchangers (Q Sepharose and RESOURCE Q) and size exclusion chromatographic (Superdex 200) matrices were successfully employed for purification of a hexameric SH from R. eutropha.•The H2 oxidizing activity of the SH was demonstrated spectrophotometrically in solution and also immobilized on an EPG electrode using cyclic voltammetry.
Hiraishi, Tomohiro; Hirahara, Yoko; Doi, Yoshiharu; Maeda, Mizuo; Taguchi, Seiichi
2006-01-01
Poly[(R)-3-hydroxybutyrate] (PHB) depolymerase from Ralstonia pickettii T1 (PhaZRpiT1) adsorbs to denatured PHB (dPHB) via its substrate-binding domain (SBD) to enhance dPHB degradation. To evaluate the amino acid residues participating in dPHB adsorption, PhaZRpiT1 was subjected to a high-throughput screening system consisting of PCR-mediated random mutagenesis targeted to the SBD gene and a plate assay to estimate the effects of mutations in the SBD on dPHB degradation by PhaZRpiT1. Genetic...
Directory of Open Access Journals (Sweden)
N.G. Tessarollo
2013-01-01
Full Text Available Extratos aquosos da planta medicinal Achillea millefolium contêm macromoléculas de interesse para desenvolver fitodefensivos para a agricultura. Duas frações de mil folhas foram obtidas por ultrafiltração, E1 (contendo moléculas maiores que 30 kDa, e E3 (peptídeos entre 1 e 10 kDa que inibiram o crescimento das bactérias fitopatogênicas Ralstonia solanacearum, gram-negativa, e Clavibacter michiganensis subsp. michiganensis, gram-positiva, com dependência de concentração. Os valores de concentração inibitória mínima (CIM para ambos os extratos e bactérias foram baixos, entre 20 e 80µM. A CIM relativa à proteína total evidenciou a presença de macromoléculas muito ativas em E3, embora com baixa concentração proteica. E3 se aplica à prospecção de peptídeos antimicrobianos. Estimar a CIM relativa à quantidade de amostra vegetal valorizou o potencial antimicrobiano natural de E1, que contém alta concentração proteica. E1e E3 se aplicam ao desenvolvimento de fitodefensivos para uso biotecnológico. A ultrafiltração fracionou as amostras de forma nativa, rápida, e com baixo custo; além de dessalinizar, clarificar, purificar, e concentrar E1 e E3. Esse estudo inédito sobre a separômica e a ação antimicrobiana de extratos macromoleculares aquosos de mil folhas sugere que plantas cicatrizantes podem apresentar grande potencial para desenvolver fitodefensivos agrícolas naturais não danosos, à semelhança de medicamentos fitoterápicos.Aqueous extracts from the medicinal plant Achillea millefolium contain macromolecules of interest to develop agrochemicals for agriculture. Two fractions of "mil folhas" were obtained by ultrafiltration, E1 (containing molecules larger than 30 kDa and E3 (peptides between 1 and 10 kDa, which inhibited the growth of phytopathogenic bacteria Ralstonia solanacearum, gram-negative, and Clavibacter michiganensis subsp. michiganensis, gram-positive, concentration-dependent. The values of
International Nuclear Information System (INIS)
Okazaki, Nobuo; Arimori, Takao; Nakazawa, Masami; Miyatake, Kazutaka; Ueda, Mitsuhiro; Tamada, Taro
2011-01-01
The catalytic domain of a novel chitinase, which is a member of GH family 23, from the moderately thermophilic bacterium Ralstonia sp. A-471 was crystallized and diffraction data were collected to 1.85 Å resolution. Chitinase from the moderately thermophilic bacterium Ralstonia sp. A-471 (Ra-ChiC) is divided into two domains: a chitin-binding domain (residues 36–80) and a catalytic domain (residues 103–252). Although the catalytic domain of Ra-ChiC has homology to goose-type lysozyme, Ra-ChiC does not show lysozyme activity but does show chitinase activity. The catalytic domain with part of an interdomain loop (Ra-ChiC 89–252 ) was crystallized under several different conditions using polyethylene glycol as a precipitant. The crystals diffracted to 1.85 Å resolution and belonged to space group P6 1 22 or P6 5 22, with unit-cell parameters a = b = 100, c = 243 Å. The calculated Matthews coefficient was approximately 3.2, 2.4 or 1.9 Å 3 Da −1 assuming the presence of three, four or five Ra-ChiC 89–252 molecules in the asymmetric unit, respectively
Maketon, Monchan; Apisitsantikul, Jirasak; Siriraweekul, Chatchai
2008-04-01
Two biological control agents, Bacillus subtilis AP-01 (Larminar(™)) and Trichoderma harzianum AP-001 (Trisan(™)) alone or/in combination were investigated in controlling three tobacco diseases, including bacterial wilt (Ralstonia solanacearum), damping-off (Pythium aphanidermatum), and frogeye leaf spot (Cercospora nicotiana). Tests were performed in greenhouse by soil sterilization prior to inoculation of the pathogens. Bacterial-wilt and damping off pathogens were drenched first and followed with the biological control agents and for comparison purposes, two chemical fungicides. But for frogeye leaf spot, which is an airborne fungus, a spraying procedure for every treatment including a chemical fungicide was applied instead of drenching. Results showed that neither B. subtilis AP-01 nor T harzianum AP-001 alone could control the bacterial wilt, but when combined, their controlling capabilities were as effective as a chemical treatment. These results were also similar for damping-off disease when used in combination. In addition, the combined B. subtilis AP-01 and T. harzianum AP-001 resulted in a good frogeye leaf spot control, which was not significantly different from the chemical treatment.
Vinaya, K; Kavitha, R; Ananda Kumar, C S; Benaka Prasad, S B; Chandrappa, S; Deepak, S A; Nanjunda Swamy, S; Umesha, S; Rangappa, K S
2009-01-01
Several 1-benzhydryl-sulfonyl-4-(3-(piperidin-4-yl)propyl)piperidine derivatives 8(a-j) were prepared by the treatment of substituted benzhydryl chlorides with 4-(3-(piperidin-4-yl)propyl)piperidine followed by N-sulfonation with sulfonyl chlorides in the presence of dry methylene dichloride and triethyl amine. The synthesized compounds were characterized by (1)H-NMR, IR, and elemental analysis. All the synthesized compounds were evaluated in vitro for their efficacy as antimicrobial agents by artificial inoculation technique against standard strains of two important bacterial viz., Xanthomonas axonopodis pv. vesicatoria and Ralstonia solanacearum as well as and two fungal pathogens namely Alternaria solani and Fusarium solani of tomato plants. We have briefly investigated the structure-activity relation studies and reveal that the nature of substitutions on benzhydryl ring and sulfonamide ring influences the antibacterial activity. Among the synthesized new compounds 8b, 8d, 8g, 8h, 8i, and 8j were showed significant potent antimicrobial activities compared to the standard drugs chloramphenicol, mancozeb.
Raza, Waseem; Wei, Zhong; Ling, Ning; Huang, Qiwei; Shen, Qirong
2016-06-10
Three organic fertilizers made of different animal and plant waste materials (BOFs) were evaluated for their effects on the production of antibacterial volatile organic compounds (VOCs) by two Bacillus amyloliquefaciens strains SQR-9 and T-5 against the tomato wilt pathogen Ralstonia solanacearum (RS). Both strains could produce VOCs that inhibited the growth and virulence traits of RS; however, in the presence of BOFs, the production of antibacterial VOCs was significantly increased. The maximum inhibition of growth and virulence traits of RS by VOCs of T-5 and SQR-9 was determined at 1.5% BOF2 and 2% BOF3, respectively. In case of strain T-5, 2-nonanone, nonanal, xylene, benzothiazole, and butylated hydroxy toluene and in case of strain SQR-9, 2-nonanone, nonanal, xylene and 2-undecanone were the main antibacterial VOCs whose production was increased in the presence of BOFs. The results of this study reveal another significance of using organic fertilizers to improve the antagonistic activity of biocontrol agents against phytopathogens. Copyright © 2016 Elsevier B.V. All rights reserved.
A prophage tail-like protein is deployed by Burkholderia bacteria to feed on fungi.
Swain, Durga Madhab; Yadav, Sunil Kumar; Tyagi, Isha; Kumar, Rahul; Kumar, Rajeev; Ghosh, Srayan; Das, Joyati; Jha, Gopaljee
2017-09-01
Some bacteria can feed on fungi, a phenomenon known as mycophagy. Here we show that a prophage tail-like protein (Bg_9562) is essential for mycophagy in Burkholderia gladioli strain NGJ1. The purified protein causes hyphal disintegration and inhibits growth of several fungal species. Disruption of the Bg_9562 gene abolishes mycophagy. Bg_9562 is a potential effector secreted by a type III secretion system (T3SS) and is translocated into fungal mycelia during confrontation. Heterologous expression of Bg_9562 in another bacterial species, Ralstonia solanacearum, confers mycophagous ability in a T3SS-dependent manner. We propose that the ability to feed on fungi conferred by Bg_9562 may help the bacteria to survive in certain ecological niches. Furthermore, considering its broad-spectrum antifungal activity, the protein may be potentially useful in biotechnological applications to control fungal diseases.Some bacteria can feed on live fungi through unclear mechanisms. Here, the authors show that a T3SS-secreted protein, which is homologous to phage tail proteins, allows a Burkholderia gladioli strain to kill and feed on various fungal species.
Hijacking of the host SCF ubiquitin ligase machinery by plant pathogens
Directory of Open Access Journals (Sweden)
Shimpei eMagori
2011-11-01
Full Text Available The SCF (SKP1-CUL1-F-box protein ubiquitin ligase complex mediates polyubiquitination of proteins targeted for degradation, thereby controlling a plethora of biological processes in eukaryotic cells. Although this ubiquitination machinery is found and functional only in eukaryotes, many non-eukaryotic pathogens also encode F-box proteins, the critical subunits of the SCF complex. Increasing evidence indicates that such non-eukaryotic F-box proteins play an essential role in subverting or exploiting the host ubiquitin/proteasome system for efficient pathogen infection. A recent bioinformatic analysis has identified more than 70 F-box proteins in 22 different bacterial species, suggesting that use of pathogen-encoded F-box effectors in the host cell may be a widespread infection strategy. In this review, we focus on plant pathogen-encoded F-box effectors, such as VirF of Agrobacterium tumefaciens, GALAs of Ralstonia solanacearum, and P0 of Poleroviruses, and discuss the molecular mechanism by which plant pathogens use these factors to manipulate the host cell for their own benefit.
Polyhydroxyalkanoates production with Ralstonia eutropha from low quality waste animal fats.
Riedel, Sebastian L; Jahns, Stefan; Koenig, Steven; Bock, Martina C E; Brigham, Christopher J; Bader, Johannes; Stahl, Ulf
2015-11-20
Polyhydroxyalkanoates (PHAs) are biodegradable and biocompatible polyesters considered as alternatives to petroleum-based plastics. Ralstonia eutropha is a model organism for PHA production. Utilizing industrially rendered waste animal fats as inexpensive carbon feedstocks for PHA production is demonstrated here. An emulsification strategy, without any mechanical or chemical pre-treatment, was developed to increase the bioavailability of solid, poorly-consumable fats. Wild type R. eutropha strain H16 produced 79-82% (w/w) polyhydroxybutyrate (PHB) per cell dry weight (CDW) when cultivated on various fats. A productivity of 0.3g PHB/(L × h) with a total PHB production of 24 g/L was achieved using tallow as carbon source. Using a recombinant strain of R. eutropha that produces poly(hydroxybutyrate-co-hydroxyhexanoate) [P(HB-co-HHx)], 49-72% (w/w) of PHA per CDW with a HHx content of 16-27 mol% were produced in shaking flask experiments. The recombinant strain was grown on waste animal fat of the lowest quality available at lab fermenter scale, resulting in 45 g/L CDW with 60% (w/w) PHA per CDW and a productivity of 0.4 g PHA/(L × h). The final HHx content of the polymer was 19 mol%. The use of low quality waste animal fats as an inexpensive carbon feedstock exhibits a high potential to accelerate the commercialization of PHAs. Copyright © 2015 Elsevier B.V. All rights reserved.
Jüngert, Janina R; Patterson, Cameron; Jendrossek, Dieter
2018-04-20
In this study, we screened PHB synthase PhaC1 and PHB depolymerase PhaZa1 of Ralstonia eutropha for the presence of phosphorylated residues during the PHB accumulation and PHB degradation phase. Thr373 of PHB synthase PhaC1 was phosphorylated in the stationary growth phase but was not modified in the exponential and PHB accumulation phases. Ser35 of PHB depolymerase PhaZa1 was identified in phosphorylated form both in the exponential and in the stationary growth phase. Additional phosphosites were identified for both proteins in sample-dependent forms. Site-directed mutagenesis of the codon for Thr373 and other phosphosites of PhaC1 revealed a strong negative impact on PHB synthase activity. Modification of Thr26 and Ser35 of PhaZa1 reduced the ability of R. eutropha to mobilize PHB in the stationary growth phase. Our results show that phosphorylation of PhaC1 and PhaZa1 can be important for modulation of the activities of PHB synthase and PHB depolymerase. Importance Polyhydroxybutyrate (PHB) and related polyhydroxyalkanoates (PHAs) are important intracellular carbon and energy storage compounds in many prokaryotes. The accumulation of PHB or PHAs increases the fitness of cells during periods of starvation and other stress conditions. The simultaneous presence of poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) and PHB depolymerase (PhaZa1) on synthesized PHB granules in Ralstonia eutropha (alternative designation Cupriavidus necator ) has been previously shown in several laboratories. These findings imply that the activities of PHB synthase and PHB depolymerase should be regulated to avoid a futile cycle of simultaneous synthesis and degradation of PHB. Here, we addressed this question by identifying phosphorylation sites on PhaC1 and PhaZa1 and by site-directed mutagenesis of identified residues. Furthermore, we conducted in vitro and in vivo analysis of PHB synthase activity and PHB contents. Copyright © 2018 American Society for Microbiology.
PHB granules are attached to the nucleoid via PhaM in Ralstonia eutropha.
Wahl, Andreas; Schuth, Nora; Pfeiffer, Daniel; Nussberger, Stephan; Jendrossek, Dieter
2012-11-16
Poly(3-hydroxybutyrate) (PHB) granules are important storage compounds of carbon and energy in many prokaryotes which allow survival of the cells in the absence of suitable carbon sources. Formation and subcellular localization of PHB granules was previously assumed to occur randomly in the cytoplasm of PHB accumulating bacteria. However, contradictionary results on subcellular localization of PHB granules in Ralstonia eutropha were published, recently. Here, we provide evidence by transmission electron microscopy that PHB granules are localized in close contact to the nucleoid region in R. eutropha during growth on nutrient broth. Binding of PHB granules to the nucleoid is mediated by PhaM, a PHB granule associated protein with phasin-like properties that is also able to bind to DNA and to phasin PhaP5. Over-expression of PhaM resulted in formation of many small PHB granules that were always attached to the nucleoid region. In contrast, PHB granules of ∆phaM strains became very large and distribution of granules to daughter cells was impaired. Association of PHB granules to the nucleoid region was prevented by over-expression of PhaP5 and clusters of several PHB granules were mainly localized near the cell poles. Subcellular localization of PHB granules is controlled in R. eutropha and depends on the presence and concentrations of at least two PHB granule associated proteins, PhaM and PhaP5.
Directory of Open Access Journals (Sweden)
Jinhui Wang
Full Text Available Haplotypes A and B of 'Candidatus Liberibacter solanacearum' (CLso are associated with diseases of solanaceous plants, especially Zebra chip disease of potato, and haplotypes C, D and E are associated with symptoms on apiaceous plants. To date, one complete genome of haplotype B and two high quality draft genomes of haplotype A have been obtained for these unculturable bacteria using metagenomics from the psyllid vector Bactericera cockerelli. Here, we present the first genomic sequences obtained for the carrot-associated CLso. These two genomic sequences of haplotype C, FIN114 (1.24 Mbp and FIN111 (1.20 Mbp, were obtained from carrot psyllids (Trioza apicalis harboring CLso. Genomic comparisons between the haplotypes A, B and C revealed that the genome organization differs between these haplotypes, due to large inversions and other recombinations. Comparison of protein-coding genes indicated that the core genome of CLso consists of 885 ortholog groups, with the pan-genome consisting of 1327 ortholog groups. Twenty-seven ortholog groups are unique to CLso haplotype C, whilst 11 ortholog groups shared by the haplotypes A and B, are not found in the haplotype C. Some of these ortholog groups that are not part of the core genome may encode functions related to interactions with the different host plant and psyllid species.
Riedel, Sebastian L; Lu, Jingnan; Stahl, Ulf; Brigham, Christopher J
2014-02-01
Lipid and fatty acid metabolism has been well studied in model microbial organisms like Escherichia coli and Bacillus subtilis. The major precursor of fatty acid biosynthesis is also the major product of fatty acid degradation (β-oxidation), acetyl-CoA, which is a key metabolite for all organisms. Controlling carbon flux to fatty acid biosynthesis and from β-oxidation allows for the biosynthesis of natural products of biotechnological importance. Ralstonia eutropha can utilize acetyl-CoA from fatty acid metabolism to produce intracellular polyhydroxyalkanoate (PHA). R. eutropha can also be engineered to utilize fatty acid metabolism intermediates to produce different PHA precursors. Metabolism of lipids and fatty acids can be rerouted to convert carbon into other value-added compounds like biofuels. This review discusses the lipid and fatty acid metabolic pathways in R. eutropha and how they can be used to construct reagents for the biosynthesis of products of industrial importance. Specifically, how the use of lipids or fatty acids as the sole carbon source in R. eutropha cultures adds value to these biotechnological products will be discussed here.
Directory of Open Access Journals (Sweden)
HADIWIYONO
2011-01-01
Full Text Available Hadiwiyono, Widada J, Subandiyah S, Fegan F (2011 Pulsed Field Gel Electrophoresis (PFGE: a DNA finger printing technique to study the genetic diversity of blood disease bacterium of banana. Biodiversitas 12: 12-16. Blood disease bacterium (BDB is the most important pathogen of bananas in Indonesia. In some field, the disease incidence reaches over 80%. Epidemiologically, the disease is similar to moko disease in South America and bugtok disease in the Philippines caused by Ralstonia solanacearum race 2. However, BDB is different in phenotype and genotype from the two diseases. Previously BDB was limited in South Sulawesi since 1920s – 1980s and recently was reported in 27 of 30 provinces in Indonesia. Pulsed-Field Gel Electrophoresis (PFGE is a genomic DNA fingerprinting method, which employs rare cutting restriction endonucleases to digest genome prior to electrophoresis using specialized condition to separate of large DNA fragments. The results showed that PFGE analysis was a discriminative tool to study the genetic diversity of BDB. Based on the PFGE analysis, BDB isolates obtained from different localities in Yogyakarta and Central Java were quit diverse.
Ahn, Il-Pyung; Lee, Sang-Woo; Kim, Min Gab; Park, Sang-Ryeol; Hwang, Duk-Ju; Bae, Shin-Chul
2011-01-01
A selected strain of rhizobacterium, Pseudomonas putida strain LSW17S (LSW17S), protects tomato plants (Lycopersicon esculentum L. cv. Seokwang) from bacterial speck by biotrophic Pseudomonas syringae pv. tomato strain DC3000 (DC3000) and bacterial wilt by necrotrophic Ralstonia solanacearum KACC 10703 (Rs10703). To investigate defense mechanisms induced by LSW17S in tomato plants, transcription patterns of pathogenesis-related (PR) genes and H2O2 production were analyzed in plants treated with LSW17S and subsequent pathogen inoculation. LSW17S alone did not induce transcriptions of employed PR genes in leaves and roots. DC3000 challenge following LSW17S triggered rapid transcriptions of PR genes and H2O2 production in leaves and roots. Catalase infiltration with DC3000 attenuated defense-related responses and resistance against DC3000 infection. Despite depriving H2O2 production and PR1b transcription by the same treatment, resistance against Rs10703 infection was not deterred significantly. H2O2 is indispensable for defense signaling and/or mechanisms primed by LSW17S and inhibition of bacterial speck, however, it is not involved in resistance against bacterial wilt. PMID:21710203
Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds
Directory of Open Access Journals (Sweden)
Lei Zhou
2017-11-01
Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.
Bae, Chungyun; Han, Sang Wook; Song, Yu-Rim; Kim, Bo-Young; Lee, Hyung-Jin; Lee, Je-Min; Yeam, Inhwa; Heu, Sunggi; Oh, Chang-Sik
2015-07-01
Disease resistance against xylem-colonizing pathogenic bacteria in crops. Plant pathogenic bacteria cause destructive diseases in many commercially important crops. Among these bacteria, eight pathogens, Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, Erwinia amylovora, Pantoea stewartii subsp. stewartii, Clavibacter michiganensis subsp. michiganensis, Pseudomonas syringae pv. actinidiae, and Xylella fastidiosa, infect their host plants through different infection sites and paths and eventually colonize the xylem tissues of their host plants, resulting in wilting symptoms by blocking water flow or necrosis of xylem tissues. Noticeably, only a relatively small number of resistant cultivars in major crops against these vascular bacterial pathogens except X. oryzae pv. oryzae have been found or generated so far, although these pathogens threaten productivity of major crops. In this review, we summarize the lifestyles of major xylem-colonizing bacterial pathogens and then discuss the progress of current research on disease resistance controlled by qualitative disease resistance genes or quantitative trait loci against them. Finally, we propose infection processes of xylem-colonizing bacterial pathogens as one of possible reasons for why so few qualitative disease resistance genes against these pathogens have been developed or identified so far in crops.
Saratale, Ganesh D; Oh, Min-Kyu
2015-09-01
Alkaline pretreatment using NaOH, KOH, or NaOCl has been applied to various types of waste biomass to enhance enzymatic digestibility. Pretreatment (2% NaOH, 121 °C, 30 min) of rice paddy straw (PS) resulted in a maximum yield of 703 mg of reducing sugar per gram of PS with 84.19% hydrolysis yield after a two-step enzymatic hydrolysis process. Ralstonia eutropha ATCC 17699 was tested for its ability to synthesize poly-3-hydroxybutyrate (PHB) using PS hydrolysates as its sole carbon source. It is noteworthy that dry cell weight, polyhydroxyalkanoate (PHA) accumulation and PHB yield with the use of laboratory-grade sugars were similar to those achieved with PS-derived sugars. Under optimized conditions, we observed maximal PHA accumulation (75.45%) and PHB production (11.42 g/L) within 48 h of fermentation. After PHB recovery, the physicochemical properties of PHB were determined by various analytical techniques, showed the results were consistent with the characteristics of a standard polymer of PHB. Thus, the PS hydrolysate proved to be an excellent cheap carbon substrate for PHB production. Copyright © 2015 Elsevier B.V. All rights reserved.
Gu, Yian; Hou, Yugang; Huang, Dapeng; Hao, Zhexia; Wang, Xiaofang; Wei, Zhong; Jousset, Alexandre; Tan, Shiyong; Xu, Dabing; Shen, Qirong; Xu, Yangchun; Friman, Ville Petri
Aims: We evaluated the efficacy of biochar application for suppressing bacterial wilt of tomato and identified the potential underlying mechanisms involved in the disease control. Methods: We measured the impact of two different sized biochar (53–120 μm and 380–830 μm) on bacterial wilt incidence in
Cometabolism of Fluoroanilines in the Presence of 4-Fluoroaniline by Ralstonia sp. FD-1
Directory of Open Access Journals (Sweden)
Wenling Cao
2015-01-01
Full Text Available A strain of Ralstonia sp. FD-1 capable of using 4-fluoroaniline (4-FA as the sole carbon and nitrogen source was investigated for its ability to utilize 4-FA isomers (2-FA, 3-FA and homologs (2,4-DFA, 3,4-DFA, and 2,3,4-TFA. Both 4-FA and 3-FA could be mineralized as the sole carbon and nitrogen source by FD-1. 2-FA, 2,4-DFA, 3,4-DFA, and 2,3,4-TFA could not be degraded by FD-1, respectively, and were selected as secondary substrates for cometabolism with 500 mg/L 4-FA as growth substrate. Bacterial growth (OD600, F− concentrations, and fluoroanilines contents were measured to determinate the degradation ability of 4-FA isomers and homologs by FD-1. FD-1 growth was inhibited by 2,4-DFA, 3,4-DFA, and 2,3,4-TFA at higher concentrations (400 mg/L, except for 2-FA. Complete fluoroanilines degradation was achieved while incomplete defluorination was characterized by the stoichiometric fluoride release indicating partial degradation but not total mineralization. When fluoroaniline was supplied to the resting cells of strain FD-1, a relatively effective removal was showed. Strain FD-1 had broadened application prospect of toxicity and low nutrition fluoroanilines wastewater.
Studies on the production of branched-chain alcohols in engineered Ralstonia eutropha
Energy Technology Data Exchange (ETDEWEB)
Lu, Jingnan [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Chemistry; Brigham, Christopher J.; Gai, Claudia S. [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Biology; Sinskey, Anthony J. [Massachusetts Institute of Technology, Cambridge, MA (United States). Dept. of Biology; Massachusetts Institute of Technology, Cambridge, MA (United States). Div. of Health Sciences and Technology; Massachusetts Institute of Technology, Cambridge, MA (United States). Engineering Systems Div.
2012-10-15
Wild-type Ralstonia eutropha H16 produces polyhydroxybutyrate (PHB) as an intracellular carbon storage material during nutrient stress in the presence of excess carbon. In this study, the excess carbon was redirected in engineered strains from PHB storage to the production of isobutanol and 3-methyl-1-butanol (branched-chain higher alcohols). These branched-chain higher alcohols can directly substitute for fossil-based fuels and be employed within the current infrastructure. Various mutant strains of R. eutropha with isobutyraldehyde dehydrogenase activity, in combination with the overexpression of plasmid-borne, native branched-chain amino acid biosynthesis pathway genes and the overexpression of heterologous ketoisovalerate decarboxylase gene, were employed for the biosynthesis of isobutanol and 3-methyl-1-butanol. Production of these branched-chain alcohols was initiated during nitrogen or phosphorus limitation in the engineered R. eutropha. One mutant strain not only produced over 180 mg/L branched-chain alcohols in flask culture, but also was significantly more tolerant of isobutanol toxicity than wild-type R. eutropha. After the elimination of genes encoding three potential carbon sinks (ilvE, bkdAB, and aceE), the production titer improved to 270 mg/L isobutanol and 40 mg/L 3-methyl-1-butanol. Semicontinuous flask cultivation was utilized to minimize the toxicity caused by isobutanol while supplying cells with sufficient nutrients. Under this semicontinuous flask cultivation, the R. eutropha mutant grew and produced more than 14 g/L branched-chain alcohols over the duration of 50 days. These results demonstrate that R. eutropha carbon flux can be redirected from PHB to branched-chain alcohols and that engineered R. eutropha can be cultivated over prolonged periods of time for product biosynthesis. (orig.)
Tejwani, Vijay; Schmitt, Franz-Josef; Wilkening, Svea; Zebger, Ingo; Horch, Marius; Lenz, Oliver; Friedrich, Thomas
2017-01-01
Ralstonia eutropha is a hydrogen-oxidizing ("Knallgas") bacterium that can easily switch between heterotrophic and autotrophic metabolism to thrive in aerobic and anaerobic environments. Its versatile metabolism makes R. eutropha an attractive host for biotechnological applications, including H 2 -driven production of biodegradable polymers and hydrocarbons. H 2 oxidation by R. eutropha takes place in the presence of O 2 and is mediated by four hydrogenases, which represent ideal model systems for both biohydrogen production and H 2 utilization. The so-called soluble hydrogenase (SH) couples reversibly H 2 oxidation with the reduction of NAD + to NADH and has already been applied successfully in vitro and in vivo for cofactor regeneration. Thus, the interaction of the SH with the cellular NADH/NAD + pool is of major interest. In this work, we applied the fluorescent biosensor Peredox to measure the [NADH]:[NAD + ] ratio in R. eutropha cells under different metabolic conditions. The results suggest that the sensor operates close to saturation level, indicating a rather high [NADH]:[NAD + ] ratio in aerobically grown R. eutropha cells. Furthermore, we demonstrate that multicomponent analysis of spectrally-resolved fluorescence lifetime data of the Peredox sensor response to different [NADH]:[NAD + ] ratios represents a novel and sensitive tool to determine the redox state of cells. Copyright © 2016 Elsevier B.V. All rights reserved.
Aulia, Fatimatul; Susanti, Hilda; Fikri, Edwin Noor
2016-01-01
The research about the effect of applications biofertilizer and mycorhiza to intensity attack of bacterial wilt disease, growth, and yield of tomato was conducted in trial garden of Agriculture Faculty Lambung Mangkurat University from November 2015 until February 2016. The experiment was arranged in a completely randomized design with one factor, four treatments (no treatment (control), biofertilizer, mycorhiza, and biofertilizer + mycorhiza), and five replications. The results of experimen...
Kim, Eun-Jung; Son, Hyeoncheol Francis; Chang, Jeong Ho; Kim, Kyung-Jin
2014-03-01
Polyhydroxyalkanoates are linear polyesters that are produced by bacterial fermentation and are used as biodegradable bioplastics. β-Ketothiolase B (BktB) from Ralstonia eutropha (ReBktB) is a key enzyme for the production of various types of copolymers by catalyzing the condensation reactions of acetyl-CoA with propionyl-CoA and butyryl-CoA. The ReBktB protein was crystallized using the hanging-drop vapour-diffusion method in the presence of 25% polyethylene glycol 3350, 0.1 M bis-tris pH 6.5, 0.2 M lithium sulfate at 295 K. X-ray diffraction data were collected to a maximum resolution of 2.3 Å on a synchrotron beamline. The crystal belonged to space group C2221, with unit-cell parameters a = 106.95, b = 107.24, c = 144.14 Å. With two molecules per asymmetric unit, the crystal volume per unit protein weight (VM) is 2.54 Å(3) Da(-1), which corresponds to a solvent content of approximately 51.5%. The structure was solved by the molecular-replacement method and refinement of the structure is in progress.
Biosynthesis and thermal properties of PHBV produced from levulinic acid by Ralstonia eutropha.
Directory of Open Access Journals (Sweden)
Yuanpeng Wang
Full Text Available Levulinic acid (LA can be cost-effectively produced from a vast array of renewable carbohydrate-containing biomaterials. LA could facilitate the commercialization of the polymer poly(hydroxybutyrate-co-hydroxyvalerate (PHBV and PHBV-based products as carbon substrates. Therefore, this paper focused on the production of PHBV by Ralstonia eutropha with LA for hydroxyvalerate (HV production, which plays an important role in enhancing the thermal properties of PHBV. Accordingly, the HV content of PHBV varied from 0-40.9% at different concentrations of LA. Stimulation of cell growth and PHBV accumulation were observed when 2-6 g L(-1 LA was supplied to the culture. The optimal nitrogen sources were determined to be 0.5 g L(-1 ammonium chloride and 2 g L(-1 casein peptone. It was determined that the optimal pH for cell growth and PHBV accumulation was 7.0. When the cultivation was performed in large scale (2 L fermenter with a low DO concentration of 30% and a pH of 7.0, a high maximum dry cell weight of 15.53 g L(-1 with a PHBV concentration of 12.61 g L(-1 (53.9% HV, up to 81.2% of the dry cell weight, was obtained. The melting point of PHBV found to be decreased as the fraction of HV present in the polymer increased, which resulted in an improvement in the ductility and flexibility of the polymer. The results of this study will improve the understanding of the PHBV accumulation and production by R. eutropha and will be valuable for the industrial production of biosynthesized polymers.
Gilboa-Garber, Nechama; Lerrer, Batya; Lesman-Movshovich, Efrat; Dgani, Orly
2005-12-01
Human milk, serum, saliva, and seminal fluid glycoproteins (gps) nourish and protect newborn and adult tissues. Their saccharides, which resemble cell membrane components, may block pathogen adhesion and infection. In the present study, they were examined by a battery of lectins from plants, animals, and bacteria, using hemagglutination inhibition and Western blot analyses. The lectins included galactophilic ones from Aplysia gonad, Erythrina corallodendron, Maclura pomifera (MPL), peanut, and Pseudomonas aeruginosa (PA-IL); fucose-binding lectins from Pseudomonas aeruginosa (PA-IIL), Ralstonia solanacearum (RSL), and Ulex europaeus (UEA-I), and mannose/glucose-binding Con A. The results demonstrated the chosen lectin efficiency for differential analysis of human secreted gps as compared to CBB staining. They unveiled the diversity of these body fluid gp glycans (those of the milk and seminal fluid being highest): the milk gps interacted most strongly with PA-IIL, followed by RSL; the saliva gps with RSL, followed by PA-IIL and MPL; the serum gps with Con A and MPL, followed by PA-IIL and RSL, and the seminal plasma gps with RSL and MPL, followed by UEA-I and PA-IIL. The potential usage of these lectins as probes for scientific, industrial, and medical purposes, and for quality control of the desired gps is clearly indicated.
Antibacterial activity of caffeine against plant pathogenic bacteria.
Sledz, Wojciech; Los, Emilia; Paczek, Agnieszka; Rischka, Jacek; Motyka, Agata; Zoledowska, Sabina; Piosik, Jacek; Lojkowska, Ewa
2015-01-01
The objective of the present study was to evaluate the antibacterial properties of a plant secondary metabolite - caffeine. Caffeine is present in over 100 plant species. Antibacterial activity of caffeine was examined against the following plant-pathogenic bacteria: Ralstonia solanacearum (Rsol), Clavibacter michiganesis subsp. sepedonicus (Cms), Dickeya solani (Dsol), Pectobacterium atrosepticum (Pba), Pectobacterium carotovorum subsp. carotovorum (Pcc), Pseudomonas syringae pv. tomato (Pst), and Xanthomonas campestris subsp. campestris (Xcc). MIC and MBC values ranged from 5 to 20 mM and from 43 to 100 mM, respectively. Caffeine increased the bacterial generation time of all tested species and caused changes in cell morphology. The influence of caffeine on the synthesis of DNA, RNA and proteins was investigated in cultures of plant pathogenic bacteria with labelled precursors: [(3)H]thymidine, [(3)H]uridine or (14)C leucine, respectively. RNA biosynthesis was more affected than DNA or protein biosynthesis in bacterial cells treated with caffeine. Treatment of Pba with caffeine for 336 h did not induce resistance to this compound. Caffeine application reduced disease symptoms caused by Dsol on chicory leaves, potato slices, and whole potato tubers. The data presented indicate caffeine as a potential tool for the control of diseases caused by plant-pathogenic bacteria, especially under storage conditions.
Directory of Open Access Journals (Sweden)
Yenny Wuryandari
2015-03-01
Full Text Available Formula with active ingridient of fluorescent pseudomonads and its influence on wilt disease development of pepper. The purpose of this study was to synergize organic fertilizer with biopesticides of fluorescent pseudomonads 122 to be the best formula to increase the resistance of pepper plants to wilt disease. The study used a completely randomized design (CRD, which consisted of four treatments. The treatments were forms of active ingredient formula of fluorescent pseudomonads (powder, pellet, granule, and liquid. The effectiveness of the formula in suppressing development of the disease was measured by observing the incubation period, index of the disease and discoloration of vascular tissue of pepper. The results showed that the disease incubation period of plant treated with liquid and powder formula was longer than formula with granule and pellet. Plants treated with powder formula showed the lowest disease index compared to control, liquid, pellet and granule formula. Disease index and discoloration in vascular tissue was also of the lowest value when the plants were treated with powder formula. This result indicate that active ingredient of fluorescent pseudomonads formulated in powder was the most effective to inhibit the development of wilt disease on pepper caused by Fusarium sp. and Ralstonia solanacearum.
Narusaka, Mari; Iuchi, Satoshi; Narusaka, Yoshihiro
2017-03-04
A pair of Arabidopsis thaliana resistance proteins, RPS4 and RRS1, recognizes the cognate Avr effector from the bacterial pathogens Pseudomonas syringae pv. tomato expressing avrRps4 (Pst-avrRps4), Ralstonia solanacearum, and the fungal pathogen Colletotrichum higginsianum and leads to defense signaling activation against the pathogens. In the present study, we analyzed 14 A. thaliana accessions for natural variation in Pst-avrRps4 and C. higginsianum susceptibility, and found new compatible and incompatible Arabidopsis-pathogen interactions. We first found that A. thaliana accession Cvi-0 is susceptible to Pst-avrRps4. Interestingly, the genome sequence assembly indicated that Cvi-0 lost both RPS4 and RRS1, but not RPS4B and RRS1B, compared to the reference genome sequence from A. thaliana accession Col-0. On the other hand, the natural variation analysis of RPS4 alleles from various Arabidopsis accessions revealed that one amino-acid change, Y950H, is responsible for the loss of resistance to Pst-avrRps4 and C. higginsianum in RLD-0. Our data indicate that the amino acid change, Y950H, in RPS4 resulted in the loss of both RPS4 and RRS1 functions and resistance to pathogens.
Directory of Open Access Journals (Sweden)
Takeshi Kawanishi
Full Text Available Culturing is an indispensable technique in microbiological research, and culturing with selective media has played a crucial role in the detection of pathogenic microorganisms and the isolation of commercially useful microorganisms from environmental samples. Although numerous selective media have been developed in empirical studies, unintended microorganisms often grow on such media probably due to the enormous numbers of microorganisms in the environment. Here, we present a novel strategy for designing highly selective media based on two selective agents, a carbon source and antimicrobials. We named our strategy SMART for highly Selective Medium-design Algorithm Restricted by Two constraints. To test whether the SMART method is applicable to a wide range of microorganisms, we developed selective media for Burkholderia glumae, Acidovorax avenae, Pectobacterium carotovorum, Ralstonia solanacearum, and Xanthomonas campestris. The series of media developed by SMART specifically allowed growth of the targeted bacteria. Because these selective media exhibited high specificity for growth of the target bacteria compared to established selective media, we applied three notable detection technologies: paper-based, flow cytometry-based, and color change-based detection systems for target bacteria species. SMART facilitates not only the development of novel techniques for detecting specific bacteria, but also our understanding of the ecology and epidemiology of the targeted bacteria.
Production of fatty acids in Ralstonia eutropha H16 by engineering β-oxidation and carbon storage
Chen, Janice S.; Colón, Brendan; Dusel, Brendon; Ziesack, Marika; Torella, Joseph P.
2015-01-01
Ralstonia eutropha H16 is a facultatively autotrophic hydrogen-oxidizing bacterium capable of producing polyhydroxybutyrate (PHB)-based bioplastics. As PHB’s physical properties may be improved by incorporation of medium-chain-length fatty acids (MCFAs), and MCFAs are valuable on their own as fuel and chemical intermediates, we engineered R. eutropha for MCFA production. Expression of UcFatB2, a medium-chain-length-specific acyl-ACP thioesterase, resulted in production of 14 mg/L laurate in wild-type R. eutropha. Total fatty acid production (22 mg/L) could be increased up to 2.5-fold by knocking out PHB synthesis, a major sink for acetyl-CoA, or by knocking out the acyl-CoA ligase fadD3, an entry point for fatty acids into β-oxidation. As ΔfadD3 mutants still consumed laurate, and because the R. eutropha genome is predicted to encode over 50 acyl-CoA ligases, we employed RNA-Seq to identify acyl-CoA ligases upregulated during growth on laurate. Knockouts of the three most highly upregulated acyl-CoA ligases increased fatty acid yield significantly, with one strain (ΔA2794) producing up to 62 mg/L free fatty acid. This study demonstrates that homologous β-oxidation systems can be rationally engineered to enhance fatty acid production, a strategy that may be employed to increase yield for a range of fuels, chemicals, and PHB derivatives in R. eutropha. PMID:26664804
Production of fatty acids in Ralstonia eutropha H16 by engineering β-oxidation and carbon storage
Directory of Open Access Journals (Sweden)
Janice S. Chen
2015-12-01
Full Text Available Ralstonia eutropha H16 is a facultatively autotrophic hydrogen-oxidizing bacterium capable of producing polyhydroxybutyrate (PHB-based bioplastics. As PHB’s physical properties may be improved by incorporation of medium-chain-length fatty acids (MCFAs, and MCFAs are valuable on their own as fuel and chemical intermediates, we engineered R. eutropha for MCFA production. Expression of UcFatB2, a medium-chain-length-specific acyl-ACP thioesterase, resulted in production of 14 mg/L laurate in wild-type R. eutropha. Total fatty acid production (22 mg/L could be increased up to 2.5-fold by knocking out PHB synthesis, a major sink for acetyl-CoA, or by knocking out the acyl-CoA ligase fadD3, an entry point for fatty acids into β-oxidation. As ΔfadD3 mutants still consumed laurate, and because the R. eutropha genome is predicted to encode over 50 acyl-CoA ligases, we employed RNA-Seq to identify acyl-CoA ligases upregulated during growth on laurate. Knockouts of the three most highly upregulated acyl-CoA ligases increased fatty acid yield significantly, with one strain (ΔA2794 producing up to 62 mg/L free fatty acid. This study demonstrates that homologous β-oxidation systems can be rationally engineered to enhance fatty acid production, a strategy that may be employed to increase yield for a range of fuels, chemicals, and PHB derivatives in R. eutropha.
Volova, T G; Kozhevnikov, I V; Dolgopolova, Iu B; Trusova, M Iu; Kalacheva, G S; Aref'eva, Iu V
2005-01-01
The physiological, biochemical, genetic, and cultural characteristics of the glucose-utilizing mutant strain Ralstonia eutropha B8562 were investigated in comparison with the parent strain R. eutropha B5786. The morphological, cultural, and biochemical characteristics of strain R. eutropha B8562 were similar to those of strain R. eutropha B5786. Genetic analysis revealed differences between the 16S rRNA gene sequences of these strains. The growth characteristics of the mutant using glucose as the sole carbon and energy source were comparable with those of the parent strain grown on fructose. Strain B8562 was characterized by high yields of polyhydroxyalkanoate (PHA) from different carbon sources (CO2, fructose, and glucose). In batch culture with glucose under nitrogen limitation, PHA accumulation reached 90% of dry weight. In PHA, beta-hydroxybutyrate was predominant (over 99 mol %); beta-hydroxyvalerate (0.25-0.72 mol %) and beta-hydroxyhexanoate (0.008-1.5 mol %) were present as minor components. The strain has prospects as a PHA producer on glucose-containing media.
Wenninger, Erik J; Carroll, Amy; Dahan, Jennifer; Karasev, Alexander V; Thornton, Michael; Miller, Jeff; Nolte, Philip; Olsen, Nora; Price, William
2017-12-08
Zebra chip disease (ZC) is an emerging disease of potato in which tubers are produced with striped necrotic patterns that make them unmarketable. ZC is associated with the bacterium "Candidatus Liberibacter solanacearum" (Lso), which is transmitted by the potato psyllid, Bactericera cockerelli (Šulc; Hemiptera: Triozidae). First found in Idaho during 2011, ZC now contributes to increased production costs each season via additional insecticide sprays. To clarify the extent and severity of the threat of ZC in Idaho, we sampled potato psyllids in commercial potato fields across the state over four growing seasons (2012-2015). All life stages of psyllids were sampled using a combination of methods (yellow sticky traps, vacuum samples, and leaf samples), and adult psyllids were tested for the presence of Lso by Polymerase Chain Reaction (PCR). Abundance of potato psyllids initially increased gradually over each growing season, then exhibited a sharp late-season rise and a sharp decline as most fields were being harvested. Abundance of psyllids was higher at warmer, lower elevation sites, but infestation onset did not differ between growing regions. Fewer psyllids were collected in vacuum samples than in sticky trap samples. Nymphs and eggs were found only late season and during years with high abundance of adults. Overall incidence of Lso was similar among all years but one. The results presented here clarify our understanding of the seasonal phenology of potato psyllids and Lso in Idaho potato fields and will aid in developing integrated management strategies against this important pest of potato. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Comparative Genome Analyses of Serratia marcescens FS14 Reveals Its High Antagonistic Potential
Li, Pengpeng; Kwok, Amy H. Y.; Jiang, Jingwei; Ran, Tingting; Xu, Dongqing; Wang, Weiwu; Leung, Frederick C.
2015-01-01
S. marcescens FS14 was isolated from an Atractylodes macrocephala Koidz plant that was infected by Fusarium oxysporum and showed symptoms of root rot. With the completion of the genome sequence of FS14, the first comprehensive comparative-genomic analysis of the Serratia genus was performed. Pan-genome and COG analyses showed that the majority of the conserved core genes are involved in basic cellular functions, while genomic factors such as prophages contribute considerably to genome diversity. Additionally, a Type I restriction-modification system, a Type III secretion system and tellurium resistance genes are found in only some Serratia species. Comparative analysis further identified that S. marcescens FS14 possesses multiple mechanisms for antagonism against other microorganisms, including the production of prodigiosin, bacteriocins, and multi-antibiotic resistant determinants as well as chitinases. The presence of two evolutionarily distinct Type VI secretion systems (T6SSs) in FS14 may provide further competitive advantages for FS14 against other microbes. To our knowledge, this is the first report of comparative analysis on T6SSs in the genus, which identifies four types of T6SSs in Serratia spp.. Competition bioassays of FS14 against the vital plant pathogenic bacterium Ralstonia solanacearum and fungi Fusarium oxysporum and Sclerotinia sclerotiorum were performed to support our genomic analyses, in which FS14 demonstrated high antagonistic activities against both bacterial and fungal phytopathogens. PMID:25856195
The expansion of brown rot disease throughout Bolivia: possible role of climate change.
Castillo, José Antonio; Plata, Giovanna
2016-05-01
Bacterial wilt is a devastating plant disease caused by the bacterial pathogen Ralstonia solanacearum species complex and affects different crops. Bacterial wilt infecting potato is also known as brown rot (BR) and is responsible for significant economic losses in potato production, especially in developing countries. In Bolivia, BR affects up to 75% of the potato crop in areas with high incidence and 100% of stored potatoes. The disease has disseminated since its introduction to the country in the mid-1980s mostly through contaminated seed tubers. To avoid this, local farmers multiply seed tubers in highlands because the strain infecting potatoes cannot survive near-freezing temperatures that are typical in the high mountains. Past disease surveys have shown an increase in seed tubers with latent infection in areas at altitudes lower than 3000 m a.s.l. Since global warming is increasing in the Andes Mountains, in this work, we explored the incidence of BR in areas at altitudes above 3000 m a.s.l. Results showed BR presence in the majority of these areas, suggesting a correlation between the increase in disease incidence and the increase in temperature and the number of irregular weather events resulting from climate change. However, it cannot be excluded that the increasing availability of latently infected seed tubers has boosted the spread of BR.
DNA-binding proteins from marine bacteria expand the known sequence diversity of TALE-like repeats.
de Lange, Orlando; Wolf, Christina; Thiel, Philipp; Krüger, Jens; Kleusch, Christian; Kohlbacher, Oliver; Lahaye, Thomas
2015-11-16
Transcription Activator-Like Effectors (TALEs) of Xanthomonas bacteria are programmable DNA binding proteins with unprecedented target specificity. Comparative studies into TALE repeat structure and function are hindered by the limited sequence variation among TALE repeats. More sequence-diverse TALE-like proteins are known from Ralstonia solanacearum (RipTALs) and Burkholderia rhizoxinica (Bats), but RipTAL and Bat repeats are conserved with those of TALEs around the DNA-binding residue. We study two novel marine-organism TALE-like proteins (MOrTL1 and MOrTL2), the first to date of non-terrestrial origin. We have assessed their DNA-binding properties and modelled repeat structures. We found that repeats from these proteins mediate sequence specific DNA binding conforming to the TALE code, despite low sequence similarity to TALE repeats, and with novel residues around the BSR. However, MOrTL1 repeats show greater sequence discriminating power than MOrTL2 repeats. Sequence alignments show that there are only three residues conserved between repeats of all TALE-like proteins including the two new additions. This conserved motif could prove useful as an identifier for future TALE-likes. Additionally, comparing MOrTL repeats with those of other TALE-likes suggests a common evolutionary origin for the TALEs, RipTALs and Bats. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.
Comparative genome analyses of Serratia marcescens FS14 reveals its high antagonistic potential.
Li, Pengpeng; Kwok, Amy H Y; Jiang, Jingwei; Ran, Tingting; Xu, Dongqing; Wang, Weiwu; Leung, Frederick C
2015-01-01
S. marcescens FS14 was isolated from an Atractylodes macrocephala Koidz plant that was infected by Fusarium oxysporum and showed symptoms of root rot. With the completion of the genome sequence of FS14, the first comprehensive comparative-genomic analysis of the Serratia genus was performed. Pan-genome and COG analyses showed that the majority of the conserved core genes are involved in basic cellular functions, while genomic factors such as prophages contribute considerably to genome diversity. Additionally, a Type I restriction-modification system, a Type III secretion system and tellurium resistance genes are found in only some Serratia species. Comparative analysis further identified that S. marcescens FS14 possesses multiple mechanisms for antagonism against other microorganisms, including the production of prodigiosin, bacteriocins, and multi-antibiotic resistant determinants as well as chitinases. The presence of two evolutionarily distinct Type VI secretion systems (T6SSs) in FS14 may provide further competitive advantages for FS14 against other microbes. To our knowledge, this is the first report of comparative analysis on T6SSs in the genus, which identifies four types of T6SSs in Serratia spp.. Competition bioassays of FS14 against the vital plant pathogenic bacterium Ralstonia solanacearum and fungi Fusarium oxysporum and Sclerotinia sclerotiorum were performed to support our genomic analyses, in which FS14 demonstrated high antagonistic activities against both bacterial and fungal phytopathogens.
Chen, C-M; Liu, J-J; Chou, C-W; Lai, C-H; Wu, L-T
2015-10-01
To investigate the biochemical and functional properties of an extracellular protease, RpA, in Ralstonia pickettii WP1 isolated from water supply systems. An extracellular protease was identified and characterized from R. pickettii WP1. A mutant strain WP1M2 was created from strain WP1 by mini-Tn5 transposition. The culture filtrates from WP1M2 had a lower cytotoxic effect than the parental WP1 on several mammalian cell lines. Cloning and sequence analysis revealed the Tn5 transposon inserted at a protease gene (rpA) which is 81% homologous to prtA and aprX genes of Pseudomonas fluorescens. The rpA gene encodes a 482-residue protein showing sequence similarity to metalloproteases of the serralysin family. The RpA protein was expressed in Escherichia coli using a pET expression vector and purified as a 55 kDa molecular weight protein. Furthermore, the protease activity of RpA was inhibited by protease inhibitor and heat treatment. The in vitro cytotoxic activity of R. pickettii culture filtrates was attributed to RpA protease. An extracellular protease, RpA, was identified from R. pickettii WP1 isolated from water supply system. The RpA metalloproteases is required for the pathogenicity of R. pickettii to mammalian cell lines. © 2015 The Society for Applied Microbiology.
Portable exhausters POR-004 SKID B, POR-005 SKID C, POR-006 SKID D storage plan
International Nuclear Information System (INIS)
Nelson, O.D.; Keller, G.M.
1997-01-01
This document provides a storage plan for portable exhausters POR-004 SKID B, POR-005 SKID C, AND POR-006 SKID D. The exhausters will be stored until they are needed by the TWRS (Tank Waste Remediation Systems) Saltwell Pumping Program. The storage plan provides criteria for portable exhauster storage, periodic inspections during storage, and retrieval from storage
Pfeiffer, Daniel; Jendrossek, Dieter
2014-01-01
Poly(3-hydroxybutyrate) (PHB) synthase (PhaC1) is the key enzyme of PHB synthesis in Ralstonia eutropha and other PHB-accumulating bacteria and catalyzes the polymerization of 3-hydroxybutyryl-CoA to PHB. Activity assays of R. eutropha PHB synthase are characterized by the presence of lag phases and by low specific activity. It is assumed that the lag phase is caused by the time necessary to convert the inactive PhaC1 monomer into the active dimeric form by an unknown priming process. The lag phase can be reduced by addition of nonionic detergents such as hecameg [6-O-(N-heptyl-carbamoyl)-methyl-α-D-glucopyranoside], which apparently accelerates the formation of PhaC1 dimers. We identified the PHB granule-associated protein (PGAP) PhaM as the natural primer (activator) of PHB synthase activity. PhaM was recently discovered as a novel type of PGAP with multiple functions in PHB metabolism. Addition of PhaM to PHB synthase assays resulted in immediate polymerization of 3HB coenzyme A with high specific activity and without a significant lag phase. The effect of PhaM on (i) PhaC1 activity, (ii) oligomerization of PhaC1, (iii) complex formation with PhaC1, and (iv) PHB granule formation in vitro and in vivo was shown by cross-linking experiments of purified proteins (PhaM, PhaC1) with glutardialdehyde, by size exclusion chromatography, and by fluorescence microscopic detection of de novo-synthesized PHB granules.
Franz, A; Rehner, R; Kienle, A; Grammel, H
2012-01-01
The application of Ralstonia eutropha H16 for producing polyhydroxyalkanoates as bioplastics is limited by the incapability of the bacterium to utilize glucose as a growth substrate. This study aims in characterizing glucose-utilizing strains that arose after incubation with high glucose levels, in comparison with previously published mutants, generated either by mutagenesis or by metabolic engineering. Cultivations on solid and liquid media showed that the application of high substrate concentrations rapidly induced a glucose-positive phenotype. The time span until the onset of growth and the frequency of glucose-utilizing colonies were correlated to the initial glucose concentration. All mutants exhibited elevated activities of glucose-6-phosphate dehydrogenase. The glucose-positive phenotype was abolished after deleting genes for the N-acetylglucosamine phosphotransferase system. A procedure is provided for selecting glucose-utilizing R. eutropha H16 in an unprecedented short time period and without any mutagenic treatment. An altered N-acetylglucosamine phosphotransferase system appears to be a common motif in all glucose-utilizing mutants examined so far. The correlation of the applied glucose concentration and the appearance of glucose-utilizing mutants poses questions about the randomness or the specificity of adaptive mutations in general. Furthermore, glucose-adapted strains of R. eutropha H16 could be useful for the production of bioplastics. © 2011 The Authors. Letters in Applied Microbiology ©2011 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
Kee Hoon Sohn
2014-10-01
Full Text Available Plant nucleotide-binding leucine-rich repeat (NB-LRR disease resistance (R proteins recognize specific "avirulent" pathogen effectors and activate immune responses. NB-LRR proteins structurally and functionally resemble mammalian Nod-like receptors (NLRs. How NB-LRR and NLR proteins activate defense is poorly understood. The divergently transcribed Arabidopsis R genes, RPS4 (resistance to Pseudomonas syringae 4 and RRS1 (resistance to Ralstonia solanacearum 1, function together to confer recognition of Pseudomonas AvrRps4 and Ralstonia PopP2. RRS1 is the only known recessive NB-LRR R gene and encodes a WRKY DNA binding domain, prompting suggestions that it acts downstream of RPS4 for transcriptional activation of defense genes. We define here the early RRS1-dependent transcriptional changes upon delivery of PopP2 via Pseudomonas type III secretion. The Arabidopsis slh1 (sensitive to low humidity 1 mutant encodes an RRS1 allele (RRS1SLH1 with a single amino acid (leucine insertion in the WRKY DNA-binding domain. Its poor growth due to constitutive defense activation is rescued at higher temperature. Transcription profiling data indicate that RRS1SLH1-mediated defense activation overlaps substantially with AvrRps4- and PopP2-regulated responses. To better understand the genetic basis of RPS4/RRS1-dependent immunity, we performed a genetic screen to identify suppressor of slh1 immunity (sushi mutants. We show that many sushi mutants carry mutations in RPS4, suggesting that RPS4 acts downstream or in a complex with RRS1. Interestingly, several mutations were identified in a domain C-terminal to the RPS4 LRR domain. Using an Agrobacterium-mediated transient assay system, we demonstrate that the P-loop motif of RPS4 but not of RRS1SLH1 is required for RRS1SLH1 function. We also recapitulate the dominant suppression of RRS1SLH1 defense activation by wild type RRS1 and show this suppression requires an intact RRS1 P-loop. These analyses of RRS1SLH1 shed
Sznajder, Anna; Pfeiffer, Daniel; Jendrossek, Dieter
2015-03-01
Identification of proteins that were present in a polyhydroxybutyrate (PHB) granule fraction isolated from Ralstonia eutropha but absent in the soluble, membrane, and membrane-associated fractions revealed the presence of only 12 polypeptides with PHB-specific locations plus 4 previously known PHB-associated proteins with multiple locations. None of the previously postulated PHB depolymerase isoenzymes (PhaZa2 to PhaZa5, PhaZd1, and PhaZd2) and none of the two known 3-hydroxybutyrate oligomer hydrolases (PhaZb and PhaZc) were significantly present in isolated PHB granules. Four polypeptides were found that had not yet been identified in PHB granules. Three of the novel proteins are putative α/β-hydrolases, and two of those (A0671 and B1632) have a PHB synthase/depolymerase signature. The third novel protein (A0225) is a patatin-like phospholipase, a type of enzyme that has not been described for PHB granules of any PHB-accumulating species. No function has been ascribed to the fourth protein (A2001), but its encoding gene forms an operon with phaB2 (acetoacetyl-coenzyme A [CoA] reductase) and phaC2 (PHB synthase), and this is in line with a putative function in PHB metabolism. The localization of the four new proteins at the PHB granule surface was confirmed in vivo by fluorescence microscopy of constructed fusion proteins with enhanced yellow fluorescent protein (eYFP). Deletion of A0671 and B1632 had a minor but detectable effect on the PHB mobilization ability in the stationary growth phase of nutrient broth (NB)-gluconate cells, confirming the functional involvement of both proteins in PHB metabolism. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Lauterbach, Lars; Idris, Zulkifli; Vincent, Kylie A.; Lenz, Oliver
2011-01-01
The NAD+-reducing soluble hydrogenase (SH) from Ralstonia eutropha H16 catalyzes the H2-driven reduction of NAD+, as well as reverse electron transfer from NADH to H+, in the presence of O2. It comprises six subunits, HoxHYFUI2, and incorporates a [NiFe] H+/H2 cycling catalytic centre, two non-covalently bound flavin mononucleotide (FMN) groups and an iron-sulfur cluster relay for electron transfer. This study provides the first characterization of the diaphorase sub-complex made up of HoxF and HoxU. Sequence comparisons with the closely related peripheral subunits of Complex I in combination with UV/Vis spectroscopy and the quantification of the metal and FMN content revealed that HoxFU accommodates a [2Fe2S] cluster, FMN and a series of [4Fe4S] clusters. Protein film electrochemistry (PFE) experiments show clear electrocatalytic activity for both NAD+ reduction and NADH oxidation with minimal overpotential relative to the potential of the NAD+/NADH couple. Michaelis-Menten constants of 56 µM and 197 µM were determined for NADH and NAD+, respectively. Catalysis in both directions is product inhibited with K I values of around 0.2 mM. In PFE experiments, the electrocatalytic current was unaffected by O2, however in aerobic solution assays, a moderate superoxide production rate of 54 nmol per mg of protein was observed, meaning that the formation of reactive oxygen species (ROS) observed for the native SH can be attributed mainly to HoxFU. The results are discussed in terms of their implications for aerobic functioning of the SH and possible control mechanism for the direction of catalysis. PMID:22016788
Directory of Open Access Journals (Sweden)
A. Ruiz Lascano
2002-12-01
Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.
Comparative genome analyses of Serratia marcescens FS14 reveals its high antagonistic potential.
Directory of Open Access Journals (Sweden)
Pengpeng Li
Full Text Available S. marcescens FS14 was isolated from an Atractylodes macrocephala Koidz plant that was infected by Fusarium oxysporum and showed symptoms of root rot. With the completion of the genome sequence of FS14, the first comprehensive comparative-genomic analysis of the Serratia genus was performed. Pan-genome and COG analyses showed that the majority of the conserved core genes are involved in basic cellular functions, while genomic factors such as prophages contribute considerably to genome diversity. Additionally, a Type I restriction-modification system, a Type III secretion system and tellurium resistance genes are found in only some Serratia species. Comparative analysis further identified that S. marcescens FS14 possesses multiple mechanisms for antagonism against other microorganisms, including the production of prodigiosin, bacteriocins, and multi-antibiotic resistant determinants as well as chitinases. The presence of two evolutionarily distinct Type VI secretion systems (T6SSs in FS14 may provide further competitive advantages for FS14 against other microbes. To our knowledge, this is the first report of comparative analysis on T6SSs in the genus, which identifies four types of T6SSs in Serratia spp.. Competition bioassays of FS14 against the vital plant pathogenic bacterium Ralstonia solanacearum and fungi Fusarium oxysporum and Sclerotinia sclerotiorum were performed to support our genomic analyses, in which FS14 demonstrated high antagonistic activities against both bacterial and fungal phytopathogens.
Matrix approach to the simultaneous detection of multiple potato pathogens by real-time PCR.
Nikitin, M M; Statsyuk, N V; Frantsuzov, P A; Dzhavakhiya, V G; Golikov, A G
2018-03-01
Create a method for highly sensitive, selective, rapid and easy-to-use detection and identification of economically significant potato pathogens, including viruses, bacteria and oomycetes, be it single pathogen, or a range of various pathogens occurring simultaneously. Test-systems for real-time PCR, operating in the unified amplification regime, have been developed for Phytophthora infestans, Pectobacterium atrosepticum, Dickeya dianthicola, Dickeya solani, Ralstonia solanacearum, Pectobacterium carotovorum, Clavibacter michiganensis subsp. sepedonicus, potato viruses Y (ordinary and necrotic forms as well as indiscriminative test system, detecting all forms), A, X, S, M, potato leaf roll virus, potato mop top virus and potato spindle tuber viroid. The test-systems (including polymerase and revertase) were immobilized and lyophilized in miniature microreactors (1·2 μl) on silicon DNA/RNA microarrays (micromatrices) to be used with a mobile AriaDNA ® amplifier. Preloaded 30-reaction micromatrices having shelf life of 3 and 6 months (for RNA- and DNA-based pathogens, respectively) at room temperature with no special conditions were successfully tested on both reference and field samples in comparison with traditional ELISA and microbiological methods, showing perfect performance and sensitivity (1 pg). The accurate, rapid and user-friendly diagnostic system in a micromatrix format may significantly contribute to pathogen screening and phytopathological studies. © 2018 The Authors. Journal of Applied Microbiology published by John Wiley & Sons Ltd on behalf of The Society for Applied Microbiology.
Towards allele mining of bacterial wilt disease resistance gene in tomato
International Nuclear Information System (INIS)
Galvez, H.F.; Narciso, J.O.; Opina, N.L.; Canama, A.O.; Colle, M.G.; Latiza, M.A.; Caspillo, C.L.; Bituin, J.L.; Frankie, R.B.; Hautea, D.M.
2005-01-01
Tomato (Lycopersicon esculentum Mill.) is the most important vegetable commodity of the Philippines. Bacterial wilt caused by Ralstonia solanacearum is one serious constraint in tomato production particularly during off-season planting. A major locus derived from H7996 that confers resistance to bacterial wilt has been mapped in the tomato genome. To validate the biological function of the resistance locus and generate multiple allele -mimics-, targeted mutation was induced in tomato using gamma ray and ethyl methane sulfonate (EMS) mutagens. Suitable mutagen treatment was established by evaluating a wide range of mutagen doses/concentrations for a) percent seed germination, b) reduction in plant height, and c) loss of resistance. Six hundred Gy and 1.0% EMS were identified to generate large M1 families of H7996. From 10,000 initial seeds treated with either gamma ray or EMS, a total of 3,663 M1 plants were generated. M2 seeds were harvested from all surviving M1 plants. Several DNA markers have been resourced and are being developed specific to the bacterial wilt resistant gene. In the large M2 population, of H7996, both the phenotypic manifestation of bacterial wilt susceptibility and nucleotide changes in the resistance locus will be evaluated. Large M3 families for the different allele series of the bacterial wilt resistance gene will be established for future high throughput TILLING (Targeting Induced Local Lesions in Genomes) analysis in the gene region
Top 10 plant pathogenic bacteria in molecular plant pathology.
Mansfield, John; Genin, Stephane; Magori, Shimpei; Citovsky, Vitaly; Sriariyanum, Malinee; Ronald, Pamela; Dow, Max; Verdier, Valérie; Beer, Steven V; Machado, Marcos A; Toth, Ian; Salmond, George; Foster, Gary D
2012-08-01
Many plant bacteriologists, if not all, feel that their particular microbe should appear in any list of the most important bacterial plant pathogens. However, to our knowledge, no such list exists. The aim of this review was to survey all bacterial pathologists with an association with the journal Molecular Plant Pathology and ask them to nominate the bacterial pathogens they would place in a 'Top 10' based on scientific/economic importance. The survey generated 458 votes from the international community, and allowed the construction of a Top 10 bacterial plant pathogen list. The list includes, in rank order: (1) Pseudomonas syringae pathovars; (2) Ralstonia solanacearum; (3) Agrobacterium tumefaciens; (4) Xanthomonas oryzae pv. oryzae; (5) Xanthomonas campestris pathovars; (6) Xanthomonas axonopodis pathovars; (7) Erwinia amylovora; (8) Xylella fastidiosa; (9) Dickeya (dadantii and solani); (10) Pectobacterium carotovorum (and Pectobacterium atrosepticum). Bacteria garnering honourable mentions for just missing out on the Top 10 include Clavibacter michiganensis (michiganensis and sepedonicus), Pseudomonas savastanoi and Candidatus Liberibacter asiaticus. This review article presents a short section on each bacterium in the Top 10 list and its importance, with the intention of initiating discussion and debate amongst the plant bacteriology community, as well as laying down a benchmark. It will be interesting to see, in future years, how perceptions change and which bacterial pathogens enter and leave the Top 10. © 2012 The Authors. Molecular Plant Pathology © 2012 BSPP and Blackwell Publishing Ltd.
Portable exhauster POR-007/Skid E and POR-008/Skid F storage plan
International Nuclear Information System (INIS)
Nelson, O.D.
1998-01-01
This document provides storage requirements for 1,000 CFM portable exhausters POR-O07/Skid E and POR-008/Skid F. These requirements are presented in three parts: preparation for storage, storage maintenance and testing, and retrieval from storage. The exhauster component identification numbers listed in this document contain the prefix POR-007 or POR-008 depending on which exhauster is being used
Sedighi, Mahsa; Zamir, Seyed Morteza; Vahabzadeh, Farzaneh
2016-01-01
The degradability of ethyl mercaptan (EM), by phenol-utilizing cells of Ralstonia eutropha, in both suspended and immobilized culture systems, was investigated in the present study. Free-cells experiments conducted at EM concentrations ranging from 1.25 to 14.42 mg/l, showed almost complete removal of EM at concentrations below 10.08 mg/l, which is much higher than the maximum biodegradable EM concentration obtained in experiments that did not utilize phenol as the primary substrate, i.e. 2.5 mg/l. The first-order kinetic rate constant (kSKS) for EM biodegradation by the phenol-utilizing cells (1.7 l/g biomass/h) was about 10 times higher than by cells without phenol utilization. Immobilized-cells experiments performed in a gas recycling trickle-bed reactor packed with kissiris particles at EM concentrations ranging from 1.6 to 36.9 mg/l, showed complete removal at all tested concentrations in a much shorter time, compared with free cells. The first-order kinetic rate constant (rmaxKs) for EM utilization was 0.04 l/h for the immobilized system compared to 0.06 for the suspended-growth culture, due to external mass transfer diffusion. Diffusion limitation was decreased by increasing the recycling-liquid flow rate from 25 to 65 ml/min. The removed EM was almost completely mineralized according to TOC and sulfate measurements. Shut down and starvation experiments revealed that the reactor could effectively handle the starving conditions and was reliable for full-scale application. Copyright © 2015 Elsevier Ltd. All rights reserved.
DESAJUSTE EDUCATIVO POR REGIONES EN COLOMBIA: ¿COMPETENCIA POR SALARIOS O POR PUESTOS DE TRABAJO?
Directory of Open Access Journals (Sweden)
Maribel Castillo Caicedo
2007-06-01
Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación, entendida como un desajuste por exceso, entre el nivel educativo alcanzado por el individuo y el exigido por el puesto de trabajo en el cual se desempeña; esto se debe a que existe una demanda laboral estrecha de puestos de trabajo para personas calificadas en Colombia. Se analizan las contribuciones empíricas existentes y el debate sobre las mismas; se examinan las teorías que permiten explicar la existencia de un desajuste educativo y se realiza una revisión de la literatura internacional y nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis para desarrollar un esquema que permita determinar el comportamiento del individuo en el fenómeno de la sobreeducación.
Desajuste educativo por regiones en Colombia: ¿competencia por salarios o por puestos de trabajo?
Directory of Open Access Journals (Sweden)
Castillo Caicedo Maribel
2007-08-01
Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación,
entendida como un desajuste por exceso, entre el nivel educativo alcanzado
por el individuo y el exigido por el puesto de trabajo en el cual se
desempeña; esto se debe a que existe una demanda laboral estrecha de
puestos de trabajo para personas calificadas en Colombia. Se analizan las
contribuciones empíricas existentes y el debate sobre las mismas; se
examinan las teorías que permiten explicar la existencia de un desajuste
educativo y se realiza una revisión de la literatura internacional y
nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis
para desarrollar un esquema que permita determinar el comportamiento
del individuo en el fenómeno de la sobreeducación.
Directory of Open Access Journals (Sweden)
Dhana G Gorasia
2016-08-01
Full Text Available The type IX secretion system (T9SS has been recently discovered and is specific to Bacteroidetes species. Porphyromonas gingivalis, a keystone pathogen for periodontitis, utilizes the T9SS to transport many proteins including the gingipain virulence factors across the outer membrane and attach them to the cell surface via a sortase-like mechanism. At least 11 proteins have been identified as components of the T9SS including PorK, PorL, PorM, PorN and PorP, however the precise roles of most of these proteins have not been elucidated and the structural organization of these components is unknown. In this study, we purified PorK and PorN complexes from P. gingivalis and using electron microscopy we have shown that PorN and the PorK lipoprotein interact to form a 50 nm diameter ring-shaped structure containing approximately 32-36 subunits of each protein. The formation of these rings was dependent on both PorK and PorN, but was independent of PorL, PorM and PorP. PorL and PorM were found to form a separate stable complex. PorK and PorN were protected from proteinase K cleavage when present in undisrupted cells, but were rapidly degraded when the cells were lysed, which together with bioinformatic analyses suggests that these proteins are exposed in the periplasm and anchored to the outer membrane via the PorK lipid. Chemical cross-linking and mass spectrometry analyses confirmed the interaction between PorK and PorN and further revealed that they interact with the PG0189 outer membrane protein. Furthermore, we established that PorN was required for the stable expression of PorK, PorL and PorM. Collectively, these results suggest that the ring-shaped PorK/N complex may form part of the secretion channel of the T9SS. This is the first report showing the structural organization of any T9SS component.
Gorasia, Dhana G; Veith, Paul D; Hanssen, Eric G; Glew, Michelle D; Sato, Keiko; Yukitake, Hideharu; Nakayama, Koji; Reynolds, Eric C
2016-08-01
The type IX secretion system (T9SS) has been recently discovered and is specific to Bacteroidetes species. Porphyromonas gingivalis, a keystone pathogen for periodontitis, utilizes the T9SS to transport many proteins including the gingipain virulence factors across the outer membrane and attach them to the cell surface via a sortase-like mechanism. At least 11 proteins have been identified as components of the T9SS including PorK, PorL, PorM, PorN and PorP, however the precise roles of most of these proteins have not been elucidated and the structural organization of these components is unknown. In this study, we purified PorK and PorN complexes from P. gingivalis and using electron microscopy we have shown that PorN and the PorK lipoprotein interact to form a 50 nm diameter ring-shaped structure containing approximately 32-36 subunits of each protein. The formation of these rings was dependent on both PorK and PorN, but was independent of PorL, PorM and PorP. PorL and PorM were found to form a separate stable complex. PorK and PorN were protected from proteinase K cleavage when present in undisrupted cells, but were rapidly degraded when the cells were lysed, which together with bioinformatic analyses suggests that these proteins are exposed in the periplasm and anchored to the outer membrane via the PorK lipid. Chemical cross-linking and mass spectrometry analyses confirmed the interaction between PorK and PorN and further revealed that they interact with the PG0189 outer membrane protein. Furthermore, we established that PorN was required for the stable expression of PorK, PorL and PorM. Collectively, these results suggest that the ring-shaped PorK/N complex may form part of the secretion channel of the T9SS. This is the first report showing the structural organization of any T9SS component.
Habibi, Alireza; Vahabzadeh, Farzaneh
2013-01-01
The ability of the phenol-adapted Ralstonia eutropha to utilize formaldehyde (FD) as the sole source of carbon and energy was studied. Adaptation to FD was accomplished by substituting FD for glucose in a stepwise manner. The bacterium in the liquid test culture could tolerate concentrations of FD up to 900 mg L(-1). Degradation of FD was complete in 528 h at 30°C with shaking at 150 rpm (r = 1.67 mg L(-1) h(-1)), q = 0.035 g(FD) g(cell) (-1) h(-1). Substrate inhibition kinetics (Haldane and Luong equations) are used to describe the experimental data. At non-inhibitory concentrations of FD, the Monod equation was used. According to the Luong model, the values of the maximum specific growth rate (μ(max)), half-saturation coefficient (k(S)), the maximum allowable formaldehyde concentration (S(m)), and the shape factor (n) were 0.117 h(-1), 47.6 mg L(-1), 900 mg L(-1), and 2.2, respectively. The growth response of the test bacterium to consecutive FD feedings was examined, and the FD-adapted R. eutropha cells were able to degrade 1000 mg L(-1) FD in 150 h through 4 cycles of FD feeds. During FD degradation, formic acid metabolite was formed. Assimilation of FD, methanol, formic acid, and oxalate by the test bacterium was accompanied by the formation of a pink pigment. The carotenoid nature of the cellular pigment has been confirmed and the test bacterium appeared to be closely related to pink-pigmented facultative methylotrophs (PPFM). The extent of harm to soil exposed to biotreated wastewaters containing FD may be moderated due to the association between methylotrophic/oxalotrophic bacteria and plants.
Directory of Open Access Journals (Sweden)
Maxence S Vincent
2016-08-01
Full Text Available The Type IX secretion system (T9SS is a versatile multi-protein complex restricted to bacteria of the Bacteriodetes phylum and responsible for the secretion of surface attachment of diverse proteins that participate to S-layer formation, gliding motility or pathogenesis. The T9SS is poorly characterized but a number of proteins involved in the assembly of the secretion apparatus in the oral pathogen Porphyromonas gingivalis have been identified based on genome substractive analyses. Among these proteins, PorY and PorX encode typical two-component system (TCS sensor and CheY-like response regulator respectively. Although the porX and porY genes do not localize at the same genetic locus, it has been proposed that PorXY form a bona fide TCS. Deletion of the porX in P. gingivalis causes a slight decrease of the expression of a number of other T9SS genes, including sov, porT, porP, porK, porL, porM, porN and porY. Here, we show that PorX and the soluble cytoplasmic domain of PorY interact. Using electrophoretic mobility shift, DNA-protein co-purification and heterologous host expression assays, we showed that PorX does not bind and does not directly regulate expression of the T9SS genes. Finally, we show that PorX interacts with the cytoplasmic domain of PorL, a component of the T9SS membrane core complex and propose that the CheY-like PorX protein might be involved in the dynamics of the T9SS.
Vincent, Maxence S.; Durand, Eric; Cascales, Eric
2016-01-01
The Type IX secretion system (T9SS) is a versatile multi-protein complex restricted to bacteria of the Bacteriodetes phylum and responsible for the secretion or cell surface exposition of diverse proteins that participate to S-layer formation, gliding motility or pathogenesis. The T9SS is poorly characterized but a number of proteins involved in the assembly of the secretion apparatus in the oral pathogen Porphyromonas gingivalis have been identified based on genome substractive analyses. Among these proteins, PorY, and PorX encode typical two-component system (TCS) sensor and CheY-like response regulator respectively. Although the porX and porY genes do not localize at the same genetic locus, it has been proposed that PorXY form a bona fide TCS. Deletion of porX in P. gingivalis causes a slight decrease of the expression of a number of other T9SS genes, including sov, porT, porP, porK, porL, porM, porN, and porY. Here, we show that PorX and the soluble cytoplasmic domain of PorY interact. Using electrophoretic mobility shift, DNA-protein co-purification and heterologous host expression assays, we demonstrate that PorX does not bind T9SS gene promoters and does not directly regulate expression of the T9SS genes. Finally, we show that PorX interacts with the cytoplasmic domain of PorL, a component of the T9SS membrane core complex and propose that the CheY-like PorX protein might be involved in the dynamics of the T9SS. PMID:27630829
Energy Technology Data Exchange (ETDEWEB)
Brigham, CJ; Speth, DR; Rha, C; Sinskey, AJ
2012-10-22
Poly(3-hydroxybutyrate) (PHB) production and mobilization in Ralstonia eutropha are well studied, but in only a few instances has PHB production been explored in relation to other cellular processes. We examined the global gene expression of wild-type R. eutropha throughout the PHB cycle: growth on fructose, PHB production using fructose following ammonium depletion, and PHB utilization in the absence of exogenous carbon after ammonium was resupplied. Our results confirm or lend support to previously reported results regarding the expression of PHB-related genes and enzymes. Additionally, genes for many different cellular processes, such as DNA replication, cell division, and translation, are selectively repressed during PHB production. In contrast, the expression levels of genes under the control of the alternative sigma factor sigma(54) increase sharply during PHB production and are repressed again during PHB utilization. Global gene regulation during PHB production is strongly reminiscent of the gene expression pattern observed during the stringent response in other species. Furthermore, a ppGpp synthase deletion mutant did not show an accumulation of PHB, and the chemical induction of the stringent response with DL-norvaline caused an increased accumulation of PHB in the presence of ammonium. These results indicate that the stringent response is required for PHB accumulation in R. eutropha, helping to elucidate a thus-far-unknown physiological basis for this process.
Directory of Open Access Journals (Sweden)
Carlos Colegial
1999-01-01
Full Text Available Las encefalopatías espongiformes por priones son enfermedades neurodegenerativas que pueden ser esporádicas o transmisibles, ya sea por mecanismos infecciosos o hereditarios. Su investigación ha planteado enormes retos y en el recorrido histórico en busca de su causa dos médicos han recibido el premio Nobel de Medicina: Carleton Gajdusek, por sus trabajos en Nueva Guinea donde describió la transmisión infecciosa por ritos canibalísticos, que llevó a estudios de transmisión experimental en chimpancés y a su teoría de los "virus lentos" (por el largo período de incubación de la enfermedad.
Strube, Katja; de Vries, Simon; Cramm, Rainer
2007-07-13
In Ralstonia eutropha H16, two genes, norA and norB, form a dicistronic operon that is controlled by the NO-responsive transcriptional regulator NorR. NorB has been identified as a membrane-bound NO reductase, but the physiological function of NorA is unknown. We found that, in a NorA deletion mutant, the promoter activity of the norAB operon was increased 3-fold, indicating that NorA attenuates activation of NorR. NorA shows limited sequence similarity to the oxygen carrier hemerythrin, which contains a di-iron center. Indeed, optical and EPR spectroscopy of purified NorA revealed the presence of a di-iron center, which binds oxygen in a similar way as hemerythrin. Diferrous NorA binds two molecules of NO maximally. Unexpectedly, binding of NO to the diferrous NorA required an external reductant. Two different NorA-NO species could be resolved. A minor species (up to 20%) showed an S = (1/2) EPR signal with g( perpendicular) = 2.041, and g( parallel) = 2.018, typical of a paramagnetic dinitrosyl iron complex. The major species was EPR-silent, showing characteristic signals at 420 nm and 750 nm in the optical spectrum. This species is proposed to represent a novel dinitrosyl iron complex of the form Fe(2+)-[NO](2)(2-), i.e. NO is bound as NO(-). The NO binding capacity of NorA in conjunction with its high cytoplasmic concentration (20 mum) suggests that NorA regulates transcription by lowering the free cytoplasmic concentration of NO.
Directory of Open Access Journals (Sweden)
Benjaphorn Prapagdee
2009-12-01
Full Text Available Cadmium (Cd is a major environmental hazard, which usually is detected in its ionic form of Cd2+. It also causes adverse toxic effects on human health and other living organisms. Cd-resistant bacteria were isolated from Cd-contaminated soils. One isolate, TAK1, was highly resistance level to Cd toxicity. TAK1 was isolated from soil contaminated with a high Cd concentration (204.1 mg.kg-1. The result of 16S rDNA sequence analysis found that the TAK1 showed the similarity to Ralstonia sp. Physiological adaptive and cross-protective responses to Cd and Zn killing were investigated in Ralstonia sp.TAK1. Exposure to a low concentration of Cd induced adaptive resistance to higher concentrations of Cd. In addition, pretreatment of Ralstonia sp.TAK1 with an inducing concentration of Cd conferred cross-protective response against subsequent exposure to the lethal concentrations of Zn. The induced adaptive and cross-protective response Ralstonia sp.TAK1 required newly synthesized protein(s. Cd-induced adaptive and cross-protective responses against Cd and Zn toxicity are the important mechanisms used by Ralstonia sp.TAK1 to survive in the heavy metal contaminated environments. These findings might lead to the use of Ralstonia sp.TAK1 for microbial based remediation in Cd and Zn-contaminated soils.
Li, Wenbin; Abad, Jorge A; French-Monar, Ronald D; Rascoe, John; Wen, Aimin; Gudmestad, Neil C; Secor, Gary A; Lee, Ing-Ming; Duan, Yongping; Levy, Laurene
2009-07-01
The new Liberibacter species, 'Candidatus Liberibacter solanacearum' (Lso) recently associated with potato/tomato psyllid-transmitted diseases in tomato and capsicum in New Zealand, was found to be consistently associated with a newly emerging potato zebra chip (ZC) disease in Texas and other southwestern states in the USA. A species-specific primer LsoF was developed for both quantitative real-time PCR (qPCR) and conventional PCR (cPCR) to detect and quantify Lso in infected samples. In multiplex qPCR, a plant cytochrome oxidase (COX)-based probe-primer set was used as a positive internal control for host plants, which could be used to reliably access the DNA extraction quality and to normalize qPCR data for accurate quantification of the bacterial populations in environment samples. Neither the qPCR nor the cPCR using the primer and/or probe sets with LsoF reacted with other Liberibacter species infecting citrus or other potato pathogens. The low detection limit of the multiplex qPCR was about 20 copies of the target 16S rDNA templates per reaction for field samples. Lso was readily detected and quantified in various tissues of ZC-affected potato plants collected from fields in Texas. A thorough but uneven colonization of Lso was revealed in various tissues of potato plants. The highest Lso populations were about 3x10(8) genomes/g tissue in the root, which were 3-order higher than those in the above-ground tissues of potato plants. The Lso bacterial populations were normally distributed across the ZC-affected potato plants collected from fields in Texas, with 60% of ZC-affected potato plants harboring an average Lso population from 10(5) to 10(6) genomes/g tissue, 4% of plants hosting above 10(7) Lso genomes/g tissue, and 8% of plants holding below 10(3) Lso genomes/g tissue. The rapid, sensitive, specific and reliable multiplex qPCR showed its potential to become a powerful tool for early detection and quantification of the new Liberibacter species associated
Reinhold-Hurek, Barbara; Maes, Tamara; Gemmer, Sabrina; Van Montagu, Marc; Hurek, Thomas
2006-02-01
The nitrogen-fixing endophyte Azoarcus sp. strain BH72 infects roots of Kallar grass and rice inter- and intra-cellularly and can spread systemically into shoots without causing symptoms of plant disease. Although cellulose or its breakdown products do not support growth, this strain expresses an endoglucanase, which might be involved in infection. Sequence analysis of eglA places the secreted 34-kDa protein into the glycosyl hydrolases family 5, with highest relatedness (40% identity) to endoglucanases of the phytopathogenic bacteria Xanthomonas campestris and Ralstonia solanacearum. Transcriptional regulation studied by eglA:: gusA fusion was not significantly affected by cellulose or its breakdown products or by microaerobiosis. Strongest induction (threefold) was obtained in bacteria grown in close vicinity to rice roots. Visible sites of expression were the emergence points of lateral roots and root tips, which are the primary regions of ingress into the root. To study the role in endophytic colonization, eglA was inactivated by transposon mutagenesis. Systemic spreading of the eglA mutant and of a pilAB mutant into the rice shoot could no longer be detected by polymerase chain reaction. Microscopic inspection of infection revealed that the intracellular colonization of root epidermis cells was significantly reduced in the eglA- mutant BHE6 compared with the wild type and partially restored in the complementation mutant BHRE2 expressing eglA. This provides evidence that Azoarcus sp. endoglucanase is an important determinant for successful endophytic colonization of rice roots, suggesting an active bacterial colonization process.
International Nuclear Information System (INIS)
Huang, D.; Li, M.; He, S.
2015-01-01
ROP/RAC GTPases is a plant-specific subfamily of Rho GTPases that plays a versatile role in the regulation of plant growth, development, in hormone signal transduction and response to the environment. Prior to the present study, only one Rop gene in pepper has been described. However, with the recent release of the draft genome sequence of pepper allowes us to conduct a genome wide search to identify how many Rop family members existed in pepper genome. We carried out bioinformatics analysis to establish the conserved as well as divergent regions on the protein sequences, phylogenetically analysis and the corresponding result shows that, CaROPs could be distributed into four groups as described in the literature for their homologs in Arabidopsis. To understand the function of nine Rop genes in pepper, we accordingly studied the tissue, fruit development and ripening expression patterns of CaRop genes by obtained RNA-seq data from public database. From our analysis, we realized that the expression of CaRop genes shows no total tissue or developmental specific expression. Furthermore, gene expression profiles of CaRop in response to environment stresses and hormone treatment, such as inoculated with Ralstonia solanacearum, by heat stress as well as treated with four phytohormones respectively and evaluated with real time RT-PCR. The potential involvement of specific CaRop genes in growth, fruit development, ripening, environment stresses as well as hormone responses discussed and may lay the foundation for future functional analysis to unravel their biological roles. (author)
Directory of Open Access Journals (Sweden)
Michaela Wimmerová
Full Text Available Carbohydrate-receptor interactions are an integral part of biological events. They play an important role in many cellular processes, such as cell-cell adhesion, cell differentiation and in-cell signaling. Carbohydrates can interact with a receptor by using several types of intermolecular interactions. One of the most important is the interaction of a carbohydrate's apolar part with aromatic amino acid residues, known as dispersion interaction or CH/π interaction. In the study presented here, we attempted for the first time to quantify how the CH/π interaction contributes to a more general carbohydrate-protein interaction. We used a combined experimental approach, creating single and double point mutants with high level computational methods, and applied both to Ralstonia solanacearum (RSL lectin complexes with α-L-Me-fucoside. Experimentally measured binding affinities were compared with computed carbohydrate-aromatic amino acid residue interaction energies. Experimental binding affinities for the RSL wild type, phenylalanine and alanine mutants were -8.5, -7.1 and -4.1 kcal x mol(-1, respectively. These affinities agree with the computed dispersion interaction energy between carbohydrate and aromatic amino acid residues for RSL wild type and phenylalanine, with values -8.8, -7.9 kcal x mol(-1, excluding the alanine mutant where the interaction energy was -0.9 kcal x mol(-1. Molecular dynamics simulations show that discrepancy can be caused by creation of a new hydrogen bond between the α-L-Me-fucoside and RSL. Observed results suggest that in this and similar cases the carbohydrate-receptor interaction can be driven mainly by a dispersion interaction.
International Nuclear Information System (INIS)
Mondal, P.; Majumder, C.B.; Mohanty, B.
2008-01-01
This paper presents the observations on the bio-removal of arsenic from contaminated water by using Ralstonia eutropha MTCC 2487 and activated carbon in a batch reactor. The effects of agitation time, pH, type of granular activated carbon (GAC) and initial arsenic concentration (As o ) on the % removal of arsenic have been discussed. Under the experimental conditions, optimum removal was obtained at the pH of 6-7 with agitation time of 100 h. The % removal of As(T) increased initially with the increase in As o and after attaining the maximum removal (∼86%) at the As o value of around 15 ppm, it started to decrease. Simultaneous adsorption bioaccumulation (SABA) was observed, when fresh GAC was used as supporting media for bacterial immobilization. In case of SABA, the % removal of As(III) was almost similar (only ∼1% more) to the additive values of individual removal of As(III) obtained by only adsorption and only bio-adsorption. However, for As(V) the % removal was less (∼8%) than the additive value of the individual % removals obtained by only adsorption and bio-adsorption. Percentage removal of Fe, Mn, Cu and Zn were 65.17%, 72.76%, 98.6% and 99.31%, respectively. Maximum regeneration (∼99.4%) of the used bio-adsorbent was achieved by the treatment with 5NH 2 SO 4 followed by 1N NaOH and 30% H 2 O 2 in HNO 3 . The fitness of the isotherms to predict the specific uptake for bio-adsorption/accumulation process has been found to decrease in the following order: Temkin isotherm > Langmuir isotherm > Freundlich isotherm. For the adsorption process with fresh GAC the corresponding order is Freundlich isotherm > Langmuir isotherm > Temkin isotherm for As(V) and As(T). However, for As(III) it was Langmuir > Temkin > Freundlich
Casipoemas por Navidad : (1969-2010)
Sena Medina, Guillermo
2011-01-01
PRESENTACIÓN AL AIRE DE LA POESÍA RELIGIOSA Y NAVIDEÑA DE GUILLERMO SENA MEDINA Constituye un gran honor hacer la presentación de Guillermo Sena Medina por un doble motivo; por la larga y sincera amistad que nos une desde hace muchos años al socaire de nuestra común afición por la Historia, como cronistas oficiales de nuestros municipios; y, sobre todo y particularmente, por su rica y profunda personalidad como hombre de letras, nacida de su aún más rica y profunda personalidad humana. A...
Evolution of NADPH-cytochrome P450 oxidoreductases (POR) in Apiales - POR 1 is missing
DEFF Research Database (Denmark)
Andersen, Trine Bundgaard; Hansen, Niels Bjørn; Laursen, Tomas
2016-01-01
The NADPH-dependent cytochrome P450 oxidoreductase (POR) is the obligate electron donor to eukaryotic microsomal cytochromes P450 enzymes. The number of PORs within plant species is limited to one to four isoforms, with the most common being two PORs per plant. These enzymes provide electrons to ...... (available from the SRA at NCBI). All three genes were shown to be functional upon reconstitution into nanodiscs, confirming that none of the isoforms are pseudogenes....
Wübbeler, Jan Hendrik; Raberg, Matthias; Brandt, Ulrike; Steinbüchel, Alexander
2010-01-01
The catabolism of the disulfide 3,3′-dithiodipropionic acid (DTDP) is initiated by the reduction of its disulfide bond. Three independent Tn5::mob-induced mutants of Advenella mimigardefordensis strain DPN7T were isolated that had lost the ability to utilize DTDP as the sole source of carbon and energy and that harbored the transposon insertions in three different sites of the same dihydrolipoamide dehydrogenase gene encoding the E3 subunit of the pyruvate dehydrogenase multi-enzyme complex of this bacterium (LpdAAm). LpdAAm was analyzed in silico and compared to homologous proteins, thereby revealing high similarities to the orthologue in Ralstonia eutropha H16 (PdhLRe). Both bacteria are able to cleave DTDP into two molecules of 3-mercaptopropionic acid (3MP). A. mimigardefordensis DPN7T converted 3MP to 3-sulfinopropionic acid, whereas R. eutropha H16 showed no growth with DTDP as the sole carbon source but was instead capable of synthesizing heteropolythioesters using the resulting cleavage product 3MP. Subsequently, the genes lpdAAm and pdhLRe were cloned, heterologously expressed in Escherichia coli applying the pET23a expression system, purified, and assayed by monitoring the oxidation of NADH. The physiological substrate lipoamide was reduced to dihydrolipoamide with specific activities of 1,833 mkat/kg of protein (LpdAAm) or 1,667 mkat/kg of protein (PdhLRe). Reduction of DTDP was also unequivocally detected with the purified enzymes, although the specific enzyme activities were much lower: 0.7 and 0.5 mkat/kg protein, respectively. PMID:20833784
Osteomalacia inducida por tumor: hemangiopericitoma rinosinusal
Directory of Open Access Journals (Sweden)
Enriqueta M. Serafini
2013-02-01
Full Text Available La osteomalacia inducida por tumor es una rara enfermedad del metabolismo óseo caracterizada por el aumento en la excreción de fosfato a nivel renal seguido de hipofosfatemia. Es causada por agentes fosfatúricos producidos por determinados tumores. La resección total del tumor resulta en la completa reversión de las anormalidades bioquímicas, la desaparición de las manifestaciones clínicas y los hallazgos en los estudios por imágenes. Presentamos el caso de un varón de 61 años con cuadro clínico y laboratorio compatibles con osteomalacia oncogénica inducida por tumor mesenquimático de localización rinosinusal. En nuestro caso el diagnóstico histológico correspondió a una neoplasia de tipo vascular: hemangiopericitoma.
Directory of Open Access Journals (Sweden)
Tariq Mustafa
Full Text Available The potato psyllid, Bactericera cockerelli (Šulc (Hemiptera: Triozidae, is a vector of the phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso, the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern. All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato ("inoculation access period", or IAP to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in
DEFF Research Database (Denmark)
Hansen, Ernst Jan de Place
2000-01-01
Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM).......Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM)....
Garrido Garrido, Julián
1997-01-01
Not available.La verdad por definición es un tipo peculiar de verdad científica, distinguible de las verdades lógicas, matemáticas y empíricas. La definición, por su parte, designa diversos procedimientos de asignación de significado, cuyas diferencias exigen una adjetivación cuidadosa: definiciones ostensivas y operacionales, definiciones de diccionario y definiciones teóricas. Pero sólo las del último tipo son verdaderas por definición. En el presente artículo se precisa el concepto formal ...
Electrocardiografo por computadora
Tinoco Hernandez, Rosanna; Paredes Bejarano, Margarita; Romero Chaglia, Norman; Yapur Auad, Miguel Eduardo
2009-01-01
El presente trabajo trata sobrees el diseño y la implementación de un graficador de señales cardiacas por computadora, para lo cual diseñamos un circuito electrónico capaz de recibir la senal analógica proveniente de la actividad electrica del corazón , amplificarla, y luego convertirla en una señal digital para ser procesada por software y finalmente ser graficada, siendo posible así observar la señal cardiaca en el monitor de un computador como un tren de pulsos. Cabe destacar que par...
Ma, Hai-Yan; Yang, Bo; Wang, Hong-Wei; Yang, Qi-Yin; Dai, Chuan-Chao
2016-01-15
Continuous cropping practices cause a severe decline in peanut yield. The aim of this study was to investigate the remediation effect of Serratia marcescens on continuously cropped peanut soil. A pot experiment was conducted under natural conditions to determine peanut agronomic indices, soil microorganism characteristics, soil enzyme activities and antagonism ability to typical pathogens at different growth stages. Four treatments were applied to red soil as follows: an active fermentation liquor of S. marcescens (RZ-21), an equivalent sterilized fermentation liquor (M), an equivalent fermentation medium (P) and distilled water (CK). S. marcescens significantly inhibited the two typical plant pathogens Fusarium oxysporum A1 and Ralstonia solanacearum B1 and reduced their populations in rhizosphere soil. The RZ-21 treatment significantly increased peanut yield, vine dry weight, root nodules and taproot length by 62.3, 33, 72 and 61.4% respectively, followed by the M treatment. The P treatment also increased root nodules and root length slightly. RZ-21 also enhanced the activities of soil urease, sucrase and hydrogen peroxidase at various stages. In addition, RZ-21 and M treatments increased the average population of soil bacteria and decreased the average population of fungi in the three critical peanut growth stages, except for M in the case of the fungal population at flowering, thus balancing the structure of the soil microorganism community. This is the first report of S. marcescens being applied to continuously cropped peanut soil. The results suggest that S. marcescens RZ-21 has the potential to improve the soil environment and agricultural products and thus allow the development of sustainable management practices. © 2015 Society of Chemical Industry.
Leite, Giuseppe G F; Figueirôa, Juciane V; Almeida, Thiago C M; Valões, Jaqueline L; Marques, Walber F; Duarte, Maria D D C; Gorlach-Lira, Krystyna
2016-03-01
Biosurfactants are microbial secondary metabolites. The most studied are rhamnolipids, which decrease the surface tension and have emulsifying capacity. In this study, the production of biosurfactants, with emphasis on rhamnolipids, and diesel oil degradation by 18 strains of bacteria isolated from waste landfill soil contaminated by petroleum was analyzed. Among the studied bacteria, gram-positive endospore forming rods (39%), gram positive rods without endospores (17%), and gram-negative rods (44%) were found. The following methods were used to test for biosurfactant production: oil spreading, emulsification, and hemolytic activity. All strains showed the ability to disperse the diesel oil, while 77% and 44% of the strains showed hemolysis and emulsification of diesel oil, respectively. Rhamnolipids production was observed in four strains that were classified on the basis of the 16S rRNA sequences as Pseudomonas aeruginosa. Only those strains showed the rhlAB gene involved in rhamnolipids synthesis, and antibacterial activity against Escherichia coli, P. aeruginosa, Staphylococcus aureus, Bacillus cereus, Erwinia carotovora, and Ralstonia solanacearum. The highest production of rhamnolipids was 565.7 mg/L observed in mineral medium containing olive oil (pH 8). With regard to the capacity to degrade diesel oil, it was observed that 7 strains were positive in reduction of the dye 2,6-dichlorophenolindophenol (2,6-DCPIP) while 16 had the gene alkane mono-oxygenase (alkB), and the producers of rhamnolipids were positive in both tests. Several bacterial strains have shown high potential to be explored further for bioremediation purposes due to their simultaneous ability to emulsify, disperse, and degrade diesel oil. © 2015 American Institute of Chemical Engineers Biotechnol. Prog., 32:262-270, 2016. © 2015 American Institute of Chemical Engineers.
Deng, Meng-Ying; Sun, Yun-Hao; Li, Pai; Fu, Bei; Shen, Dong; Lu, Yong-Jun
2016-10-01
Virulent protein toxins secreted by the bacterial pathogens can cause cytotoxicity by various molecular mechanisms to combat host cell defense. On the other hand, these proteins can also be used as probes to investigate the defense pathway of host innate immunity. Ralstonia solanacearum, one of the most virulent bacterial phytopathogens, translocates more than 70 effector proteins via type III secretion system during infection. Here, we characterized the cytotoxicity of effector RipI in budding yeast Saccharomyce scerevisiae, an alternative host model. We found that over-expression of RipI resulted in severe growth defect and arginine (R) 117 within the predicted integrase motif was required for inhibition of yeast growth. The phenotype of death manifested the hallmarks of apoptosis. Our data also revealed that RipI-induced apoptosis was independent of Yca1 and mitochondria-mediated apoptotic pathways because Δyca1 and Δaif1 were both sensitive to RipI as compared with the wild type. We further demonstrated that RipI was localized in the yeast nucleus and the N-terminal 1-174aa was required for the localization. High-throughput RNA sequencing analysis showed that upon RipI over-expression, 101 unigenes of yeast ribosome presented lower expression level, and 42 GO classes related to the nucleus or recombination were enriched with differential expression levels. Taken together, our data showed that a nuclear-targeting effector RipI triggers yeast apoptosis, potentially dependent on its integrase function. Our results also provided an alternative strategy to dissect the signaling pathway of cytotoxicity induced by the protein toxins. Copyright © 2016 Elsevier Ltd. All rights reserved.
Celulitis por citomegalovirus Cytomegalovirus cellulitis
Directory of Open Access Journals (Sweden)
A. Ruiz Lascano
2002-12-01
Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.Cutaneous lesions in CMV infection are rare, often a late manifestation of systemic infection, and usually herald a fatal course. A 70 year-old woman received a kidney transplantation one month before consulting and immunosuppressive therapy that included cyclosporine A and methylprednisone. She complained of fever, local pain in her right leg, and an erythematous and swelling plaque. She was treated with intravenous antibiotics without improvement. A skin biopsy was performed and the tissue obtained was sent for bacterial and fungal cultures as well as for histological examination. Cultures were negative. The biopsy showed CMV cytopathic changes. Immunoperoxidase staining was positive for CMV and polymerase chain reaction (PCR testing revealed CMV DNA. She was treated with ganciclovir with resolution of the lesion. CMV cellulitis is a rare cutaneous manifestation
Eggers, Jessica; Steinbüchel, Alexander
2014-12-01
The model organism for polyhydroxybutyrate (PHB) biosynthesis, Ralstonia eutropha H16, possesses multiple isoenzymes of granules coating phasins as well as of PHB depolymerases, which degrade accumulated PHB under conditions of carbon limitation. In this study, recombinant Escherichia coli BL21(DE3) strains were used to study the impact of selected PHB depolymerases of R. eutropha H16 on the growth behavior and on the amount of accumulated PHB in the absence or presence of phasins. For this purpose, 20 recombinant E. coli BL21(DE3) strains were constructed, which harbored a plasmid carrying the phaCAB operon from R. eutropha H16 to ensure PHB synthesis and a second plasmid carrying different combinations of the genes encoding a phasin and a PHB depolymerase from R. eutropha H16. It is shown in this study that the growth behavior of the respective recombinant E. coli strains was barely affected by the overexpression of the phasin and PHB depolymerase genes. However, the impact on the PHB contents was significantly greater. The strains expressing the genes of the PHB depolymerases PhaZ1, PhaZ2, PhaZ3, and PhaZ7 showed 35% to 94% lower PHB contents after 30 h of cultivation than the control strain. The strain harboring phaZ7 reached by far the lowest content of accumulated PHB (only 2.0% [wt/wt] PHB of cell dry weight). Furthermore, coexpression of phasins in addition to the PHB depolymerases influenced the amount of PHB stored in cells of the respective strains. It was shown that the phasins PhaP1, PhaP2, and PhaP4 are not substitutable without an impact on the amount of stored PHB. In particular, the phasins PhaP2 and PhaP4 seemed to limit the degradation of PHB by the PHB depolymerases PhaZ2, PhaZ3, and PhaZ7, whereas almost no influence of the different phasins was observed if phaZ1 was coexpressed. This study represents an extensive analysis of the impact of PHB depolymerases and phasins on PHB accumulation and provides a deeper insight into the complex interplay
Birlutiu, Rares Mircea; Roman, Mihai Dan; Cismasiu, Razvan Silviu; Fleaca, Sorin Radu; Popa, Crina Maria; Mihalache, Manuela; Birlutiu, Victoria
2017-07-19
In the context of an increase number of primary and revision total hip and total knee arthroplasty performed yearly, an increased risk of complication is expected. Prosthetic joint infection (PJI) remains the most common and feared arthroplasty complication. Ralstonia pickettii is a Gram-negative bacterium, that has also been identified in biofilms. It remains an extremely rare cause of PJI. There is no report of an identification of R. pickettii on an extracted spacer loaded with antibiotic. We present the case of an 83-years-old Caucasian male patient, that underwent a right cemented total hip replacement surgery. The patient is diagnosed with an early PJI with no isolated microorganism. A debridement and change of mobile parts is performed. At the beginning of 2016, the patient in readmitted into the Orthopedic Department for sever, right abdominal and groin pain and elevated serum erythrocyte sedimentation rate and C-reactive protein. A joint aspiration is performed with a negative microbiological examination. A two-stage exchange with long interval management is adopted, and a preformed spacer loaded with gentamicin was implanted. In July 2016, based on the proinflammatory markers evolution, a shift a three-stage exchange strategy is decided. In September 2016, a debridement, and changing of the preformed spacer loaded with gentamicin with another was carried out. Bacteriological examination of the tissues sampled intraoperatively was positive for Pseudomonas aeruginosa. From the sonication fluid, no bacteria were isolated on culture or identified using the bbFISH assay. During the hospitalization period, the patient received i.v. ceftazidime 3x2g/day and p.o. ciprofloxacin 2x750mg/day, antibiotic therapy that was continued after discharge with p.o. ciprofloxacin 2x750mg/day for 6 weeks. In February 2017, a reimplantation of a revision prosthesis is performed. The retrieved spacer is sonicated, and after 4 days of incubation of the sonication fluid, R
Tendencia de la mortalidad por cáncer en Chile según diferencias por nivel educacional, 2000-2010
Directory of Open Access Journals (Sweden)
Cristian A. Herrera Riquelme
2015-01-01
Full Text Available Objetivo. Caracterizar la tendencia de la mortalidad por cáncer en Chile según diferencias por nivel educacional en el período 2000-2010 en la población mayor de 20 años. Métodos. Cálculo de las tasas de mortalidad específica por cáncer ajustadas por edad para diferentes niveles educacionales (NE, para el período 2000-2010. Las tasas obtenidas se analizaron con un modelo de regresión de Poisson, calculando el índice de desigualdad relativa (IDR y el índice de desigualdad de la pendiente (IDP para cada año. Resultados. Se registraron 232 541 muertes por cáncer en el período 2000-2010. Los tipos de cáncer más frecuentes fueron de mama, estómago y vesícula biliar en mujeres; y estómago, próstata y pulmón en hombres. Las tasas de mortalidad por cáncer estandarizadas por edad fueron mayores en los NE más bajos, excepto para el de mama en mujer y el de pulmón en hombres. Las mayores diferencias se encontraron en el de vesícula biliar en mujeres y el de estómago en hombres, con mayores tasas de mortalidad específica de hasta 49 y 63 veces respectivamente, para NE bajo respecto al NE alto. Entre 2000 y 2010, las diferencias en mortalidad por NE se redujeron para todos los cánceres combinados en ambos géneros, mama en mujeres, y pulmón y estómago en hombres. Conclusiones. Durante el período estudiado, la mortalidad por cáncer en Chile estuvo fuertemente asociada al NE de la población. Esta información debe ser considerada al definir estrategias nacionales para reducir la mortalidad específica por cáncer en los grupos más desprotegidos.
Muerte materna por malaria grave por Plasmodium vivax
Directory of Open Access Journals (Sweden)
Nancy Arróspide
Full Text Available Se presenta el caso de una mujer de 19 años con 29 semanas de gestación, procedente de Llumpe (Ancash con antecedentes de viajes a las localidades de Chanchamayo (Junín y Rinconada (Ancash. Ingresó al Hospital de Chacas (Ancash por presentar mal estado general, deshidratación, dificultad respiratoria, ictericia, sensación de alza térmica y dolor abdominal, tuvo reporte de: hemoparásitos 60% en frotis sanguíneo. Fue transferida al Hospital Ramos Guardia (Huaraz donde presentó mayor dificultad respiratoria, coluria, hematuria, disminución del débito urinario y reporte de Plasmodium (+, luego fue transferida al Hospital Cayetano Heredia (Lima donde ingresó a la Unidad de Cuidados Intensivos (UCI, con evolución a falla multiorgánica, óbito fetal y muerte materna. Se confirmó infección por Plasmodium vivax. Destacamos la importancia de mejorar nuestras capacidades de diagnóstico y manejo para brindar un tratamiento adecuado y oportuno.
Desenvolvimento de um kit de irrigação por microtubos com moto-bomba propulsionada por energia solar
Luiz Ricardo Sobenko
2016-01-01
O bombeamento de água por meio da energia solar vem se mostrando uma alternativa para localidades onde outras fontes de energia não estão disponíveis ou são limitadas. Torna-se interessante aliar essa alternativa a um sistema de irrigação que opera com vazão e pressão relativamente baixas, como a irrigação localizada por microtubos, possibilitando assim a obtenção de alta eficiência. No presente trabalho teve-se por objetivo dimensionar e avaliar um kit de irrigação por microtubos, alimentado...
Tendencia de la mortalidad por cáncer en Chile según diferencias por nivel educacional, 2000-2010
Cristian A. Herrera Riquelme; Lucy Kuhn-Barrientos; Roberto Rosso Astorga; Jorge Jiménez de la Jara
2015-01-01
Objetivo. Caracterizar la tendencia de la mortalidad por cáncer en Chile según diferencias por nivel educacional en el período 2000-2010 en la población mayor de 20 años. Métodos. Cálculo de las tasas de mortalidad específica por cáncer ajustadas por edad para diferentes niveles educacionales (NE), para el período 2000-2010. Las tasas obtenidas se analizaron con un modelo de regresión de Poisson, calculando el índice de desigualdad relativa (IDR) y el índice de desigualdad de la pendiente (ID...
Castro, Pablo; Vera, Jeanette; Cifuentes, Luis; Wellenius, Gregory; Verdejo, Hugo; Sepúlveda, Luis; Vukasovic, José Luis; Llevaneras, Silvana
2010-01-01
Antecedentes: Estudios recientes han reportado una asociación entre la contaminación ambiental por material particulado (PM) y el riesgo de hospitalizaciones de pacientes con insuficiencia cardiaca (IC). La región metropolitana de nuestro país constituye un área geográfica en la cual la contaminación es especialmente relevante, asociándose a incrementos periódicos en la morbimortalidad por causa respiratoria. Sin embargo el efecto de la polución por PM en la morbilidad de pacientes con IC no ...
Síndrome de Munchausen por mandato
Esteban, Miguel A.; Pérez, Miriam R.; Bracco, Anahí
2006-01-01
El Síndrome de Munchausen por mandato, "un trastorno ficticio, por el cual la enfermedad del niño es inducida, promovida o provocada por la persona más próxima a él, generalmente su madre", es todavía mal conocido y su génesis imperfectamente comprendida. Esta comunicación está destinada a esclarecer al pediatra esta patología, con elevada morbilidad y secuelas, como así también de altísima mo...
Directory of Open Access Journals (Sweden)
JOSE MATOS
2012-01-01
Full Text Available El objetivo de este trabajo fue evaluar y caracterizar el comportamiento mecánico en desgaste del acero API 5L X65, revestido con niobio en comparación al desempeño del revestimiento de la aleación de inconel 625 empleados en la industria de petróleo y gas. El revestimiento de niobio fue obtenido por el proceso de aspersión térmica a plasma de arco no transferido y el revestimiento inconel 625 por soldadura con electrodo revestido. La resistencia al desgaste por abrasión fue evaluada según la norma Petrobras N-2568, en un tribómetro CTER, la rugosidad y el volumen de material desgastado se determinó a través de perfilometría y la dureza de los revestimientos por microscopia Vickers. Los revestimientos obtenidos fueron caracterizados respecto a su morfología por microscopia electrónica de barrido (MEB y microscopía óptica (MO. La mayor dureza del revestimiento con niobio obtenido puede haber contribuido a reducir la tasa de desgaste en comparación con el revestimiento de inconel 625.
CARACTERÍSTICAS DA VIOLÊNCIA SEXUAL SOFRIDA POR CRIANÇAS ASSISTIDAS POR UM PROGRAMA DE APOIO
KELLY LINHARES VASCONCELOS; ADRIANA GOMES NOGUEIRA FERREIRA; ELIANY NAZARÉ OLIVEIRA; DANIELLE D\\u2019ÁVILA SIQUEIRA; PATRÍCIA NEYVA DA COSTA PINHEIRO
2010-01-01
En Brasil, las estadísticas de la violencia sexual contra niños están lejos de reflejar la verdadera realidad actual debido a la baja notificación de los casos. La finalidad de este estudio fue caracterizar el abuso sexual sufrido por niños asistidos por el Programa Sentinela y el perfil del agresor, en Sobral-Ceará, en el periodo que va del 2002 al 2006. La muestra no probabilística intencional fue compuesta por 50 víctimas de abuso sexual y de las mismas, el 66% es del sexo femenino, con pr...
Abdome agudo por obstrução por ileobiliar
Directory of Open Access Journals (Sweden)
Márcia Cristina de Alencastro
Full Text Available OBJETIVO: descrever a experiência na abordagem dos doentes com abdome agudo por obstrução por IB, desde o diagnóstico até o tratamento definitivo. MÉTODOS: estudo retrospectivo incluindo todos os casos de IB tratados em um período de 23 anos. De acordo com a abordagem cirúrgica realizada, os pacientes foram divididos em dois grupos (1 enterolitotomia com colecistectomia no segundo momento; e (2 enterolitotomia, colecistectomia e abordagem da fístula. RESULTADOS: Doze pacientes foram incluídos, sendo 11 mulheres (91,6%, com média de idade de 72,2 anos. Todos os pacientes apresentavam doenças associadas, principalmente hipertensão arterial sistêmica (75%. Dois pacientes não apresentavam sintomas significativos de obstrução intestinal. O diagnóstico de IB foi realizado em seis pacientes (50% antes da laparotomia. O grupo 1 foi constituído de oito pacientes e o grupo 2 de quatro, e a morbidade foi, respectivamente, 33,3% e 8,3%. A mortalidade foi 16,6% (um paciente de cada grupo. CONCLUSÃO: O manejo do IB deve ser individualizado. O tratamento da obstrução mediante remoção do cálculo biliar por enterotomia proximal é a escolha inicial para o tratamento do IB. A colecistectomia e a correção da fístula bilioentérica podem ser realizadas juntamente com a remoção do cálculo, no entanto, em pacientes com comorbidades significativas, esses procedimentos devem ser realizados posteriormente.
Uso das diretrizes para tratamento da úlcera por pressão por enfermeiros de um hospital geral
Directory of Open Access Journals (Sweden)
Elaine Maria Leite Rangel
2009-03-01
Full Text Available Este estudo objetivou identificar a freqüência do uso das diretrizes para o tratamento da úlcera por pressão(UP por enfermeiros de um hospital geral no interior do estado de São Paulo. É transversal de caráterdescritivo com análise quantitativa de dados. Amostra de 25 enfermeiros. Para a coleta de dados utilizou-se uminstrumento, construído a partir das diretrizes para o tratamento da UP. As questões foram relacionadas aostipos de intervenções usadas pelos enfermeiros para o tratamento da UP em estágio I, II, com necrose e comtecido de granulação. Para UP em estágio I, 24 (96% enfermeiros sempre realizavam a mudança de decúbito.Nas úlceras em estágio II a utilização de óleos vegetais na ferida era realizada sempre por 10 (40%enfermeiros e o curativo de hidrocolóide nunca era utilizado por 12 (57,1% enfermeiros. Em UP com necrose alimpeza com povidine era realizada por 4 (17,4% enfermeiros às vezes. Para o desbridamento, 16 (64% àsvezes utilizavam papaína e 15 (71,4% às vezes utilizavam colagenase. Em úlceras com tecido de granulaçãosempre era utilizado o soro fisiológico por 25 (100% enfermeiros. Houve variação nas práticas para otratamento da UP e falta de adesão às diretrizes.
Mortalidad por causas externas en Medellín, 1999-2006
Directory of Open Access Journals (Sweden)
Doris Cardona Arango
2008-01-01
Full Text Available Caracterizar el comportamiento de la mortalidad por causas externas en la ciudad de Medellín, Colombia, entre 1999-2006, según sexo, edad y causa básica de muerte fue el objetivo de este estudio descriptivo longitudinal, con fuente de información secundaria de 22 128 registros de defunción por causas externas. El análisis realizado es univariado y bivariado por sexo, grupos de edad y causa de muerte. Las causas externas registradas en el periodo fueron: 72.9 por ciento por homicidio; 15.3 por ciento, accidente de transporte; 7.3 por ciento, traumatismos; 4.2 por ciento, por suicidio, y por otras causas, 0.4 por ciento. La mayor tasa de mortalidad se presentó en el grupo de edad de 20 a 24 años (27.6 por cien mil habitantes, hecho que merece especial consideración por las implicaciones sociales, familiares y laborales que representa el fallecimiento de una persona en su etapa productiva.
Energy Technology Data Exchange (ETDEWEB)
Dionisi, H.M.; Chewning, C.S.; Morgan, K.H.; Menn, F.M.; Easter, J.P; Sayler, G.S. [University of Tennessee, Knoxville, TN (United States). Center for Environmental Biotechnology
2004-07-01
We designed a real-time PCR assay able to recognize dioxygenase large-subunit gene sequences with more than 90% similarity to the Ralstonia sp. strain U2 nagAc gene (nagAc-like gene sequences) in order to study the importance of organisms carrying these genes in the biodegradation of naphthalene. Sequencing of PCR products indicated that this real-time PCR assay was specific and able to detect a variety of nagAc-like gene sequences. One to 100 ng of contaminated-sediment total DNA in 25-{mu}l reaction mixtures produced an amplification efficiency of 0.97 without evident PCR inhibition. The assay was applied to surficial freshwater sediment samples obtained in or in close proximity to a coal tar-contaminated Superfund site. Naphthalene concentrations in the analyzed samples varied between 0.18 and 106 mg/kg of dry weight sediment. The assay for nagAc-like sequences indicated the presence of (4.1 {+-} 0.7) X 10{sup 3} to (2.9 {+-} 0.3) X 10{sup 5} copies of nagAc-like dioxygenase genes per mug of DNA extracted from sediment samples. These values corresponded to (1.2 {+-} 0.6) X 10{sup 5} to (5.4 {+-} 0.4) X 10{sup 7} copies of this target per g of dry weight sediment when losses of DNA during extraction were taken into account. There was a positive correlation between naphthalene concentrations and nagAc-like gene copies per microgram of DNA = 0.89) and per gram of dry weight sediment = 0.77). These results provide evidence of the ecological significance of organisms carrying nagAc-like genes in the biodegradation of naphthalene.
Apendicitis por Paracoccidioides brasiliensis
Directory of Open Access Journals (Sweden)
Ana Beatriz MUÑOZ URRIBARRI
2006-01-01
Full Text Available La paracoccidioidomicosis es la micosis más prevalente en Sudamérica. La forma aguda afecta el sistema fagocítico mononuclear de niños y personas inmunocomprometidas. El compromiso gastrointestinal es frecuente y su patogenia implica diseminación hematógena y linfática. La linfadenomegalia abdominal causa obstrucción intestinal y abdomen agudo. En este artículo damos a conocer el caso de un niño con compromiso gastrointestinal por apendicitis. Este es el primer caso reportado de apendicitis por esta patología. (Rev Med Hered 2006;17:58-60.
Tatuaje por amalgama. Reporte de un caso
Directory of Open Access Journals (Sweden)
Luis Fang Mercado
2012-01-01
Full Text Available El tatuaje por amalgama se origina por el depósito en el tejido conectivo subepitelial de fragmentos de amalgama resultado de procedimientos iatrogénicos por parte del operador. La profundidad a la que se encuentren albergados los residuos de este material influye en la presentación clínica de las lesiones. Radiográficamente se pueden identificar los fragmentos mientras tengan diámetros razonables; histológicamente se pueden observar las partículas de amalgama como gránulos oscuros, sólidos e irregulares dispuesto entre los haces de colágeno y vasos sanguíneos. Este artículo refiere el caso clínico de un paciente que presentó pigmentación por amalgama en mucosa vestibular, originada por una porción de amalgama usada como material obturador en una apicectomía del 11 realizada con anterioridad. Teniendo en cuenta las consideraciones clínicas y radiográficas se optó por realizar una segunda apicectomía con obturación retrógrada con MTA del 11. Durante el procedimiento quirúrgico se cureteó y adelgazó la cara interna del colgajo mucoperióstico para tratar de disminuir el grado de pigmentación.
La pintura vista por un pintor joven
Directory of Open Access Journals (Sweden)
Fuentes Pozo, Pedro
2000-01-01
Full Text Available Not available
El pintor se define a lo largo del tiempo como un artista en mutación influenciado por la sociedad de su momento y por su propio mundo interior Esto ha contribuido a la creación de distintos estilos pictóricos y a una evolución que conlleva la despreocupación por el aspecto formal en aras de una introspección al mundo interior En el cambio constante se refleja la búsqueda del artista que valida la intemporalidad del arte. Así, el verdadero artista sobrevive al aplauso o rechazo de la crítica, convirtiéndose en un verdadero hombre renancentista preocupado por el hallazgo del conocimiento universal.
Experiência inicial com terapia por pressão negativa por instilação em feridas complexas
Directory of Open Access Journals (Sweden)
Dimas André Milcheski
Full Text Available RESUMO Objetivo: relatar a experiência inicial com a terapia por pressão negativa por instilação em feridas complexas infectadas ou contaminadas. Métodos: a terapia por pressão negativa por instilação utilizada foi o V.A.C. Ulta com instilação Veraflo (Kinetic Concepts, Inc. O modo de operação foi contínuo com pressão sub-atmosférica ajustada em 125 mmHg por duas horas e instilação entre as pausas. O tempo de instilação foi de 20 minutos (tempo de contato do agente tópico com a ferida e a substância instilada foi solução salina padrão a 0,9%. Após obtenção de preparo adequado da ferida, ela foi coberta com enxerto ou retalho. Resultados: foram operados dez pacientes com feridas complexas contaminadas ou infectadas. O número médio de trocas da TPNi foi 1,4, o número médio total de cirurgias foi de 2,4, o intervalo até a cobertura da ferida foi de 6,3 dias e o intervalo até a alta foi de 11,4 dias. Conclusão: a comparação da terapia por pressão negativa por instilação com dois estudos prévios (controle histórico evidenciou um tempo de internação menor, favorecendo a TPNi. Este estudo teve um caráter inicial, fazendo-se necessário conduzir um trabalho randomizado e controlado para confirmar a eficácia desta terapia e verificar a sua custo-efetividade.
Neuropatia experimental por DDT: análise de nervo por microdissecção de fibras
Directory of Open Access Journals (Sweden)
Edison Matos Nóvak
1984-09-01
Full Text Available Estudou-se o nervo gênito-femural do rato albino submetido a intoxicação crônica por DDT, administrado por 180 dias na dose de 5 mg/kg de peso via oral. Os resultados mostraram proporção anormal de fibras tipo C, sendo sugerido ocorrer degeneração tipo axonal determinada pelo DDT.
Ptose palpebral causada por Paquidermoperiostose
Directory of Open Access Journals (Sweden)
Patricia Regina de Pinho Tavares
2014-08-01
Full Text Available A paquidermoperiostose é uma síndrome caracterizada por acometimento cutâneo e ósseo, e em alguns casos ocorre comprometimento palpebral leve. É uma síndrome rara, idiopática ou hereditária, com provável herança autossômica dominante de penetrância variável. Descreve-se o caso de um paciente com ptose grave por paquidermoperiostose elucidando sua fisiopatologia e conduta cirúrgica aplicada.
Porter, Todd D; Banerjee, Subhashis; Stolarczyk, Elzbieta I; Zou, Ling
2011-06-01
Cytochrome P450 reductase (POR) is a microsomal electron transport protein essential to cytochrome P450-mediated drug metabolism and sterol and bile acid synthesis. The conditional deletion of hepatic POR gene expression in mice results in a marked decrease in plasma cholesterol levels counterbalanced by the accumulation of triglycerides in lipid droplets in hepatocytes. To evaluate the role of cholesterol and bile acid synthesis in this hepatic lipidosis, as well as the possible role of lipid transport from peripheral tissues, we developed a stable, small interfering RNA (siRNA)-mediated cell culture model for the suppression of POR. POR mRNA and protein expression were decreased by greater than 50% in McArdle-RH7777 rat hepatoma cells 10 days after transfection with a POR-siRNA expression plasmid, and POR expression was nearly completely extinguished by day 20. Immunofluorescent analysis revealed a marked accumulation of lipid droplets in cells by day 15, accompanied by a nearly 2-fold increase in cellular triglyceride content, replicating the lipidosis seen in hepatic POR-null mouse liver. In contrast, suppression of CYP51A1 (lanosterol demethylase) did not result in lipid accumulation, indicating that loss of cholesterol synthesis is not the basis for this lipidosis. Indeed, addition of cholesterol to the medium appeared to augment the lipidosis in POR-suppressed cells, whereas removal of lipids from the medium reversed the lipidosis. Oxysterols did not accumulate in POR-suppressed cells, discounting a role for liver X receptor in stimulating triglyceride synthesis, but addition of chenodeoxycholate significantly repressed lipid accumulation, suggesting that the absence of bile acids and loss of farnesoid X receptor stimulation lead to excessive triglyceride synthesis.
Consanguinidad por isonimia en Salta
Directory of Open Access Journals (Sweden)
Albeza, María V.
2007-01-01
Full Text Available Se estimó el coeficiente de parentesco por isonimia para localidades de la Puna, Valle Calchaquí y Valle de Lerma, a fin de evaluar diferentes factores evolutivos que podrían estar afectando la composición genética de la población. A partir de los apellidos de las parejas consignadas en fuentes primarias de información, se estimó la isonimia conyugal o marital, el coeficiente total Ft y sus componentes Fr (inbreeding azaroso y Fn (inbreeding no azaroso. De las localidades estudiadas, en la Puna se ha detectado sólo una pareja isónima en una de ellas, en el Valle Calchaquí, tres y ninguna en el Valle de Lerma. Tanto en el Valle Calchaquí como en el de Lerma, se han estimado valores negativos de Ft, y en la Puna se registran los valores más elevados. En las localidades estudiadas no se cumple el supuesto de transmisión patrilineal de apellidos por lo que los valores de Fr y por ende de Ft podrían estar subestimados. Es por ello que sería necesario contar con información desde otras vertientes metodológicas para corroborar, complementar y manejar cuidadosamente el análisis de los datos y las conclusiones que se obtienen.
Nefrectomía simple por puerto único (LESS) asistida por robot (da Vinci)
CASTILLO C,OCTAVIO A; VIDAL M,IVAR; SEPÚLVEDA T,FRANCISCO
2011-01-01
Introducción: La cirugía mínimamente invasiva en urología avanza rápidamente y la cirugía laparo-endoscópica a través de puerto único (LESS) no es la excepción. Esta técnica por vía laparoscópica presenta mucha dificultad y requiere de un cirujano laparoscópico experimentado debido a la falta de triangulación y el cruce de los instrumentos. Los beneficios del sistema quirúrgico da Vinci® han sido introducidos recientemente en LESS. Presentamos dos casos de nefrectomía LESS asistida por robot....
International Nuclear Information System (INIS)
Mriithi, L.M.
2002-01-01
Bacterial wilt (BW) caused by Ralstonia solanacearum is one of the most damaging of potato (Solanum tuberosum L.) in Kenya and worldwide. In Kenya Potato tuber yield losses due to BW infection are estimated at 50-100%. Low soil fertility is also one of the most important constraints limiting potato production in central Kenya highlands. Farmers tackle this problem through use of inorganic fertilisers and organic manures, both of which amend the soil environment to influence bacterial wilt development. Undecomposed organic manures can also introduce the pathogen into a clean field. Between short rains 1999 and 2000, 10 on-farm researcher/farmer-designed and farmer-managed trials were done at Kianjuki catchment in Embu District. The objective was to use farmers' participatory research approach and select the most suitable organic and inorganic fertiliser combination(s) with lowest BWI and acceptable usable tuber yields. And also demonstrate use of some components of integrated disease management methods in reduction of disease incidence and spread. Seven treatments were proposed, presented to the farmers for discussion and the most relevant four were selected for evaluation . A newly released potato variety 'Asante' was planted during the short-rains 1999 and long rains 2000. BWI didn't;t result in significant differences between treatments but the tuber yields were significantly different in short-rains 1999 and 2000. During short-rains 2000, both BWI and tuber yields and unusable tubers differed significantly between treatments. The results confirmed that use of well-decomposed manures or manures from pathogen-free areas can be used in combination with inorganic fertilisers to improve soil fertility and potato tuber yields in smallholder farm without influencing BWI. Use of certified seed tubers in pathogen free fields and following recommendation field sanitation measures, resulted in apparently bacterial wilt free crop
Lee, Boyoung; Lee, Soohyun; Ryu, Choong-Min
2012-07-01
Plants modulate defence signalling networks in response to different biotic stresses. The present study evaluated the effect of a phloem-sucking aphid on plant defence mechanisms in pepper (Capsicum annuum) during subsequent pathogen attacks on leaves and rhizosphere bacteria on roots. Plants were pretreated with aphids and/or the chemical trigger benzothiadiazol (BTH) 7 d before being challenged with two pathogenic bacteria, Xanthomonas axonopodis pv. vesicatoria (Xav) as a compatible pathogen and X. axonopodis pv. glycines (Xag) as an incompatible (non-host) pathogen. Disease severity was noticeably lower in aphid- and BTH + aphid-treated plants than in controls. Although treatment with BTH or aphids alone did not affect the hypersensitive response (HR) against Xag strain 8ra, the combination treatment had a synergistic effect on the HR. The aphid population was reduced by BTH pretreatment and by combination treatment with BTH and bacterial pathogens in a synergistic manner. Analysis of the expression of the defence-related genes Capsicum annum pathogenesis-related gene 9 (CaPR9), chitinase 2 (CaCHI2), SAR8·2 and Lipoxygenase1 (CaLOX1) revealed that aphid infestation resulted in the priming of the systemic defence responses against compatible and incompatible pathogens. Conversely, pre-challenge with the compatible pathogen Xav on pepper leaves significantly reduced aphid numbers. Aphid infestation increased the population of the beneficial Bacillus subtilis GB03 but reduced that of the pathogenic Ralstonia solanacearum SL1931. The expression of defence-related genes in the root and leaf after aphid feeding indicated that the above-ground aphid infestation elicited salicylic acid and jasmonic acid signalling throughout the whole plant. The findings of this study show that aphid feeding elicits plant resistance responses and attracts beneficial bacterial populations to help the plant cope with subsequent pathogen attacks.
Shelobolina, Evgenya; Konishi, Hiromi; Xu, Huifang; Benzine, Jason; Xiong, Mai Yia; Wu, Tao; Blöthe, Marco; Roden, Eric
2012-01-01
The biogeochemistry of phyllosilicate-Fe redox cycling was studied in a Phalaris arundinacea (reed canary grass) dominated redoximorphic soil from Shovelers Sink, a small glacial depression near Madison, WI. The clay size fraction of Shovelers Sink soil accounts for 16% of the dry weight of the soil, yet contributes 74% of total Fe. The dominant mineral in the clay size fraction is mixed layer illite-smectite, and in contrast to many other soils and sediments, Fe(III) oxides are present in low abundance. We examined the Fe biogeochemistry of Shovelers Sink soils, estimated the abundance of Fe redox cycling microorganisms, and isolated in pure culture representative phyllosilicate-Fe oxidizing and reducing organisms. The abundance of phyllosilicate-Fe reducing and oxidizing organisms was low compared to culturable aerobic heterotrophs. Both direct isolation and dilution-to-extinction approaches using structural Fe(II) in Bancroft biotite as a Fe(II) source, and O(2) as the electron acceptor, resulted in recovery of common rhizosphere organisms including Bradyrhizobium spp. and strains of Cupriavidus necator and Ralstonia solanacearum. In addition to oxidizing biotite and soluble Fe(II) with O(2), each of these isolates was able to oxidize Fe(II) in reduced NAu-2 smectite with [Formula: see text] as the electron acceptor. Oxidized NAu-2 smectite or amorphous Fe(III) oxide served as electron acceptors for enrichment and isolation of Fe(III)-reducing microorganisms, resulting in recovery of a strain related to Geobacter toluenoxydans. The ability of the recovered microorganisms to cycle phyllosilicate-Fe was verified in an experiment with native Shovelers Sink clay. This study confirms that Fe in the native Shovelers Sink clay is readily available for microbial redox transformation and can be cycled by the Fe(III)-reducing and Fe(II)-oxidizing microorganisms recovered from the soil.
Shelobolina, Evgenya; Konishi, Hiromi; Xu, Huifang; Benzine, Jason; Xiong, Mai Yia; Wu, Tao; Blöthe, Marco; Roden, Eric
2012-01-01
The biogeochemistry of phyllosilicate–Fe redox cycling was studied in a Phalaris arundinacea (reed canary grass) dominated redoximorphic soil from Shovelers Sink, a small glacial depression near Madison, WI. The clay size fraction of Shovelers Sink soil accounts for 16% of the dry weight of the soil, yet contributes 74% of total Fe. The dominant mineral in the clay size fraction is mixed layer illite–smectite, and in contrast to many other soils and sediments, Fe(III) oxides are present in low abundance. We examined the Fe biogeochemistry of Shovelers Sink soils, estimated the abundance of Fe redox cycling microorganisms, and isolated in pure culture representative phyllosilicate–Fe oxidizing and reducing organisms. The abundance of phyllosilicate–Fe reducing and oxidizing organisms was low compared to culturable aerobic heterotrophs. Both direct isolation and dilution-to-extinction approaches using structural Fe(II) in Bancroft biotite as a Fe(II) source, and O2 as the electron acceptor, resulted in recovery of common rhizosphere organisms including Bradyrhizobium spp. and strains of Cupriavidus necator and Ralstonia solanacearum. In addition to oxidizing biotite and soluble Fe(II) with O2, each of these isolates was able to oxidize Fe(II) in reduced NAu-2 smectite with NO3- as the electron acceptor. Oxidized NAu-2 smectite or amorphous Fe(III) oxide served as electron acceptors for enrichment and isolation of Fe(III)-reducing microorganisms, resulting in recovery of a strain related to Geobacter toluenoxydans. The ability of the recovered microorganisms to cycle phyllosilicate–Fe was verified in an experiment with native Shovelers Sink clay. This study confirms that Fe in the native Shovelers Sink clay is readily available for microbial redox transformation and can be cycled by the Fe(III)-reducing and Fe(II)-oxidizing microorganisms recovered from the soil. PMID:22493596
Directory of Open Access Journals (Sweden)
Triwidodo Arwiyanto
2012-02-01
Full Text Available Lincat disease of tobacco causing severe losses of the product. Control of the disease with any available measure unlikely giving enough control. A number of Bacillus spp. isolates could suppressed the growth of pathogen in vitro and suppressed the development of lincat disease in the field. This article report the charactheristics of six isolates of Bacillus spp. (Ba-4, Ba-22, Ba-24, Ba-30, Ba-33, dan Ba-41. These isolates proven could suppressed lincat disease in the field. Characterization of the isolates include the morphological, physiological characteristics, and pathogenicity against tobacco plant. The results indicated that the bacterial isolates were belong to the genus Bacillus with the following charactheristics. The bacteria were rod shapes, forming endospore, Gram positive, fermentative, positive reaction in katalase, oksidase, and Voges Proskaeur tests. Negative results were obtained for Methyl Red test, hydrolysis of starch, gelatine, and casein. The present isolates could use citrate and several carbohydrates as carbon sources. Reduce nitrate to nitrite. The isolates could grow in the medium with high osmotic pressure, i.e. could grow in the medium with 7% NaCl. The present isolates grew well in the medium with pH of 4.5 €“10 and could grow in the temperature range of 10 €“50 °C. According to pathogenicity test, the present isolates were not belong to the plant pathogenic bacteria. The present isolates could suppressed the growth of Ralstonia solanacearum in vitro, and could reduce the egg number of Meloidogyne incognita. According to the physiological charactheristics tested, it seem that isolates of Ba-4, Ba-24, Ba-30, dan Ba-33, and Ba-41 having similar charactheristics with Bacillus cereus. The Ba-22 isolate, however, having similar characteristics with B. licheniformis.
Directory of Open Access Journals (Sweden)
Athanasios Lykidis
Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.
Soil Acidification Aggravates the Occurrence of Bacterial Wilt in South China
Directory of Open Access Journals (Sweden)
Chen Xu
2017-04-01
Full Text Available Soil acidification is a major problem in modern agricultural systems and is an important factor affecting the soil microbial community and soil health. However, little is known about the effect of soil acidification on soil-borne plant diseases. We performed a 4-year investigation in South China to evaluate the correlation between soil acidification and the occurrence of bacterial wilt. The results showed that the average soil pH in fields infected by bacterial wilt disease was much lower than that in non-disease fields. Moreover, the proportion of infected soils with pH lower than 5.5 was much higher than that of non-infected soils, and this phenomenon became more obvious as the area of bacterial wilt disease increased at soil pH lower than 5.5 from 2011 to 2014. Then, in a field pot experiment, bacterial wilt disease developed more quickly and severely in acidic conditions of pH 4.5, 5.0, and 5.5. These results indicate that soil acidification can cause the outbreak of bacterial wilt disease. Further experiments showed that acidic conditions (pH 4.5–5.5 favored the growth of the pathogen Ralstonia solanacearum but suppressed the growth and antagonistic activity of antagonistic bacteria of Pseudomonas fluorescens and Bacillus cereus. Moreover, acidic conditions of pH 5.5 were conducive to the expression of the virulence genes PopA, PrhA, and SolR but restrained resistance gene expression in tobacco. Finally, application of wood ash and lime as soil pH amendments improved soil pH and reduced the occurrence of bacterial wilt. Together, these findings improve our understanding of the correlation between soil acidification and soil-borne plant diseases and also suggest that regulation of soil acidification is the precondition and foundation of controlling bacterial wilt.
Jave Escalante, Gladys Lizeth
2015-01-01
Determina el costo generado por el ausentismo laboral atribuible a licencias médicas por enfermedad en el Hospital Nacional Arzobispo Loayza 2015. METODOLOGÍA: Estudio no experimental. La muestra estuvo conformada por 118 médicos asistenciales y personal de enfermería. Para el análisis de los costos se utilizó el costo de tiempo perdido del paciente, ingresos dejados de percibir por el hospital y descuento económico al trabajador. Además se realizó un análisis económico y de sensibilidad. ...
Directory of Open Access Journals (Sweden)
Montoya H Luz Marina
1982-09-01
Full Text Available Un índice es una lista de palabras o frases indicadores asociados que permite la ubicación de material al interior de un libro o una publicación, en este caso será por el nombre de la materia.
Mortalidad intrahospitalaria por accidente cerebrovascular
Federico Rodríguez Lucci; Virginia Pujol Lereis; Sebastián Ameriso; Guillermo Povedano; María F. Díaz; Alejandro Hlavnicka; Néstor A. Wainsztein; Sebastián F. Ameriso
2013-01-01
La mortalidad global por accidente cerebrovascular (ACV) ha disminuido en las últimas tres décadas, probablemente debido a un mejor control de los factores de riesgo vascular. La mortalidad hospitalaria por ACV ha sido tradicionalmente estimada entre 6 y 14% en la mayoría de las series comunicadas. Sin embargo, los datos de ensayos clínicos recientes sugieren que esta cifra sería sustancialmente menor. Se revisaron datos de pacientes internados con diagnóstico de ACV del Banco de Datos de Str...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... solanacearum GMI1000] ... Length = 190 ... Query: 9 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPT...TITTVETEGFSGY 68 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPTTITTVE...TEGFSGY Sbjct: 1 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPTTITTVETEGFSGY 60 ... Query: 129 EGGYEIYMVADAS
CARACTERÍSTICAS DA VIOLÊNCIA SEXUAL SOFRIDA POR CRIANÇAS ASSISTIDAS POR UM PROGRAMA DE APOIO
Directory of Open Access Journals (Sweden)
KELLY LINHARES VASCONCELOS
2010-01-01
Full Text Available En Brasil, las estadísticas de la violencia sexual contra niños están lejos de reflejar la verdadera realidad actual debido a la baja notificación de los casos. La finalidad de este estudio fue caracterizar el abuso sexual sufrido por niños asistidos por el Programa Sentinela y el perfil del agresor, en Sobral-Ceará, en el periodo que va del 2002 al 2006. La muestra no probabilística intencional fue compuesta por 50 víctimas de abuso sexual y de las mismas, el 66% es del sexo femenino, con predominio de rango de edad entre 8-12 años incompletos, (58%; en el 36% de los casos los padres están separados, siendo la madre la principal responsable por la familia (62%. La mayoría de los agresores es del sexo masculino (78%. En el ambiente fuera de la familia los agresores son conocidos o amigos de la familia (14%; dentro del seno familiar el padrastro es identificado como siendo el agresor más frecuente (18%. Los datos destacan características similares a las de otros estudios, definiendo una cierta igualdad en este tipo de violencia.
Vivencias psicosociales reveladas por niños que reciben tratamiento con quimioterapia por cáncer
Directory of Open Access Journals (Sweden)
BLANCA CECILIA VANEGAS DE AHOGADO
2009-12-01
Full Text Available Se realizó un estudio cualitativo con el propósito de descubrir las vivencias psicosociales de niños y niñas de 9 a 12 años que recibían tratamiento con quimioterapia por cáncer. La recolección de la información se hizo mediante encuentros lúdicos con el apoyo de algunas preguntas básicas que facilitaron las revelaciones narrativas. Tres aspectos se destacan en los hallazgos del estudio: vivencias desfavorables, vivencias relacionadas con la autoestima y vivencias favorables; las dos primeras, de diversa manera, afectan en estos niños su vida personal, familiar, escolar y, en general, todo su entorno. Es de resaltar que, como consecuencia de la caída del cabello, con frecuencia han sido objeto de burla y de rechazo por sus compañeros de estudio, lo que produce el más notorio efecto sobre su autoimagen; por otra parte, el ausentismo escolar conlleva dificultades académicas y sentimientos de tristeza en estos niños, situación que empeora cuando, por motivos de tratamiento, su lugar de residencia está alejado de la ciudad, viéndose sometidos a largos periodos de separación, no solo de su familia sino de sus pares. Se concluye que la mayor parte de las revelaciones son impactantes por su gran contenido de sufrimiento y dolor para estos niños, lo que demuestra la urgencia de retomar los hallazgos del estudio para orientar el cuidado de enfermería de manera más integral y apoyar para que se haga lo propio en el hogar y en las instituciones educativas.
Pedro Teixeira y su viaje por Mesopotamia
Directory of Open Access Journals (Sweden)
Fuente del Pilar, José Javier
2005-04-01
Full Text Available Pedro Teixeira es un integrante notable de la ilustre nómina de los viajeros portugueses que, a finales del s, XVI y principios del XVII, ensancharon para Occidente las fronteras del mundo. Su conocimiento en España se debe a la publicación en 1994 de su obra «Relaciones del Origen, Descendencia y Sucesión de los Reyes de Persia, y de Harmuz, y de un viaje hecho por el autor dende la India hasta Italia por tierra», en edición realizada por el profesor Eduardo Barajas Sala, lamentablemente fallecido en 1997. En este artículo se ofrece una reseña biográfica de Pedro Teixeira, y un análisis del viaje narrado por el autor en la última parte de sus «Relaciones »: el que desde Ormuz le conducirá, a través de Mesopotamia, hasta la costa del Mediterráneo.…
Violência e mortes por causas externas
Directory of Open Access Journals (Sweden)
Graciete Oliveira Vieira
2003-02-01
Full Text Available Através de um estudo ecológico caracterizou-se a violência e as mortes por causas externas em Salvador e Bahia utilizando-se dados da Fundação Nacional de Saúde-Ministério da Saúde, dos registros de mortalidade e das estimativas populacionais do IBGE. O risco de morrer por homicídio no Brasil é 3 vezes o do Estados Unidos, chegando a ser 40 vezes superior ao do Japão. Homicídio foi a primeira causa de anos potenciais de vidas perdidos (13,4% no Brasil (1997, seguido por acidentes de trânsito (10,6%. Causas externas foi a segunda causa de morte em Salvador e Bahia (1996. A violência tem raízes sócio-culturais e político-ideológicas e pode ser prevenida por ações intersetoriais e multidisciplinares.
Associação entre violência por parceiro íntimo contra a mulher e infecção por HIV
Directory of Open Access Journals (Sweden)
Claudia Barros
2011-04-01
Full Text Available OBJETIVO: Analisar a associação entre a violência por parceiro íntimo contra mulheres e a infecção ou suspeita de infecção pelo vírus da imunodeficiência humana (HIV. MÉTODOS: Estudo transversal com base em dados de questionários aplicados face-a-face e de prontuários médicos de 2.780 mulheres de 15 a 49 anos, atendidas em unidades do sistema único de saúde da Grande São Paulo, SP, em 2001-2002. As mulheres foram categorizadas em: usuárias em tratamento por serem "soropositivas para o HIV", com "suspeita de HIV" e aquelas que procuraram os serviços por outros motivos. A violência por parceiro íntimo contra mulheres na vida foi categorizada por gravidade e recorrência dos episódios de violência. A associação com o desfecho foi testada pelo modelo de Poisson com variância robusta e ajustada por variáveis sociodemográficas, sexuais e reprodutivas. RESULTADOS: A prevalência de violência foi de 59,8%. Sofrer violência reiterada e grave apresentou maior associação de infecção confirmada pelo HIV (RP = 1,91. A violência independente da gravidade e da recorrência dos episódios apresentou maior associação para a suspeita de infecção por HIV (RP = 1,29. CONCLUSÕES: A violência por parceiro íntimo contra mulheres tem papel relevante nas situações de suspeita e confirmação da infecção pelo HIV, sendo essencial incluir sua detecção, controle e prevenção como parte da atenção integral à saúde das mulheres.
Directory of Open Access Journals (Sweden)
Tang Renxian
2010-11-01
Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.
Cobos García, Angel; Díaz Rubio, Olga
2011-01-01
Esta unidade didáctica denominada Conservación por calor forma parte da materia «Tecnoloxía do procesado de alimentos» que se impartirá no primeiro semestre do 2º curso do Grao en Nutrición Humana e Dietética. A materia estrutúrase en diferentes unidades didácticas, tratando cada unha delas as diferentes tecnoloxías de procesado dos alimentos, tanto de conservación coma de transformación. A presente unidade didáctica aborda a conservación dos alimentos por calor. Este método permite destruír ...
Storani, Emilia
2017-01-01
El artículo propone indagar sobre los modos y diferentes formatos que se utilizan tanto en la escritura como en la lectura, para articular con las luchas por la identidad de género. La Ley de Identidad de Género ha sido un puntapié clave para pensarnos a nosotros mismos culturalmente y para pensar a los demás. Pero, ¿cómo mencionamos, escribimos y leemos las diferentes identidades? La escritura, también es un mundo transformador para quienes bregan por una sociedad más libre y sin prejuicios....
Diverticulitis yeyunal perforada por enterolito.
Marenco De la Cuadra, Beatriz; Gomez-Rosado, Juan-Carlos; Capitan-Morales, Luis-Cristobal; Valdés Hernández, Javier; Reyes-lopera, N.J. De los
2012-01-01
La diverticulosis yeyunal es una enfermedad adquirida rara. Casi el 60-70% keeps asymptomátic or Con síntomas crónicos inespecíficos, aunque puede presentarse como un abdomen agudo. La perforación debida a enterolitos es una causa extremadamente rara do complicación, y puede producirse por la impactación de ésta contra la pared intestinal. Presentamos caso de un varón de 82 años que acude a urgencias por un dolor súbito abdominal, difuso, con irritación peritoneal, leucocitosis con neutro...
Por y para en los manuales de ELE
Directory of Open Access Journals (Sweden)
Sidoti, Rossana
2008-12-01
Full Text Available La oposición por / para es una de las cuestiones gramaticales que comportan mayor dificultad a la hora de acercarse al estudio del español como L2 sobre todo cuando remiten a conceptos lingüísticos difíciles de entender por no tener ésta referente alguno en el mundo extralingüístico. Si, por un lado, nos resulta fácil entender lo que tiene un referente en el mundo concreto; por otro, no podemos advertir el referente extralingüístico de preposiciones como por / para, si este no existe. Si las preposiciones son elementos abstractos, difíciles de aferrar de por sí, podemos sólo examinar los elementos que éstas ponen en relación y en qué contextos esta relación se determina. Para poder utilizar con precisión las dos preposiciones, es importante no reducirlas a una sola preposición como ocurre en otros idiomas, y sobre todo no relacionarlas sólo a los conceptos de causa y finalidad. Este trabajo se propone individualizar los manuales de español como lengua extranjera más utilizados en las universidades italianas para luego comparar las distintas fuentes de información sobre por / para y exponer comentarios, reflexiones y sugerencias sobre el tema con el fin de precisar en qué medida se puede mejorar lo que los manuales reducen o generalizan, puesto que para los estudiantes de ELE estos representan una herramienta valiosa a la que acudir.
Pronóstico de la diarrea por rotavirus
Directory of Open Access Journals (Sweden)
Mota-Hernández Felipe
2001-01-01
Full Text Available Objetivo. Comparar la gravedad de la diarrea por rotavirus (RV y por no rotavirus. Material y métodos. Estudio transversal en 520 lactantes con diarrea aguda, efectuado entre octubre de 1994 y marzo de 1995 en siete centros del primer nivel de atención en cinco estados de México. El diagnóstico de RV se realizó con ensayo inmunoenzimático o por electroforesis. El análisis se hizo a través de medidas de tendencia central. Los resultados se presentan como promedio y desviación estándar o mediana o variación. Resultados. Se aisló RV en 264 lactantes (50.7% con predominio en varones de 6 meses a un año. Las manifestaciones clínicas fueron significativamente diferentes entre el grupo rotavirus positivo y el grupo rotavirus negativo en mediana de evacuaciones por 24 horas, frecuencia de vómitos, temperatura > 38° C, deshidratación y calificación de gravedad, respectivamente. Conclusiones. Estos resultados mostraron peor pronóstico por mayor gravedad de la diarrea por RV en lactantes, con relación a otra etiología. El texto completo en inglés de este artículo está disponible en: http://www.insp.mx/salud/index.html
Miasis cutanea por cordylobia anthropophaga
Directory of Open Access Journals (Sweden)
Alkorta Gurrutxaga Miriam
2001-01-01
Full Text Available El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ha efectuado una revisión de los casos de miasis cutáneas forunculoides importadas publicados en España, así como de la biología, patología, tratamiento y prevención de la miasis humana por Cordylobia anthropophaga. El caso referido, se caracterizó por la infestación con un número inusualmente elevado de larvas, no sospechándose su etiología hasta la fase final de la enfermedad. La emergencia continuada de larvas (se recogieron 91 generó en la paciente un estado de ansiedad importante. Finalmente, la eliminación de las larvas provocó una rápida mejoría de la paciente. Aunque los casos de miasis cutánea no tienen la gravedad de otras enfermedades importadas, su conocimiento es necesario desde el punto de vista preventivo, diagnóstico y terapeútico. Es importante proceder a la identificación morfológica de las larvas diferenciándolas de otro tipo de miasis con implicaciones terapéuticas diferentes.
Directory of Open Access Journals (Sweden)
Claudia Barros
2011-04-01
Full Text Available OBJETIVO: Analisar a associação entre a violência por parceiro íntimo contra mulheres e a infecção ou suspeita de infecção pelo vírus da imunodeficiência humana (HIV. MÉTODOS: Estudo transversal com base em dados de questionários aplicados face-a-face e de prontuários médicos de 2.780 mulheres de 15 a 49 anos, atendidas em unidades do sistema único de saúde da Grande São Paulo, SP, em 2001-2002. As mulheres foram categorizadas em: usuárias em tratamento por serem "soropositivas para o HIV", com "suspeita de HIV" e aquelas que procuraram os serviços por outros motivos. A violência por parceiro íntimo contra mulheres na vida foi categorizada por gravidade e recorrência dos episódios de violência. A associação com o desfecho foi testada pelo modelo de Poisson com variância robusta e ajustada por variáveis sociodemográficas, sexuais e reprodutivas. RESULTADOS: A prevalência de violência foi de 59,8%. Sofrer violência reiterada e grave apresentou maior associação de infecção confirmada pelo HIV (RP = 1,91. A violência independente da gravidade e da recorrência dos episódios apresentou maior associação para a suspeita de infecção por HIV (RP = 1,29. CONCLUSÕES: A violência por parceiro íntimo contra mulheres tem papel relevante nas situações de suspeita e confirmação da infecção pelo HIV, sendo essencial incluir sua detecção, controle e prevenção como parte da atenção integral à saúde das mulheres.OBJETIVO: Analizar la asociación entre la violencia contra mujeres por pareja íntima y la infección o sospecha de infección por el virus de inmunodeficiencia humana (VIH. MÉTODOS: Estudio transversal con base en datos de cuestionarios aplicados cara-a cara y de prontuarios médicos de 2.780 mujeres de 15 a 49 años, atendidas en unidades del sistema único de salud de la Gran Sao Paulo, Sureste de Brasil, en 2001-2002. Las mujeres fueron categorizadas en: usuarias en tratamiento por ser
Itinerarios Didácticos por la isla de Lanzarote
Becerra-Ramírez, Rafael; González Cárdenas, Elena; Gosálvez, Rafael U.; Escobar Lahoz, Estela; Dóniz-Páez, Javier
2013-01-01
Con la confección de esta guía de itinerarios didácticos por la isla de Lanzarote pretendemos contribuir a un mayor conocimiento de las características geográficas de este espacio dominado por las formas volcánicas que caracterizan un paisaje modificado por la mano del hombre que convive con los volcanes y los usa, tradicionalmente como soporte de sus cultivos, y modernamente como base de la industria turística. Los itinerarios didácticos por la isla de Lanzarote son la adaptación de los t...
Signos Vitales de los CDC-Muertes por intoxicación por alcohol (Alcohol Poisoning Deaths)
Centers for Disease Control (CDC) Podcasts
2015-01-06
Este podcast se basa en la edición de enero del 2015 del informe Signos Vitales de los CDC. En los Estados Unidos, mueren en promedio seis personas cada dÃa debido a la intoxicación por alcohol. Infórmese sobre lo que puede hacer para prevenir los atracones de alcohol y las intoxicaciones por alcohol. Created: 1/6/2015 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP). Date Released: 1/6/2015.
Topoplastia de Cvintal assistida por laser de femtossegundo
Directory of Open Access Journals (Sweden)
Alexandre Takayoshi Ishizaki
2013-06-01
Full Text Available Apresentamos um relato de astigmatismo tardio progressivo pós-transplante de córnea para ceratocone, associado à afinamento periférico na junção doador-receptor, o que presumidamente pode ser considerado como recorrência da ectasia. O caso foi tratado por meio de Topoplastia de Cvintal assistida por laser de femtossegundo para a confecção da incisão com geometria "top hat", seguido de sutura com ajuste per-operatório guiado por ceratoscopia.
Micetoma por Nocardia brasiliensis: reporte de caso
Directory of Open Access Journals (Sweden)
Miriam Guevara R
2003-07-01
Full Text Available Se presenta el caso de un paciente peruano, agricultor, con una infección cutánea de origen traumático causada por Nocardia brasiliensis, que evolucionó hacia la amputación del miembro inferior afectado. El diagnóstico se realizó por examen directo y cultivo del espécimen.
Mortalidad por envenenamiento en niños
Directory of Open Access Journals (Sweden)
Híjar Martha
1998-01-01
Full Text Available Objetivo. Conocer el panorama de las muertes por envenenamiento en niños de 0-14 años ocurridas en la República mexicana, entre 1979 y 1994. Material y métodos. Se utilizaron fuentes secundarias. Las variables analizadas fueron: edad, sexo, año, causa externa de traumatismos y envenenamientos, de la IX Clasificación Internacional de Enfermedades: E850-E858, E860-E869 y E905. Mediante un modelo de regresión Poisson se analizaron tendencias por causa específica y se obtuvieron riesgos relativos según edad, sexo y entidad federativa. Resultados. Hubo un total de 11 272 defunciones en menores de 15 años; las principales causas fueron el envenenamiento y las reacciones tóxicas causadas por plantas y animales venenosos (E905, el envenenamiento accidental por gas de uso doméstico y por monóxido de carbono (E868 y el envenenamiento accidental por otras drogas (E858. El grupo de edad que presentó los mayores riesgos, para las causas mencionadas, fue el de menores de un año con un riesgo relativo (RR de 29.6, IC95% 29.2-33.4; RR 3.47, IC95% 2.86-4.22, y RR 31.86, IC95% 24.8-40.9. El riesgo fue similar en ambos sexos, salvo para la causa E905. El estado de Aguascalientes se situó sistemáticamente entre los de mayor riesgo para todas las causas analizadas, mientras que Nuevo León siempre se ubicó entre los de riesgo más bajo. Conclusiones. El envenenamiento constituye una importante causa de muerte en los niños; el riesgo se incrementa al disminuir la edad. Considerando que esas muertes son potencialmente evitables y que la mayor parte de los envenenamientos ocurren en el hogar, para prevenirlos, se recomienda a los familiares vigilar y mantener fuera de peligro al niño. Por otra parte, la multicausalidad del fenómeno requiere que su prevención se realice desde una perspectiva multidisciplinaria que genere una cultura y un ambiente de seguridad en la sociedad.
Energy Technology Data Exchange (ETDEWEB)
Sinskey, Anthony J. [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Worden, Robert Mark [Michigan State Univ., East Lansing, MI (United States); Brigham, Christopher [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Lu, Jingnan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Quimby, John Westlake [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Gai, Claudia [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Speth, Daan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Elliott, Sean [Boston Univ., MA (United States); Fei, John Qiang [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Bernardi, Amanda [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Li, Sophia [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Grunwald, Stephan [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Grousseau, Estelle [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Maiti, Soumen [Michigan State Univ., East Lansing, MI (United States); Liu, Chole [Michigan State Univ., East Lansing, MI (United States)
2013-12-16
This research project is a collaboration between the Sinskey laboratory at MIT and the Worden laboratory at Michigan State University. The goal of the project is to produce Isobutanol (IBT), a branched-chain alcohol that can serve as a drop-in transportation fuel, through the engineered microbial biosynthesis of Carbon Dioxide, Hydrogen, and Oxygen using a novel bioreactor. This final technical report presents the findings of both the biological engineering work at MIT that extended the native branched-chain amino acid pathway of the wild type Ralstonia eutropha H16 to perform this biosynthesis, as well as the unique design, modeling, and construction of a bioreactor for incompatible gasses at Michigan State that enabled the operational testing of the complete system. This 105 page technical report summarizing the three years of research includes 72 figures and 11 tables of findings. Ralstonia eutropha (also known as Cupriavidus necator) is a Gram-negative, facultatively chemolithoautotrophic bacteria. It has been the principle organism used for the study of polyhydroxybutyrate (PHB) polymer biosynthesis. The wild-type Ralstonia eutropha H16 produces PHB as an intracellular carbon storage material while under nutrient stress in the presence of excess carbon. Under this stress, it can accumulate approximately 80 % of its cell dry weight (CDW) as this intracellular polymer. With the restoration of the required nutrients, the cells are then able to catabolize this polymer. If extracted from the cell, this PHB polymer can be processed into biodegradable and biocompatible plastics, however for this research, it is the efficient metabolic pathway channeling the captured carbon that is of interest. R. eutropha is further unique in that it contains two carbon-fixation Calvin–Benson–Bassham cycle operons, two oxygen-tolerant hydrogenases, and several formate dehydrogenases. It has also been much studied for its ability in the presence of oxygen, to fix carbon dioxide
Selección de Recursos Humanos por Competencias
Sánchez Domingo, Cristina
2013-01-01
Los objetivos de este trabajo son, por un lado conocer en qué consisten los procesos de valoración y selección de personas desde el enfoque de las competencias laborales. Para ello, ha sido preciso profundizar en el estudio del concepto de “competencia laboral”, y comprender qué es la Gestión de Recursos Humanos por Competencias, en cuyo seno se encuentra la propia Selección de Recursos Humanos. Por otra parte, un segundo objetivo del trabajo es conocer el grado de implantación de la Selecció...
Tallado de hélices por el método de copiado por proyección
Directory of Open Access Journals (Sweden)
José Vicente Fierro Vasco
1983-01-01
Full Text Available Este dispositivo fue diseñado como parte de la investigación sobre Aerogeneradores que se está llevando a cabo en el Departamento de Ingeniería Mecánica, cuyo investigador principal es el Ing. Julio Mario Rodríguez Devis. Como parte inicial de la investigación se adecuó un túnel situado en el Laboratorio de Hidráulica para hacer las pruebas de modelos. En la construcción de dichos modelos se requiere una buena precisión en la hechura de las aspas del molino, en especial por el tamaño reducido de liste. Se debe garantizar que el perfil aerodinámico se conserve a lo largo del aspa, por lo que se requiere de un dispositivo capaz de tallar los álabes con la precisión y rapidez necesarias. Los resultados del trabajo fueron presentados al concurso del premio Worthington de la Ingeniería Colombiana 1982 (Categoría estudiantes, por los estudiantes que trabajaron en el proyecto, siendo acreedores al primer puesto.
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... solanacearum GMI1000] ... Length = 136 ... Query: 11 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLL...EDKYGYVAAVLPSTYHLHLSE 70 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLLEDKYGY...VAAVLPSTYHLHLSE Sbjct: 1 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLLEDKYGYVAAVLPSTYHLHLSE 60 ... Query: 131 ENLVHMDMDQFMALMR 146 ... ENLVHMDMDQFMALMR Sbjct: 121 ENLVHMDMDQFMALMR 136
Directory of Open Access Journals (Sweden)
George Deroco Martins
Full Text Available O cultivo da cana-de-açúcar no Brasil, embora assistido por técnicas modernas de plantio, é alvo constante de parasitas do sistema radicular. Por registrar seletivamente o fluxo espectral da radiação eletromagnética refletida pela vegetação, o sensoriamento remoto tornou-se uma poderosa ferramenta na detecção das plantas infectadas por patógenos do solo. Com o objetivo de caracterizar espectralmente a cana-de-açúcar sadia e infectada por nematoides e pela larva do besouro Migdolus fryanus, foram tomadas medidas radiométricas in situ e geradas curvas hiperespectrais de plantas sadias e infectadas. Técnicas específicas de análise espectral, como a determinação da posição da borda do vermelho limítrofe (Red Edge Position Determination - REPD e diferentes índices espectrais foram avaliados para discriminar as três ocorrências. As curvas de reflectância mostraram diferenças em magnitude principalmente nos comprimentos de onda do vermelho e infravermelho próximo e, assim como a determinação do REP e os índices de clorofila b, NDVI, MCARI e TCARI, permitiram distinguir apenas entre plantas sadias e infectadas. As razões espectrais sensíveis aos pigmentos clorofila a e carotenoides, porém, discriminaram as três ocorrências, inclusive plantas infectadas por nematoides e Migdolus fryanus. A melhor discriminação foi obtida com o índice de carotenoides, um pigmento fortemente relacionado com estresse da planta
Osteoporosis secundaria y Osteoporosis inducida por glucocorticoides (OIG
Directory of Open Access Journals (Sweden)
Elías Forero Illera
2006-01-01
Full Text Available La osteoporosis es un problema de salud pública importante a nivel mundial, y su prevalencia está aumentando. La osteoporosis secundaria se puede producir por varias patologías y el uso de ciertos medicamentos. Los glucocorticoides son un grupo de fármacos usados extensamente en la práctica médica debido a su indiscutible utilidad. La osteoporosis inducida por glucocorticoides es un problema de salud pública. Aunque la patogénesis de la pérdida producida por los glucocorticoides en el hueso no se conoce totalmente, investigaciones recientes han proporcionado nuevas conocimientos en los mecanismos de estos fármacos a nivel celular y molecular. Diversas guías han sido propuestas por diversos grupos para el tratamiento de la OIG; desafortunadamente, las guías del tratamiento no se utilizan adecuadamente en los pacientes.
Principais gestos esportivos executados por jogadores de handebol
Directory of Open Access Journals (Sweden)
Luiz Carlos Hespanhol Junior
2012-09-01
Full Text Available Este estudo teve como objetivo quantificar os principais gestos esportivos executados por jogadores profissionais de handebol. Para a mensuração quantitativa dos principais movimentos executados por cada jogador de handebol avaliado foram realizadas gravações de vídeo em todos os jogos. Foram realizados em média 1288,0 (DP = 190,7 gestos esportivos por jogo. Os armadores centrais realizaram em média 375,0 (DP = 83,7 gestos esportivos, e a posição de pivô 63,3 (DP = 21,2 gestos por jogo. As recepções e os passes foram os gestos mais executados, e a posição que mais realizou gestos esportivos na equipe de handebol avaliada foi o armador central, seguido do armador esquerdo e direito. O pivô foi a posição que menos realizou gestos esportivos.
Higiene mental: conferencia dictada por la Radiodifusora Nacional
Directory of Open Access Journals (Sweden)
Francisco Gómez Pinzón
1941-01-01
tiene extraordinaria trascendencia para el país por sus vastas repercusiones sobre el futuro de nuestro pueblo, y que, sin embargo ha sido negligentemente olvidado por las autoridades y deliberadamente ignorado por los sectores cultos e ilustrados de nuestra sociedad. Me refería entonces a la curva ascendente que, no sólo entre nosotros sino en todos los países civilizados, han seguido en su propagación las enfermedades nerviosas y mentales, y que hace contraste con la disminución progresiva de las demás afecciones y en especial de las infecto-contagiosas, que están a punto de ser dominadas por la técnica cada día más perfecta de la medicina preventiva. Hoy quiero ocuparme de algunos aspectos de este mismo tema que apenas alcanzaron a ser esbozados en mi conferencia anterior.
La mortalidad por enfermedades del corazón y por reumatismo en la ciudad de bogotá
Bejarano, Jorge
2012-01-01
La alta cifra de mortalidad por enfermedades cardio-vasculares está indicando la urgencia de una campana para contener sus avances. De todas las adquisiciones sanitarias, ninguna ha tenido el alcance y los resultados admirables de los centros o dispensarios destinados al tratamiento de una enfermedad y a la educación del enfermo. Nadie podrá pues, dudar que los dispensarios o consultorios de enfermedades cardio-vasculares, sea una de las armas más eficaces en la lucha contra la mortalidad por...
Levantamiento del proceso de registros contables por causación de las cuentas por cobrar a clientes
Mayele-Rodríguez, Luz
2013-01-01
De igual forma el Proyecto de Mejora de Procesos a elaborar, desarrollar e implementar en el Área Administrativa y Financiera del Centro de Pinturas Automotriz “LMS”, es realizar el levantamiento del Proceso de Registros Contables por Causación de las cuentas por cobrar a clientes. Lo anterior se puede desarrollar a partir de un poder de negociación con proveedores que incluye entre otros los siguientes factores : El plazo alcanzado en la negociación de compras de insumos, materias primas, co...
Alarma activada por control remoto selectivo.
Eguíluz Morán, Luis Ignacio; Lara Santillán, Pedro María; Mañana Canteli, Mario
1995-01-01
La finalidad de esta invención consiste en disponer de una alarma que bien evite el robo de objetos ligeros y portátiles por el procedimiento que se conoce como "del tirón" --es decir, arrebatar algo y salir corriendo--, bien permita identificar un equipaje entre otros. La originalidad del dispositivo reside en la activación/desactivación del dispositivo de sonido por control remoto, así como la posibilidad de seleccionar el sonido de salida dependiendo de su finalidad. Se reivindica como de ...
San Sebastian, vista por Paret y Alcázar
Directory of Open Access Journals (Sweden)
María Castilla Albisu
2013-07-01
Full Text Available Luis Paret y Alcázar pintó una serie de vistas panorámicas de puertos del litoral Cantábrico, por encargo del rey Carlos III. El objetivo de este trabajo es ahondar en la vida de este pintor para así comprender mejor su obra. A pesar de los estudios realizados por algunos historiadores quedan todavía incógnitas por descubrir relativas a la vida y al trabajo de este artista. Al acercarse a la figura de Paret y Alcázar hay que preguntarse por qué habiendo sido uno de los pintores más prometedores de su tiempo, su figura ha caído en un triste olvido.
Trisegmentectomia hepática direita por videolaparoscopia
Directory of Open Access Journals (Sweden)
Marcel Autran C. Machado
Full Text Available INTRODUÇÃO: Em 2007 os autores descreveram a primeira hepatectomia direita por videolaparoscopia realizada no Brasil. Hepatectomia direita ampliada, também conhecida como trisegmentectomia direita, é procedimento altamente complexo e implica em grande retirada do volume hepático. Os autores descrevem a primeira trisegmentectomia direita por videolaparoscopia realizada no Brasil. TÉCNICA: O paciente é colocado em posição supina em decúbito lateral esquerdo. O cirurgião se coloca entre as pernas da paciente. Utilizamos cinco trocartes, três de 12 mm e dois de 5 mm. Devido à embolização prévia da veia porta direita, o hilo hepático não é dissecado. O pedículo portal direito é seccionado com grampeador laparoscópico de carga vascular por meio de acesso intra-hepático, segundo técnica previamente descrita pelos autores. A seguir procede-se a mobilização do fígado direito seguido de dissecção da veia cava retro-hepática e secção da veia hepática direita. Estes passos são realizados sem manobra de Pringle. O fígado é seccionado com combinação de bisturi harmônico e grampeador endoscópico. O pedículo do segmento 4 é seccionado dentro do fígado. O espécime é retirado por meio de incisão supra-púbica e a área cruenta é revista para verificar hemostasia. O procedimento é encerrado e dreno de sistema fechado é posicionado junto à área cruenta. CONCLUSÃO: Trisegmentectomia hepática direita por videolaparoscopia é procedimento factível e seguro e deve ser considerado para pacientes selecionados. Este procedimento deve ser realizado em centros especializados e por cirurgiões com experiência tanto em cirurgia hepática como cirurgia laparoscópica avançada.
Directory of Open Access Journals (Sweden)
Jaime Baby Moreno
2015-06-01
Full Text Available Este artículo trata del uso del Valor Percibido por el Cliente (VPC como herramienta para el análisis competitivo por parte de talleres de reparación y mantenimiento automotriz. Se muestra cómo se determinan tanto la importancia relativa de los atributos que los compradores tienen en cuenta para evaluar el desempeño de un taller automotriz, como la evaluación de desempeño, realizada por los compradores de los "Talleres de los concesionarios" y de aquellos que son propiedad de individuos. Posteriormente, se ilustra la manera como unos y otros visualizan su posición competitiva. También muestra la brecha entre los valores ideales esperados y los percibidos por el mercado, la cual se constituye en una especie de "mapa" de oportunidades para las firmas actualmente presentes en el mercado y para nuevos participantes.
Malnutrición por defecto de un recién nacido por psicosis puerperal materna: presentación de un caso
Gavilla González, Bárbara; Díaz Cabrera, Leticia
2011-01-01
En el siguiente trabajo se realizó el seguimiento de un niño desde la etapa de recién nacido hasta el año de edad por malnutrición por defecto, de causa materna por psicosis puerperal. En este caso, la madre rechazaba a su hijo, negándose a alimentarlo, privando al bebé de algo tan importante en esta etapa de la vida como la lactancia materna exclusiva, requiriendo de alimentación complementaria en edad temprana para lograr un aumento de peso adecuado y un desarrollo psicomotor que se igualar...
Malnutrición por defecto de un recién nacido por psicosis puerperal materna: presentación de un caso
Gavilla González, Bárbara; Díaz Cabrera, Leticia
2012-01-01
En el siguiente trabajo se realizó el seguimiento de un niño desde la etapa de recién nacido hasta el año de edad, por malnutrición por defecto, de causa materna por psicosis puerperal. En este caso, la madre rechazaba a su hijo, negándose a alimentarlo, privando al bebé de algo tan importante en esta etapa de la vida como la lactancia materna exclusiva, requiriendo de alimentación complementaria en edad temprana para lograr un aumento de peso adecuado y un desarrollo psicomotor que se iguala...
Transmisión de Anaplasma marginale por garrapatas
Directory of Open Access Journals (Sweden)
Kelly A. Brayton
2012-01-01
Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.
Directory of Open Access Journals (Sweden)
Jorge Payome Suárez
2003-01-01
Full Text Available El comentario presentado, además de constituir una guía útil para los socios de compañías mercantiles por acciones y por cuotas, en un aspecto de indudable importancia para ellos, cual es el de su eventual responsabilidad, se erige como una herramienta provechosa para estudiantes y profesionales interesados en el tema. La experiencia académica y docente del autor del ensayo aseguran un análisis autorizado de la materia.
Directory of Open Access Journals (Sweden)
José Mejía Haro
2012-02-01
Full Text Available The variation in voluntary forage intake is undoubtedly the major dietary factor determining level and efficiency of ruminant production. This variation is bigger and least predictable for grazing ruminants. Range ruminant productivity and efficiency is relatively low due, partly, to intake limitations; productivity could probably be increased most by increasing intake. Distension of the reticulo-rumen wall is the primary intake regulation mechanism of low-quality roughages in range ruminants, digestibility and rate of ingest passage also affect voluntary intake. Body size and metabolic bodysize as well affect intake of grazing animals. Kind and amount of supplementation, forage availability, and grazing intensity have been related to voluntary forage intake. La variación en el consumo voluntario de forraje es indudablemente el principal factor dietario que determina el nivel y eficiencia de producción en un rumiante. Esta variación es mayor y muy difícil de predecir bajo condiciones de pastoreo. La productividad y eficiencia de rumiantes en pastoreo es relativamente baja debido, en parte, a las limitaciones en el consumo; la productividad probablemente se podrá incrementar si se incrementa el consumo. La distensión de la pared del rumenretículo es el principal mecanismo de regulación del consumo de forrajes de baja calidad en rumiantes en pastoreo, aunque la digestibilidad y la tasa de pasaje también afectan el consumo voluntario. Igualmente, el consumo se ve afectado por el tamaño corporal y peso metabólico del animal, por la cantidad y tipo de suplemento ofrecido, por la disponibilidad de forraje y por la intensidad del pastoreo.
Loaiza Choque, Leonardo Edwin
2016-01-01
Determina el riesgo ambiental que representan los metales pesados dispuestos en los sedimentos de los ríos Quiroz y Chira ubicados en el departamento de Piura generados por la minería artesanal. Determina las formas químicas en las que se dispersan los metales pesados ambos ríos. Demuestra que el estudio por extracción secuencial puede ser usado como componente de herramienta de gestión ambiental. Realiza el análisis de extracción secuencial por el método BCR el mismo que permite determinar l...
Retinitis por citomegalovirus en un paciente con VIH
Directory of Open Access Journals (Sweden)
Alena de los Ángeles Vejerano Duany
Full Text Available La retinitis por citomegalovirus es la infección ocular más frecuente en pacientes con un recuento de linfocitos CD4 inferior a 200 por µL. El aspecto oftalmoscópico de las lesiones se caracteriza, en la mayoría de los casos, por infiltrados retinianos resultados de la necrosis retiniana producida por citomegalovirus y el edema en asociación con hemorragias. Estas lesiones se disponen, por lo general, siguiendo las arcadas vasculares temporales con invasión hacia la mácula. Se presentó una paciente de 24 años de edad, femenina, blanca, ama de casa, con antecedentes patológicos personales oculares sin datos de interés, y antecedentes patológicos personales generales de ser diagnosticadas con VIH. Hace cuatro años que comenzó con tratamiento antirretroviral, y tuvo cambios de tratamiento en dos ocasiones. El último fue impuesto en mayo del año 2011, con el cual presentó mala adherencia terapéutica, y comenzó desde entonces a presentar disminución de su peso corporal de forma marcada en breve período de tiempo. Refiere que desde hace unos meses comenzó a presentar una disminución progresiva de la agudeza visual en el ojo derecho, acompañado de visión borrosa. Adquiere gran importancia este caso, ya que ante la supervivencia de los pacientes con sida, va a ser cada vez más frecuente la aparición de las afecciones oculares relacionadas con esta enfermedad. Dentro de ellas se encuentran las infecciones oportunistas mayores como la retinitis por citomegalovirus.
Effect of an insecticide on growth and metabolism of some non-target soil micro-organisms
International Nuclear Information System (INIS)
Balasubramanian, A.; Nilakantan, Gita
1975-01-01
Aldicarb, a systemic insecticide, enhanced the growth of Rhizobium japonicum in vitro at 1 ppm concentration but inhibited it at 5 ppm level. The cell yields of Azotobacter chroococcum and Pseudomonas solanacearum were reduced by both the concentrations of the chemical. 1 and 5 ppm levels of the insecticide the incorporation of 14 C-glucose by R. japonicum, but it was stimulated in the case of R. chroococcum. In the case of P. solanacearum, however, 1 ppm level of the insecticide enhanced the incorporation of the label. Uptake of 32 P-di-potassium hydrogen phosphate by the cells was also significantly reduced indicating that the metabolic activities of these non-target soil micro-organisms are altered by the insecticide treatment. (author)
Directory of Open Access Journals (Sweden)
Luis Armando Galvis
2010-12-01
Full Text Available La existencia de brechas salariales por género es un fenómeno que, al igual que en muchos otros países, está presente en el mercado laboral colombiano.Esas brechas no son homogéneas en todo el territorio, lo que justifica un análisis detallado de lo que ocurre en cada una de las regiones del país. Los resultados muestran diferenciales de salarios positivos en favor de los hombres en la mayoría de las ciudades principales. Sin embargo, no todo este fenómeno puede ser atribuido a la existencia de discriminación, por cuanto existen variados factores que explican parte de la brecha salarial. Para identificarlos se emplea la descomposición de Blinder-Oaxaca (BO en el contexto de regresión por cuantiles. Los resultadosde la aplicación de esta metodología sugieren que las brechas salariales no están explicadas por los atributos observables de los individuos. Dichas disparidades son en su mayoría explicadas por el efecto de las diferencias en la remuneración de atributos tales como la educación, además de elementos no observados. Por ciudades,el estudio muestra patrones que revelan una mayor brecha salarial en las regiones periféricas en comparación con Bogotá, Cali, Medellín, Manizales y Pereira.Dado que el efecto remuneración comprende, entre otros, la posible existencia de discriminación por género, es importante que se le otorgue la debida atención a este resultado para efectos de formular políticas en este sentido.
Mortalidad por meningitis por Pasteurella canis. Oportunidades de aprendizaje
Directory of Open Access Journals (Sweden)
Ana Rosa Ropero Vera
2016-01-01
Full Text Available La meningitis bacteriana es una enfermedad importante de distribución mundial, causa mayor y sustancial de mortalidad y morbilidad en países en desarrollo. La Organización Mundial de la Salud (OMS sostiene que la meningitis es una de las diez afecciones principales del ser humano y debe ser considerada como una emergencia infectológica; por eso es fundamental reconocer que esta enfermedad es causa de muerte en niños de todo el mundo, sin distinción de raza, nivel económico o sociocultural. Se realizó una investigación de caso en menor de 53 días de nacido, que cumplía con los criterios clínicos y de laboratorio compatible con meningitis bacteriana, con el propósito de analizar y fortalecer la toma de decisiones en salud pública por parte de la secretaría local de salud del municipio de Valledupar (Colombia. Entre los hallazgos se encontró antecedentes infecciosos en el menor, coloración de Gram y cultivo de LCR, en el que se identificó cocobacilos Gram negativos, que fueron aislados como agente causal Pasteurella canis. Este estudio pretende sensibilizar a los prestadores de salud para que cuenten con personal altamente capacitado para brindar tratamientos adecuados y prevenir complicaciones en la meningitis bacteriana en niños, y así disminuir la posibilidad de secuelas o muerte, tanto en pacientes con compromiso inmunológico o sin este.
Pfeiffer, Daniel; Wahl, Andreas; Jendrossek, Dieter
2011-11-01
A two-hybrid approach was applied to screen for proteins with the ability to interact with PHB synthase (PhaC1) of Ralstonia eutropha. The H16_A0141 gene (phaM) was identified in the majority of positive clones. PhaM (26.6 kDa) strongly interacted with PhaC1 and with phasin PhaP5 but not with PhaP1 or other PHB granule-associated proteins. A ΔphaM mutant accumulated only one or two large PHB granules instead of three to six medium-sized PHB granules of the wild type, and distribution of granules to daughter cells was disordered. All three phenotypes (number, size and distribution of PHB granules) were reversed by reintroduction of phaM. Purified PhaM revealed DNA-binding properties in gel mobility shift experiments. Expression of a fusion of the yellow fluorescent protein (eYfp) with PhaM resulted in formation of many small fluorescent granules that were bound to the nucleoid region. Remarkably, an eYfp-PhaP5 fusion localized at the cell poles in a PHB-negative background and overexpression of eYfp-PhaP5 in the wild type conferred binding of PHB granules to the cell poles. In conclusion, subcellular localization of PHB granules in R. eutropha depends on a concerted expression of at least three PHB granule-associated proteins, namely PhaM, PhaP5 and PHB synthase PhaC1. © 2011 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Victor Paramo Valero
2016-04-01
Full Text Available Ética del humor es una obra original, abundantemente documentada, de contenido científico y filosófico, que aborda un problema de gran importancia en los actuales estudios de éticas aplicadas. La ética del humor es una nueva ética aplicada que pretende comprender el fenómeno del humor a la luz de sus implicaciones éticas. Como señala el autor, Juan Carlos Siurana, reputado experto en el ámbito de la filosofía práctica, el interés por el humor es un interés por la ética. En la obra no presenta una nueva teoría filosófica del humor –las cuales se han venido sucediendo, al menos, desde los Diálogos de Platón–, sino una nueva teoría ética, que toma al humor como objeto principal de análisis. Por tanto, la finalidad es realizar una aportación dentro del ámbito de la ética. Para ello se nutre de distintos estudios psicológicos, biológicos, fisiológicos y neurológicos sobre el humor, así como de clásicas obras de filosofía que han abordado esta cuestión.
Directory of Open Access Journals (Sweden)
LICHT, René Henrique Götz
2009-03-01
Full Text Available RESUMOO aumento do poder de compra das mulheres tem levado empresas a adotarem estratégias de diferenciação de produtos e a produzirem produtos específicos para o público feminino. A indústria automobilística não está imune a este fenômeno, uma vez que as mulheres representam aproximadamente metade das vendas de automóvel no país. Considerando as diferenças de consumo e de comportamento entre mulheres e homens é colocada a seguinte questão: há diferenças entre escolhas associadas ao automóvel por homens e mulheres? Foram apresentados aos participantes itens presentes no dia-a-dia das pessoas, e que são por elas valorizados; e foi solicitado aos participantes que escolhessem e associassem estes itens ao automóvel. A análise dos resultados revelou haver mais semelhanças do que diferenças entre escolhas associadas ao automóvel por homens e escolhas associadas ao automóvel por mulheres. A semelhança entre as escolhas sugere que as representações, os significados e valores atribuídos ao automóvel por homens e por mulheres são similares e, desta forma, a estratégia de diferenciação de produtos não se aplica à indústria automobilística.ABSTRACTThe increase of the women purchase power has led some companies to adopt strategies of products differentiation as well as to produce specific products to the female public. The auto industry is not immune to this phenomenon, once the women represent, approximately, half of the automobile sales in the country. Considering the consumption and the behavior differences between women and men, it has set the following question: are there differences between the choices associated to the automobile by men and the choices associated to the automobile by women? It has been presented to the participants items found in the people’s day-by-day, which are valorized by them, and the participants have been asked to choose and associate these items to the automobile. The results analysis
Directory of Open Access Journals (Sweden)
Yeny Serrano
2006-01-01
Full Text Available En este artículo se propone un análisis del texto del Acuerdo por la discreción firmado en 1999 por 32 directores de medios de comunicación para elevar el nivel de calidad y responsabilidad en el cubrimiento y difusión de hechos violentos. Se analizan los factores que impiden que este Acuerdo produzca cambios efectivos en la práctica profesional informativa y se presenta un modelo (Lemieux, 2000 que tiene en cuenta las variables que influyen en la producción del discurso informativo mediático.
Rapid Screening of In-Vitro Regenerated Plantlets of Four Nigerian ...
African Journals Online (AJOL)
Prof. Ogunji
Tissue culture technique provides a rapid means of studying plant-pathogen interaction in a controlled ... Keywords: cowpea, in-vitro regeneration, hormones, Fusarium wilt, protocols. .... solanacearum and evaluation of tomato in Nepal.
Clonación humana: las preguntas «por qué no» y «por qué sí»
Directory of Open Access Journals (Sweden)
Velayos Castelo, Carmen
2002-12-01
Full Text Available Why not cloning us is a relevant question for contemporary ethics. The question why not, when it refers to a technology (or to some of its applications, is the question for its moral limits. In other words, it is the question for the universal dangers that a technology entails or could entail in some of its applications. The sphere of the moral evaluation of a technology has to do with the public elimination of the possible harms that are inherent or supervenient to its utilisation. If we focus on the relevant normative questions of the justice sphere, it couldn´t be relevant to answer the question why, that is, why a person or a group of them would wish the technology was applied The question why is related to vital options and ways of create ourselves that needn´t be binding on someone nor are characteristic of the moral point of view.
However, the suspicion of this article is the following: the specific character of contemporary technological innovation (of which cloning is a paradigmatic case stimulates and makes relevant the debate about the good (given the collective or global implications of the answers.
Por qué no clonarnos es una pregunta relevante para la ética actual. El por qué no de una técnica -o de determinadas aplicaciones de la misma- es la pregunta por los límites morales. O, de otro modo, es la pregunta por los daños objetivos que ésta supone, o supondría en una determinada aplicación. El marco de evaluación moral de una técnica tiene que ver, pues, con la desestimación pública y universal de posibles daños inherentes o sobrevenibles a su uso. Circunscritas las cuestiones normativas relevantes al ámbito de la justicia, no parecería relevante clarificar cuál sea el por qué -o el por qué sí- un individuo o un conjunto de ellos buscarían la aplicación o puesta en marcha de una técnica. Ésta es la pregunta por opciones vitales y
Orlando Castellanos. La pasión por la radio
Castellanos Molina, Orlando, 1930-1998
2004-01-01
Documento sonoro en el que se recogen entrevistas realizadas a Orlando Castellanos por Miguel Ángel de la Guardia, Miladys Ochoa, Fernando Rodríguez Sánchez (Ciego de Ávila), Ángel Ferrera, Boshmonar, Jaime Almiral, Radio Umbral de Santiago de Chile, Franco Carbón, Luis Toledo Sande y Estrella Díaz. Esta grabación pertenece a la colección Palabra Viva, desarrollada por el Centro Cultural Pablo de la Torriente Brau, a partir de las entrevistas realizadas por el periodista Orlando Castellanos. ...
MIASIS CUTÁNEA POR CORDYLOBIA ANTHROPOPHAGA
Directory of Open Access Journals (Sweden)
Miriam Alkorta Gurrutxaga
2001-01-01
Full Text Available El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ha efectuado una revisión de los casos de miasis cutáneas forunculoides importadas publicados en España, así como de la biología, patología, tratamiento y prevención de la miasis humana por Cordylobia anthropophaga. El caso referido, se caracterizó por la infestación con un número inusualmente elevado de larvas, no sospechándose su etiología hasta la fase final de la enfermedad. La emergencia continuada de larvas (se recogieron 91 generó en la paciente un estado de ansiedad importante. Finalmente, la eliminación de las larvas provocó una rápida mejoría de la paciente. Aunque los casos de miasis cutánea no tienen la gravedad de otras enfermedades importadas, su conocimiento es necesario desde el punto de vista preventivo, diagnóstico y terapeútico. Es importante proceder a la identificación morfológica de las larvas diferenciándolas de otro tipo de miasis con implicaciones terapéuticas diferentes.
Mortalidade por leucemias relacionada à industrialização
Directory of Open Access Journals (Sweden)
Leal Carmen Helena Seoane
2002-01-01
Full Text Available OBJETIVO: Analisar a distribuição espacial da mortalidade por leucemia na população, buscando identificar agregados e estabelecer sua relação com os níveis de industrialização. MÉTODOS: O estudo foi realizado nas 43 regiões de governo do Estado de São Paulo, no qüinqüênio 1991-1995. Foi construído um "índice de industrialização relativo à leucemia" (IIRL baseado no número de indústrias e empregos industriais por 100.000 habitantes, valor adicionado fiscal, variedade de ramos industriais e indústrias com potenciais exposições de risco para a leucemia. O IIRL foi distribuído em cinco categorias. Verificaram-se os coeficientes padronizados de mortalidade por leucemia em cada uma das regiões, também distribuídos em cinco categorias e comparados ao mapa IIRL. RESULTADOS: As regiões mais industrializadas em ordem decrescente foram Campinas, Piracicaba, Jundiaí, Sorocaba e São Paulo. Não foi encontrada associação entre mortalidade, por nenhum tipo de leucemia, e industrialização. A região de Jales foi a que apresentou o mais alto coeficiente padronizado de mortalidade por leucemia. CONCLUSÕES: A distribuição da mortalidade por leucemia ocorreu de forma homogênea no Estado de São Paulo, não apresentando correlação com o nível de industrialização. Entretanto, aspectos relacionados ao método epidemiológico adotado -- estudo ecológico -- e ao uso do parâmetro "mortalidade por leucemia", doença cujo prognóstico tem mudado muito nas últimas décadas, limitaram a interpretação dos resultados.
Boniek Gontijo Vaz
2009-01-01
Resumo: A espectrometria de Massas por eletronspray (ESI-MS) tornou-se um método prático para o estudo de mecanismos reacionais em solução. Neste trabalho importantes reações catalisadas por paládio: reação de Heck-Mizoroki, oxa-Heck e o acoplamento de Buchwald-Hartwig foram monitoradas por ESI-MS visando interceptar espécies que comprovam as atuais propostas mecanísticas ou que abram caminho para novas propostas para estas reações. O monitoramento das reações foi realizado no modo off-line, ...
DE ACUMULACIÓN POR DESPOSESIÓN
Directory of Open Access Journals (Sweden)
Sebastián Gómez Lende
2015-01-01
Full Text Available Omnipresente, la acumulación por desposesión es uno de los elementos centrales del orden global contemporáneo. Observados desde una perspectiva crítica, los usos extractivos del territorio constituyen una de las principales expresiones de ese proceso. A la luz de ese sistema de ideas, este artículo procura demostrar que el modelo sojero actualmente vigente en la Argentina es una de las formas más completas, exhaustivas, actuales y sofisticadas, de acumulación por desposesión en el país. En ese sentido, el artículo analiza el boom de la soja transgénica y sus vínculos con las formas tanto seculares (endeudamiento financiero, concentración de la propiedad rural, usurpación de la tierra y actuales de desposesión (degradación de la naturaleza, despojo del derecho a la salud, pillaje de recursos genéticos efectuadas por los grandes agricultores, el capital financiero, las agroindustrias y las corporaciones biotecnológicas, en detrimento de los pequeños productores, los campesinos, los pueblos aborígenes y la población en general.
La compra por impulso de productos de alimentación
DEFF Research Database (Denmark)
Luna-Arocas, Roberto; Bech-Larsen, Tino
2004-01-01
El consumo de productos de alimentación muestra una serie de matices diferenciales en su análisis si lo comparamos con otros productos de compra por impulso. En este sentido, se relaciona la compra por impulso de productos de alimentación con una baja importancia de la imagen fisica, y con las de...... descrepancias personales entre lo que un individuo es y quiere ser. Como resultado en una mestra de estudisantes, la compra por impulso de productes de alimentación se relaciona con imagen fisica pero no con las discrepanacias personales.......El consumo de productos de alimentación muestra una serie de matices diferenciales en su análisis si lo comparamos con otros productos de compra por impulso. En este sentido, se relaciona la compra por impulso de productos de alimentación con una baja importancia de la imagen fisica, y con las...
Itinerarios didácticos por la isla de Tenerife
Becerra Ramírez, María Carmen; Javier Dóniz-Páez; González Cárdenas, Elena; Gosálvez, Rafael U.; Becerra-Ramírez, Rafael; Escobar Lahoz, Estela
2013-01-01
Con la elaboración de esta guía de Itinerarios Didácticos por la isla de Tenerife pretendemos contribuir a un mayor conocimiento de las características geográficas de un espacio dominado por las formas y formaciones volcánicas que caracterizan un paisaje fuertemente modificado por la actividad humana. El hombre convive y usa lo que los volcanes le ofrecen, tradicionalmente como soporte de sus cultivos o de su actividad ganadera,y modernamente como base de la industria turística. Los itiner...
¿Por qué estudiar en la Universidad EAN?
2013-01-01
Razones para estudiar en la Universidad EAN: 1. Por ser la Universidad No.1 en Latinoamérica y No. 28 en el mundo, según el ranking mundial de Escuelas de Negocios que lidera el Consejo Superior de Investigaciones Científicas – Laboratorio de Cibermetría de España. 2. Por la flexibilidad en los planes de estudio que permite adelantar unidades y cursar la carrera en un tiempo menor. 3. Por la formación académica en dos ciclos semestrales, favoreciendo el aprendizaje y la concentrac...
Adame Alba, Nayzeth
2011-01-01
Hoy en día la excesiva carga tributaria en nuestro país, nos obliga a buscar alternativas factibles y seguras, en el cumplimiento de las obligaciones fiscales, por ello, debemos aprovechar la existencia de figuras jurídicas útiles para la optimización de recursos financieros dentro del marco de ley, es el caso de la sociedad en nombre colectivo, que nos permite la existencia de socios industriales que a su vez, el ingreso que perciben por concepto de alimentos se encuentra exento de impuestos...
ANTIOXIDANTES: MICRONUTRIENTES EN LUCHA POR LA SALUD
Zamora S, Juan Diego
2007-01-01
Los antioxidantes son sustancias químicas que se caracterizan por impedir o retrasar la oxidación de diversas sustancias principalmente de los ácidos grasos cuyas reacciones se producen tanto en los alimentos como en el organismo humano, en el cual puede provocar alteraciones fisiológicas importantes desencadenantes de diversas enfermedades. Otra de las funciones de los antioxidantes es facilitar el uso fisiológico del oxígeno por parte de las mitocondrias celulares, ayudando a reducir los ef...
Esporotricosis diagnosticada por el laboratorio
Directory of Open Access Journals (Sweden)
Nelly Ordóñez
1989-06-01
Full Text Available De 1976 a 1989 se han diagnosticado 40 casos de esporotricosis en el laboratorio de Micología del Instituto Nacional de Salud. La enfermedad se presentó en pacientes entre 4 y 52 años y tuvo predilección por el sexo masculino: 35 de 40 (87,5%; las formas clínicas más frecuentes fueron la cutánea fija, 18 de 40 (45%, y la linfocutánea, 17 de 40 (42,5%, con localización mayor en miembros superiores, 18 de 40 (45%. El diagnóstico se estableció por el aislamiento del Sporothrix schenckii en 35 de 38 pacientes (92%; los otros dos pacientes se diagnosticaron empleando otras técnicas: inmunofluorescencia directa, intradermorreacción y aglutinación en tubo.
Directory of Open Access Journals (Sweden)
Gustavo Rasera
2012-07-01
Full Text Available ntos Severos (ES, como por exemplo, vendaval, granizo e enchente, têm sido estudados com frequência devido à gravidade dos danos que estes causam à sociedade. Um dos sistemas meteorológicos que é bastante comum no Rio Grande do Sul (RS, e que frequentemente está associado aos ES são os Sistemas Convectivos de Mesoescala (SCM. Como a economia do RS é voltada majoritariamente para a agricultura, que é bastante suscetível às mudanças do tempo, é frequente no Estado a ocorrência de prejuízos econômicos causados por ES. Diante disso, o objetivo deste trabalho foi analisar a distribuição sazonal das regiões atingidas por ES gerados por SCM que afetaram o RS (ESSCMRS no período de 2004 a 2008. Foram utilizados, para o período de estudo, dados de ocorrências de ES e municípios atingidos por ES (MAES obtidos no banco de dados da Coordenadoria Estadual de Defesa Civil do RS; trajetórias dos SCM que afetaram o RS (SCMRS geradas a partir de informações fornecidas pela ferramenta ForTrACC (Forecasting and Tracking of Active Cloud Clusters e imagens brutas do satélite GOES 10 e 12 do canal 4. Os resultados obtidos mostraram que: i ~45% dos ES observados foram gerados por SCMRS; ii ~58% dos MAES foram atingidos por SCMRS; iii a porção norte do RS foi a mais atingida por ESSCMRS; iv vendaval e granizo foram os tipos de ESSCMRS que atingiram o maior número de municípios e v JAS (jul-ago-set foi o trimestre que apresentou o maior número de municípios atingidos por ESSCMRS (MAES-SCMRS.
El aprendizaje visto por los estudiantes venezolanos
Directory of Open Access Journals (Sweden)
Berta Elena Barrios
2015-01-01
Full Text Available En el siguiente trabajo se presentan los resultados de un estudio sobre las con-cepciones del aprendizaje de un grupo de estudiantes venezolanos de educa-ción primaria y media. Se trató de replicar el instrumento y procedimiento deanálisis utilizado por los investigadores Berry y Sahlberg (1996, con el objetivode caracterizar cómo conciben el aprendizaje estudiantes venezolanos entre 11y 15 años de edad y compararlo con sus pares ingleses y finlandeses. El análi-sis de resultados se basó en los criterios propuestos por dichos autores, deno-minados Pasos para un Buen Aprendizaje. Los hallazgos indican que los estu-diantes venezolanos conciben el aprendizaje como memorizar conocimientos,básicamente escolares, enseñados por los docentes. Las concepciones deambas poblaciones se ubican en una visión pasiva del aprendizaje. Se discutela vinculación de las concepciones del aprendizaje con las prácticas de la escuela.
Epidemiologia das infecções hematogênicas por Candida spp
Directory of Open Access Journals (Sweden)
Colombo Arnaldo Lopes
2003-01-01
Full Text Available O gênero Candida spp é responsável por cerca de 80% das infecções fúngicas no ambiente hospitalar e constitui causa relevante de infecções de corrente sanguínea. Nos Estados Unidos da América, Candida spp é a quarta causa mais comum de infecções de corrente sanguínea, respondendo por cerca de 8% dos casos das infecções documentadas neste sítio. Espécies não-albicans respondem hoje por ao menos 50% das infecções invasivas por Candida spp, apresentando peculiaridades de história natural e sensibilidade a antifúngicos. A mortalidade geral de fungemias por Candida spp é da ordem de 40 a 60%, tornado esta complicação infecciosa um grande desafio para os clínicos que trabalham em hospitais terciários em diferentes países.
Neumonitis por hipersensibilidad en la ciudad de México
Directory of Open Access Journals (Sweden)
Carrillo-Rodríguez José G.
2000-01-01
Full Text Available OBJETIVO: Determinar la asociación entre la zona urbana de origen del paciente en la ciudad de México y la prevalencia de neumonitis por hipersensibilidad inducida por antígeno aviario. MATERIAL Y MÉTODOS: Se trata de un estudio de casos y controles realizado en el Instituto Nacional de Enfermedades Respiratorias, en la ciudad de México, en el año de 1999. Se estudiaron 109 casos con neumonitis por hipersensibilidad y 184 controles: de éstos, 39, con fibrosis pulmonar idiopática; 63, con tuberculosis pulmonar, y 82, con asma. La ciudad de México y las zonas conurbadas se dividieron en cinco zonas geográficas: centro, noreste, sureste, noroeste y el suroeste. Se calcularon las prevalencias de las diferentes enfermedades por zona urbana de los pacientes que participaron en el estudio; como medida de asociación, se estimó la razón de momios, con un intervalo de confianza al 95%. Asimismo, se realizó regresión logística múltiple ajustando por edad, sexo y estrato socioeconómico. RESULTADOS: Ochenta casos de neumonitis por hipersensibilidad se concentraron en el sur del noreste de las zonas conurbadas y la parte norte del sureste de la ciudad de México, 48 y 32, respectivamente (RM= 3.86, IC 95% 2.17-6.96. Treinta y seis controles de asma se localizaron en el suroeste de la ciudad de México, zona donde se ubica el Intituto Nacional de Enfermedades Respiratorias (p<0.05 y cuatro en la zona conurbada. Los controles de tuberculosis pulmonar y fibrosis pulmonar idiopática estuvieron dispersos en la ciudad de México y en las zonas conurbadas. CONCLUSIONES: La zona sur del noreste y el norte de la sureste están asociadas a la neumonitis por hipersensibilidad. Las causas de esta asociación no parece ser geográfica, pero existe el antecedente de que esa zona fue basurero de la ciudad, por lo que partículas orgánicas en el ambiente pudieran coadyuvar a la aparición de esta enfermedad.
Defense mechanisms of Solanum tuberosum L. in response to attack by plant-pathogenic bacteria
Directory of Open Access Journals (Sweden)
VERA A D POIATTI
2009-01-01
Full Text Available The natural resistance of plants to disease is based not only on preformed mechanisms, but also on induced mechanisms. The defense mechanisms present in resistant plants may also be found in susceptible ones. This study attempted to analyze the metabolic alterations in plants of the potato Solanum tuberosum L. cv. Agata that were inoculated with the incompatible plant-pathogenic bacteria X. axonopodis and R. solanacearum, and the compatible bacterium E. carotovora. Levels of total phenolic compounds, including the flavonoid group, and the activities of polyphenol oxidase (PPO and peroxidase (POX were evaluated. Bacteria compatibility was evaluated by means of infiltration of tubers. The defense response was evaluated in the leaves of the potato plants. Leaves were inoculated depending on their number and location on the stem. Multiple-leaf inoculation was carried out on basal, intermediate, and apical leaves, and single inoculations on intermediate leaves. Leaves inoculated with X. axonopodis and with R. solanacearum showed hypersensitive responses within 24 hours post-inoculation, whereas leaves inoculated with E. carotovora showed disease symptoms. Therefore, the R. solanacearum isolate used in the experiments did not exhibit virulence to this potato cultivar. Regardless of the bacterial treatments, the basal leaves showed higher PPO and POX activities and lower levels of total phenolic compounds and flavonoids, compared to the apical leaves. However, basal and intermediate leaves inoculated with R. solanacearum and X. axonopodis showed increases in total phenolic compounds and flavonoid levels. In general, multiple-leaf inoculation showed the highest levels of total phenolics and flavonoids, whereas the single inoculations resulted in the highest increase in PPO activity. The POX activity showed no significant difference between single- and multiple-leaf inoculations. Plants inoculated with E. carotovora showed no significant increase in
PANORAMA LATINOAMERICANO DEL PAGO POR SERVICIOS AMBIENTALES
Directory of Open Access Journals (Sweden)
González T. Ángela
2008-07-01
Full Text Available Este documento busca proveer al lector de algunos elementos para el análisis y reflexión en torno al pago por servicios ambientales. Para ello, en primera instancia, aborda algunos conceptos básicos relacionados con economía ambiental, seguido de temas como la valoración económica de servicios ambientales y la implementación de mecanismos de pago por algunos de ellos. Lo anterior esta enriquecido con experiencias o estudios de caso a nivel latinoamericano y colombiano.
Efeito protetor da melatonina sobre intoxicações por herbicidas
Directory of Open Access Journals (Sweden)
Lécio L. de Almeida
2016-03-01
Full Text Available Resumo: O uso inadequado de herbicidas pode resultar em intoxicações agudas e, às vezes, crônicas por exposição em longo prazo a baixos níveis desses agentes tóxicos, podendo o herbicida atuar também como agentes teratogênicos, mutagênicos, cancerígenos e desreguladores endócrinos, com o aparecimento de doenças neurodegenerativas e distúrbios reprodutivos. Estudos têm revelado que a melatonina tem propriedades antioxidantes, anti-inflamatórias e imunomoduladoras e atua na reprodução. Essa indolamina está entre os agentes que têm se mostrado benéfico em intoxicações por herbicidas, porém não há relatos do uso de melatonina contra intoxicações por Glifosato-Roundup®, muito menos em associação com o Paraquat. Dessa forma, o maior interesse no tratamento das intoxicações por herbicidas, tem-se concentrado em medidas que impeçam ou minimizem as lesões celulares provocadas nos diversos sistemas biológicos. Assim, a melatonina, como antioxidante conhecido, pode ser mais uma alternativa contra as intoxicações por herbicidas associados e/ou individuais.
Directory of Open Access Journals (Sweden)
Theresa W Gyorkos
Full Text Available Objetivos. Determinar la eficacia en dosis única del albendazol sobre las infecciones por helmintos transmitidos por el suelo (HTS en escolares de una comunidad de la ciudad de Iquitos en Perú. Materiales y métodos. Dentro del contexto de un ensayo controlado aleatorizado realizado en una comunidad periurbana de escasos recursos, situada en Iquitos, en la Amazonía de Perú, se obtuvieron muestras de heces de escolares del quinto grado de primaria en 18 escuelas y se analizó la prevalencia y la intensidad de HTS. Un total de 1193 escolares fueron desparasitados con albendazol en dosis única (400 mg. De los 909 escolares que fueron encontrados positivos con al menos una infección por HTS, una muestra aleatoria de 385 fue seguida dos semanas más tarde, cuando se recolectó y analizó una segunda muestra de heces. Resultados. La eficacia del albendazol fue satisfactoria para las infecciones por Ascaris lumbricoides con una tasa de reducción de huevos (TRH de 99,8%; IC 95: 99,3-100 y por anquilostomideos con una TRH de 93,6%, IC 95%: 88,2-96,6 y por Trichuris trichiura con una TRH de 72,7%, IC 95: 58,5-79,1. Conclusiones. Estos resultados son indicativos de niveles satisfactorios de eficacia y son congruentes con datos publicados sobre la eficacia del albendazol y directivas de la Organización Mundial de la Salud. Futuras investigaciones deben centrarse en mejorar la eficacia de las estrategias de tratamiento para la infección por Trichuris trichiura.
ENSAYOS DE CREEP POR TORSIÓN Y TRACCIÓN
Daniela Alessio; Sandra Robles; Lilian Moro; René Molina
2017-01-01
En este estudio se efectúa el análisis de dos metodologías de ensayo para evaluar el comportamiento de un material al creep o fluencia por activación térmica o termofluencia. Se realizaron en laboratorio dos tipos de ensayos, por torsión y por tracción, bajo combinaciones de temperatura y tensión comparables, de un acero austenítico, de uso habitual en los equipos de la industria petroquímica de la región. Con los registros adquiridos, se graficaron las diferentes curvas deformación-tiempo de...
Premian record transmision de datos a 5,44 gigabits por segundo
2003-01-01
"El Laboratorio Europeo para la Fisica de Particulas (CERN) y el Instituto de Tecnologia de California (EEUU) seran galardonados con un premio por haber conseguido batir el record de velocidad de transmision por Internet a 5,44 gigabits por segundo, informaron hoy, miercoles, fuentes de ambos organismos" (1/2 page).
Multiple mechanisms of phase variation of PorA in Neisseria meningitidis
van der Ende, A.; Hopman, C. T.; Dankert, J.
2000-01-01
Previously, we reported that PorA expression in Neisseria meningitidis is modulated by variation in the length of the homopolymeric tract of guanidine residues between the -35 and -10 regions of the promoter or by deletion of porA. To reveal additional mechanisms of variation in PorA expression, the
Celulitis por Microascus trigonosporus(anamorfo Scopulariopsis trigonospora
Directory of Open Access Journals (Sweden)
DELIA CANLE CORTIÑAS
2013-06-01
Full Text Available Resumen: Microascus trigonosporus ( anamorfo Scopulariopsis trigonospora es un hongo filamentoso ubicuo que se encuentra en el suelo , plumas de aves, material vegetal e insectos. Aunque Scopulariopsis spp se consideran comúnmente hongos contaminantes , pueden causar ocasionalmente infecciones en humanos, en especial onicomicosis . Excepcionalmente se han descrito infecciones de piel, abscesos cerebrales, endocarditis ,sinusitis e infecciones diseminadas por Scopulariopsis spp , casi siempre en pacientes inmunodeprimidos . En los últimos años se han publicado un mayor número de casos de infecciones oportunistas por Scopulariopsis spp y otros hialohifomicetos multiresistentes. Todavía no está establecido cuál es el mejor régimen de tratamiento para las infecciones por Scopulariopsis spp. Presentamos un caso excepcional de celulitis por Microascus trigonosporus en un paciente con tratamiento prolongado con corticoides. Abstract: Microascus trigonosporus ( Anamorph Scopulariopsis trigonospora is a cosmopolitan filamentous fungus that inhabits soil, feathers ,plant material and insects. While Scopulariopsis is commonly considered as a contaminat fungus it may cause occasionally infections in humans ,especially onychomycosis .Skin lesions, brain abscess , endocarditis, sinusitis and disseminated infections due to Scopulariopsis species have been rarely reported , usually in immunocompromised patients . Over the last few years opportunistic infections by Scopulariopsis species and others multi-resistant hyalohyphomycetes have been increasingly reported . No clear treatment regimen for Scopulariopsis species infections has been established yet. We present a exceptional case of cellulitis due to Microascus trigonosporus in a patient with prolonged steroid therapy.
System design description for portable 1,000 CFM exhauster Skids POR-007/Skid E and POR-008/Skid F
International Nuclear Information System (INIS)
Nelson, O.D.
1998-01-01
The primary purpose of the two 1,000 CFM Exhauster Skids, POR-007-SKID E and POR-008-SKID F, is to provide backup to the waste tank primary ventilation systems for tanks 241-C-106 and 241-AY-102, and the AY-102 annulus in the event of a failure during the sluicing of tank 241-C-106 and subsequent transfer of sluiced waste to 241-AY-102. This redundancy is required since both of the tank ventilation systems have been declared as Safety Class systems
Variabilidad estacional de hospitalizaciones por varicela en el INSN, Lima-Perú
Directory of Open Access Journals (Sweden)
Edwin Miranda-Choque
2013-04-01
Full Text Available Objetivo: Determinar las variabilidad estacional de hospitalizaciones por varicela. Diseño: Serie de casos. Institución: Instituto Nacional de Salud del Niño (INSN del Perú. Participantes: Niños hospitalizados por varicela. Intervenciones: Se estudió las hospitalizaciones por varicela de niños atendidos en el INSN del Perú desde el año 2001 hasta el 2011, país sin implementación de la vacunación contra la varicela; se identificó a los pacientes de la oficina de estadística. Principales medidas de resultados: Variabilidad estacional de hospitalizaciones de los niños atendidos por varicela. Resultados: Se estudió a 1 566 niños hospitalizados por varicela, siendo la mediana de edad de 2 años 6 meses, 46,4% (727/1 466 de sexo femenino, mediana de estancia hospitalaria seis días (RIQ:9,4. El grupo etario más afectado fue de 0 a 2 años, correspondiendo al 55% (864/1 566. En la curva de frecuencias de hospitalizaciones por varicela por meses evidenciamos la distribución estacional, con una tendencia al incremento cada vez mayor por año. Las hospitalizaciones por varicelas con al menos alguna complicación correspondieron a 68,5%(1 073/1 566. El porcentaje de fallecidos fue 0,83% (13/1 493. Conclusiones: Las hospitalizaciones por varicela en el INSN es una causa importante de morbilidad, con una tendencia estacional, siendo más frecuente en los meses de noviembre a febrero, con el incremento cada vez mayor por año y supone una importante carga económica.
Mortalidad por paludismo en Colombia, 1979-2008
Pablo Chaparro; Julio Padilla
2012-01-01
Introducción. En Colombia, el paludismo representa un grave problema de salud pública. Se estima que, aproximadamente, 60 % de la población se encuentra en riesgo de enfermar o de morir por esta causa. Objetivo. Describir la tendencia de la mortalidad por paludismo en Colombia desde 1979 hasta 2008. Materiales y métodos. Se llevó a cabo un estudio descriptivo para determinar la tendencia de las tasas de mortalidad. Las fuentes de información fueron las bases de datos de las defunciones...
El estrés por temperatura provoca necrosis en tabaco negro; cuantificación por análisis de imágenes
Directory of Open Access Journals (Sweden)
Eduardo Ortega
2008-07-01
de imágenes ImageJ. Este programa es capaz de adquirir, mostrar, editar, resaltar y analizar imágenes. Se demostró que las hojas sometidas a 4 ºC, independientemente del tiempo de exposición, presentaron una mayor área necrosada (35% en comparación con el resto de los tratamientos. Las áreas con acumulación de H2O2 in situ fueron mayores en los tratamientos de estrés por temperaturas altas (45 y 60 oC. La detección y cuantificación de la necrosis producida por temperaturas extremas, combinando el método del azul de tripano con el análisis de imágenes, es una herramienta útil para valorar los daños producidos por estrés de temperaturas y pudiera ser utilizado para valorar los daños celulares provocados por otros tipos de estrés.Palabras clave: variedad-Habana-2000; especies reactivas de oxígeno; H2O2;; Habana-2000-variety; reactive oxygen species.
Directory of Open Access Journals (Sweden)
I. Miranda Pasos
2014-06-01
Full Text Available La industria de la construcción cada vez más consciente de la necesidad de ejecutar obras con materiales que se obtengan y/o utilicen procesos industriales que minimicen la contaminación y, que contribuyan en el comportamiento de un producto como lo es el concreto hidráulico en la construcción, ha estado buscando alternativas de materiales que sustituyan total o parcialmente al cemento por otro cementante que contamine menos en su procesos de obtención y que conserve las propiedades o las mejore. Una alternativa para sustitución parcial del cemento es la zeolita, es un mineral que se obtiene por proceso de excavación y molienda de puzolana. La norma ASTM-618, define a las puzolanas como materiales silíceo o aluminio-silíceo que por sí solo poseen poco a ningún valor cementante, pero cuando se han dividido finamente y en presencia de agua e hidróxido de calcio (Cal reaccionan químicamente a temperatura ambiente para formar cementantes (Miranda, 2008. Recientemente se ha estudiado el efecto de adicionar mineral Cal-Zeolita para la elaboración del concreto, cuyos resultados son favorables al comportamiento mecánico y su durabilidad (Dopico J.J., et al. 2009. Para la elaboración de morteros para recubrimientos al incorporar arenas zeolíticas como sustituto de la arena tradicional (Tiburcio et al. 2008. El presente proyecto evaluó el comportamiento del concreto hidráulico en estado fresco y endurecido al sustituir de manera parcial cemento por zeolita. Se enfocó a la evaluación del comportamiento mecánico como al diseño de la mezcla de concreto hidráulico fabricado con cemento normal y con cemento-zeolita. Tomando en cuenta los resultados obtenidos, la zeolita incorporada en porcentajes entre el 5% y 10 % tiende a valores de resistencias muy cercanos al concreto normal, los modelos obtenidos así lo corroboran, por lo que se puede concluir la factibilidad de sustitución parcial de cemento por zeolita tomando en cuenta el
PERFIL DOS ATENDIMENTOS POR CAUSAS EXTERNAS EM HOSPITAL PÚBLICO
Directory of Open Access Journals (Sweden)
Marlos Victor Fonsêca de Lima
2012-01-01
Full Text Available El objetivo fue identificar el perfil de los atendimientos por causas externas en la urgencia de un hospital público de referencia del Estado. Investigación descriptiva documental, con enfoque cuantitativo. En el análisis de datos, el período de enero a diciembre de 2009 se realizó 4.464 atendimientos por causas externas. La mayor frecuencia de las lesiones ocurrió en personas entre 21 y 40 años (37,70% y hombres (68,6%. Cuanto a las causas, las caídas (29% fue la mayor variable, seguido por accidente de motocicleta (17,98%, accidentes domiciliario (16,53%, agresión física (10,43% y accidente de motocicleta (8,84%. Se observó que 23,3% de los atendimientos realizados en la urgencia fueron de la población procedente de municipios aledaños. Hay, por lo tanto, la necesidad de mejorar la calidad de las informaciones acerca de las quejas motivadas por causas externas, principales causas de hospitalización y gastos en salud.
Justicia social y ambiental: mujeres por la soberanía alimentaria
Directory of Open Access Journals (Sweden)
Angelica Velasco Sesma
2010-05-01
Full Text Available Dada la situación de crisis alimentaria, climática, energética y financiera a nivel internacional y el aumento del hambre en el mundo, numerosos movimientos sociales se han unido para luchar por la soberanía alimentaria y por la agricultura campesina. Las mujeres, como sujetos que desempeñan un rol fundamental en la actividad agraria, han manifestado, en la Declaración de las mujeres por la Soberanía Alimentaria, Nyéléni, Mali, 2007, que pretenden unir su lucha por la sostenibilidad con la reivindicación de sus derechos.
Escenarios de costos generados por el uso del costeo variable
Zea Lourido, Felipe
2013-01-01
Este trabajo demuestra cómo el costeo absorbente, considerado por expertos en la materia, uno de los métodos de costeo usado frecuentemente por las organizaciones, con el propósito de determinar el valor de los inventarios y del costo de productos vendidos que intervienen en el estado de resultados para usuarios externos (stakeholders), al compararlo con el costeo variable, preferido por algunos administradores para toma de decisiones internas y usado en la preparación del estado de resultado...
ORF Alignment: NC_003295 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON
Elasticidad precio de la demanda por autopistas interurbanas en Chile
Directory of Open Access Journals (Sweden)
Rodrigo Sanes
2013-01-01
transporte depende de la información que se disponga respecto a la elasticidad precio de la demanda por el uso de puentes, túneles y carreteras. El objetivo de este trabajo es estimar la elasticidad precio de la demanda por el uso de autopistas interurbanas en Chile utilizando el método de regresiones aparentemente no relacionadas (SUR y un panel de 48 datos mensuales obtenidos a partir de 21 plazas de peajes (48 x 21. Nuestros resultados muestran que, aún controlando por el precio de la gasolina y el nivel de actividad económica, la demanda por el uso de carreteras resulta ser muy inelástica al precio del peaje, con valores que oscilan entre -0,17 para automóviles y -0,05 para camiones.
Directory of Open Access Journals (Sweden)
Kim Tae
2011-06-01
Full Text Available Abstract Background Ralstonia eutropha H16, found in both soil and water, is a Gram-negative lithoautotrophic bacterium that can utillize CO2 and H2 as its sources of carbon and energy in the absence of organic substrates. R. eutropha H16 can reach high cell densities either under lithoautotrophic or heterotrophic conditions, which makes it suitable for a number of biotechnological applications. It is the best known and most promising producer of polyhydroxyalkanoates (PHAs from various carbon substrates and is an environmentally important bacterium that can degrade aromatic compounds. In order to make R. eutropha H16 a more efficient and robust biofactory, system-wide metabolic engineering to improve its metabolic performance is essential. Thus, it is necessary to analyze its metabolic characteristics systematically and optimize the entire metabolic network at systems level. Results We present the lithoautotrophic genome-scale metabolic model of R. eutropha H16 based on the annotated genome with biochemical and physiological information. The stoichiometic model, RehMBEL1391, is composed of 1391 reactions including 229 transport reactions and 1171 metabolites. Constraints-based flux analyses were performed to refine and validate the genome-scale metabolic model under environmental and genetic perturbations. First, the lithoautotrophic growth characteristics of R. eutropha H16 were investigated under varying feeding ratios of gas mixture. Second, the genome-scale metabolic model was used to design the strategies for the production of poly[R-(--3hydroxybutyrate] (PHB under different pH values and carbon/nitrogen source uptake ratios. It was also used to analyze the metabolic characteristics of R. eutropha when the phosphofructokinase gene was expressed. Finally, in silico gene knockout simulations were performed to identify targets for metabolic engineering essential for the production of 2-methylcitric acid in R. eutropha H16. Conclusion The
Mortalidad por defectos del tubo neural en México, 1980-1997
Directory of Open Access Journals (Sweden)
Ramírez-Espitia José A
2003-01-01
Full Text Available OBJETIVO: Describir la mortalidad en México por defectos del tubo neural, durante el periodo 1980-1997. MATERIAL Y MÉTODOS: Las tasas anuales de mortalidad estatales y nacionales, por defectos del tubo neural, se calcularon por 10 000 nacidos vivos. La tendencia temporal fue evaluada por el porcentaje de cambio anual obtenido mediante un modelo de regresión de Poisson. Se calculó la razón de mortalidad, tomando la media nacional como referencia. Las tasas y las razones se representaron gráficamente en mapas. RESULTADOS: Durante el periodo la tasa bruta de mortalidad por defectos del tubo neural fue de 5.8 por 10 000 nacidos vivos. La anencefalia fue el tipo de defecto más frecuente (37.7%, seguida de la espina bífida sin hidrocefalia (31.6%. La tendencia nacional de la mortalidad por defectos del tubo neural fue ascendente entre 1980 y 1990 (porcentaje de cambio anual 7.5 IC 95% 6.5, 8.6 y descendente entre 1990-1997 (porcentaje de cambio anual -2.3 IC 95% -3.6, -0.9. CONCLUSIONES: Las altas tasas de mortalidad por defectos del tubo neural fueron debidas principalmente a la elevada frecuencia de las anencefalias. El incremento observado parece no ser sólo atribuible a cuestiones puramente diagnósticas o de mejora en los registros. La influencia de factores asociados a estos defectos, como determinados polimorfismos genéticos, la deficiencia de ácido fólico, la obesidad materna, la exposición laboral a plaguicidas y la pobreza deberán evaluarse mediante estudios específicos.
Directory of Open Access Journals (Sweden)
Francisco Javier Otero-Mendoza
2017-06-01
Full Text Available Niño de 1 año 10 meses de edad, originario de Irapuato, Guanajuato, sin antecedentes de importancia para el padecimiento actual. Inició dos meses previos a su ingreso con crisis convulsivas tónico-clónicas generalizadas de 15 segundos de duración durante el sueño. Se realizó electroencefalograma que reportó actividad epileptiforme, por lo que se dio tratamiento con ácido valproico. Una semana previa al ingreso se agregó ataxia troncal impidiendo la marcha, por lo que se realizó una tomografía axial computarizada de cráneo en la que se observó un tumor en fosa posterior con densidad heterogénea y áreas de necrosis central que obliteraba el cuarto ventrículo, ocasionando efecto de masa y desplazamiento ventral del tallo cerebral. Por tal motivo, fue referido a nuestra institución.
Higiene alimentaria para la prevención de trastornos digestivos infecciosos y por toxinas
Directory of Open Access Journals (Sweden)
G. Manuel Moreno, Dr.
2010-09-01
Full Text Available El principal factor que interviene en el origen y prevención de las enfermedades trasmitidas por los alimentos es la higiene alimentaria. Dichas enfermedades son causadas por la ingestión de alimentos o agua contaminados con microorganismos patógenos ocasionando una infección o por la ingestión de alimentos contaminados con toxinas. Los principales agentes involucrados son Escherichia Coli, Campylobacter, Salmonella, Shigella, Listeria Monocytogenes, Norovirus, virus Hepatitis A, Astrovirus, Rotavirus, y Virus Coxsackie. Toxinas producidas por hongos o por microflora marina y los contaminantes orgánicos persistentes pueden también causar serios problemas de salud. La inocuidad alimentaría ha tomado relevancia debido a una mayor exigencia por consumidores cada día más informados y por las demandas del comercio exterior. Medidas que aseguren una adecuada higiene alimentaría nos permitirá prevenir enfermedades, principalmente digestivas, causadas por variados agentes en los alimentos. Esto se logra por la implementación de las medidas propuestas por la Comisión Internacional conocida como Codex Alimentarius.
Endoftalmitis poscirugía de catarata por Sphingomonas paucimobilis
Directory of Open Access Journals (Sweden)
Omar Mauri Garrido
Full Text Available Se presenta la caracterización y manejo terapéutico de un caso de endoftalmitis bacteriana posoperatoria causada por el germen Sphingomonas paucimobilis. La endoftalmitis es la inflamación de los tejidos intraoculares, considerada como la más devastadora de las complicaciones posoperatorias; posee pronóstico visual muy reservado y un elevado riesgo de secuela. Las Sphingomonas paucimobilis son bacterias gramnegativas con forma de bacilo, quimioheterótrofa y estrictamente aerobias que causan enfermedades en los seres humanos, principalmente infecciones hospitalarias que típicamente son tratadas fácilmente con antibióticos. Por sus capacidades biodegradantes y biosintéticas, son pocos los reportes hallados de infección intraocular por este germen. El pronóstico visual es favorable con un diagnóstico precoz y la aplicación del tratamiento adecuado. En este artículo se presentan un caso de endoftalmitis poscirugía de catarata por Sphingomonas paucimobilis reportado en Cuba en el mes de septiembre de 2009.
Eritema multiforme mayor desencadenado por antimicrobianos
Directory of Open Access Journals (Sweden)
Ronaldo de Carvalho Raimundo
2010-03-01
Full Text Available El eritema multiforme, aparece como una enfermedad sistémica con la participación de la piel y las membranas mucosas en relación con varios factores como las infecciones bacterianas o virales, y en particular la administración de drogas, analgésicos y antibióticos en general. Se presenta un paciente masculino de 29 años de edad con eritema multiforme mayor desencadenado por antimicrobianos con la aparición de lesiones vesiculares-bulloso-ulcerosas en las regiones de los labios, encías, la lengua y la mucosa genital en tratamiento de una infección del tracto urinario con norfloxacino 400 mg por una semana. Fue realizado un tratamiento de soporte con el uso de colutorios para la higienización bucal y pomada a base de corticoide para protección de las úlceras, antihistamínicos y orientación nutricional de dieta líquida hipercalórica e hiperproteica. Este síndrome está caracterizado como un proceso eruptivo buloso agudo que compromete la calidad de vida del paciente y no hay pruebas de laboratorio específicas por lo que su diagnóstico debe estar basado en la revisión minuciosa de la anamnesis y en los hallazgos clínicos.
Tendencias de la mortalidad por fiebre amarilla, Colombia, 1998-2009
Directory of Open Access Journals (Sweden)
Ángela María Segura
2013-08-01
Full Text Available Introducción. La fiebre amarilla es una enfermedad tropical desatendida, razón por la cual el conocer las tendencias de mortalidad por fiebre amarilla en Colombia, constituye una importante fuente de información para la toma de decisiones y las intervenciones en salud pública. Objetivo. Analizar las tendencias de mortalidad fiebre amarilla en Colombia (1998-2009 y las diferencias que presentan las fuentes de información de morbilidad y mortalidad en el país, que afectan indicadores como el de letalidad. Materiales y métodos. Es un estudio descriptivo de las muertes por fiebre amarilla, según el Departamento Administrativo Nacional de Estadística, y de la incidencia de la enfermedad, según el Instituto Nacional de Salud. Se usaron fuentes secundarias de información en el cálculo de proporciones de las características sociodemográficas de los fallecidos y las medidas epidemiológicas de letalidad, incidencia y mortalidad por fiebre amarilla, por departamento de residencia de los fallecidos. Resultados. Las muertes por fiebre amarilla se presentan principalmente en hombres, en edad de trabajar, residentes en zonas rurales dispersas, afiliados al régimen vinculado, residentes en las zonas oriental, suroriental, norte y central del país. Se observaron inconsistencias en los informes reportados que afectan el análisis comparativo. Conclusión. Los habitantes de los departamentos ubicados en los territorios nacionales y en Norte de Santander presentan mayor riesgo de enfermar y de morir por fiebre amarilla, pero esta información pudiera estar subestimada, según la fuente de información utilizada en su cálculo. doi: http://dx.doi.org/10.7705/biomedica.v33i0.698
Energy Technology Data Exchange (ETDEWEB)
Ayala Delgado, Ramon; Heard, Christopher Lionel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1996-12-31
The use of the absorption/compression refrigeration in the industrial area is analyzed. It is estimated than in Mexico 50% of the food is wasted for lack of refrigeration in the producing centers and by the inefficient distribution system, as well as for the hot climate. The functioning of the absorption refrigeration and the hybrid system absorption/compression which can operate with the two thermodynamic cycles in variable proportions, depending on the specific application, looking for operational advantages and energy efficiency is described. This type of technology could be applied in Mexico due to the lack of industrial refrigeration and to the need of substituting compressors in some companies which have up to 20 years of use [Espanol] Se analiza el uso de la refrigeracion por absorcion/compresion en el area industrial. En Mexico se estima que se desperdicia el 50% de los alimentos por falta de refrigeracion en los centros productores y por el deficiente sistema de distribucion, asi como por el clima calido. Se describe el funcionamiento de la refrigeracion por absorcion y la refrigeracion por absorcion/compresion o sistema hibrido, el cual puede funcionar con los dos tipos de ciclos termodinamicos, en proporciones variables, dependiendo de la aplicacion especifica, buscando ventajas de operacion y eficiencia energetica. Este tipo de tecnologia podria aplicarse en Mexico debido a la falta de refrigeracion industrial y a la necesidad de sustituir compresores en algunas empresas los cuales tienen hasta 20 anos de uso
Energy Technology Data Exchange (ETDEWEB)
Ayala Delgado, Ramon; Heard, Christopher Lionel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1997-12-31
The use of the absorption/compression refrigeration in the industrial area is analyzed. It is estimated than in Mexico 50% of the food is wasted for lack of refrigeration in the producing centers and by the inefficient distribution system, as well as for the hot climate. The functioning of the absorption refrigeration and the hybrid system absorption/compression which can operate with the two thermodynamic cycles in variable proportions, depending on the specific application, looking for operational advantages and energy efficiency is described. This type of technology could be applied in Mexico due to the lack of industrial refrigeration and to the need of substituting compressors in some companies which have up to 20 years of use [Espanol] Se analiza el uso de la refrigeracion por absorcion/compresion en el area industrial. En Mexico se estima que se desperdicia el 50% de los alimentos por falta de refrigeracion en los centros productores y por el deficiente sistema de distribucion, asi como por el clima calido. Se describe el funcionamiento de la refrigeracion por absorcion y la refrigeracion por absorcion/compresion o sistema hibrido, el cual puede funcionar con los dos tipos de ciclos termodinamicos, en proporciones variables, dependiendo de la aplicacion especifica, buscando ventajas de operacion y eficiencia energetica. Este tipo de tecnologia podria aplicarse en Mexico debido a la falta de refrigeracion industrial y a la necesidad de sustituir compresores en algunas empresas los cuales tienen hasta 20 anos de uso
¿Por qué hay canciones que perduran?
Directory of Open Access Journals (Sweden)
Josune Albisu Barandiaran
2015-11-01
Full Text Available El principal objetivo de este artículo es analizar una canción, Txoria txori, para deducir cuales han sido las principales características que la han convertido en “Himno popular”, permitiéndola perdurar en el tiempo. Dentro de las principales características, dos han sido verdaderamente reseñables: por una parte, la plasticidad, y por otra, la sencillez y estructura clara de la canción.
Manifestaciones oftalmológicas por virus de Epstein-Barr
Directory of Open Access Journals (Sweden)
Adrianne MayulySuñetÁlvarez
Full Text Available Se trata de un paciente masculino de 26 años que acude por disminución brusca de la visión del ojo derecho. Seingresó como una uveítis posterior dada por exudación extensa en área macular del ojo derecho, acompañada de edema del disco óptico, vasculitis aledaña a la lesión y hemorragias dispersas en llama en el polo posterior. La etiología era controversial y, el tratamiento más apropiado era debatible, por lo que se le realizaron estudios como retinografías seriadas, angiografías fluoresceínicas y reacción en cadena de polimerasa a una muestra del humor acuoso, que confirmó la etiología viral; lo que resultó en una agudeza visual final de 0,1. Posterior a 6 meses del cuadro inicial, el paciente presentó queratitis intraestromal en forma numular -que recurre ante episodios de stress-, para desaparecer luego de terapia tópica con antiinflamatorios no esteroideos y esteroideos.La baja incidencia de casos reportados con uveítis posterior por virus de Epstein Barr resulta de un pobre conocimiento de la presentación de la enfermedad, por tanto un retraso en la instauración del tratamiento. En estos casos la prueba de oro es la reacción de cadena de polimerasa.
LUCHA POR LA TIERRA EN EL NORTE DE URUGUAY
Directory of Open Access Journals (Sweden)
Gabriel Oyhantçabal Benelli
2011-12-01
Full Text Available Este artículo analiza la trayectoria de la lucha por la tierra en Bella Unión, una región característica en Uruguay por la producción de caña de azúcar, a través de los movimientos de clase de sus principales protagonistas: los cortadores de caña sindicalizados en la Unión de Trabajadores Azucareros de Artigas (UTAA. El recorrido histórico hace énfasis en dos períodos históricos diferentes: 1961-1973 y 2005-presente. El primero va desde la fundación del sindicato hasta el golpe militar. Se da en un contexto de auge de la lucha de masas en Uruguay en el cual los trabajadores rurales se organizan en la UTAA levantando, entre otras, la bandera de la Reforma Agraria. El segundo período está marcado por la llegada al gobierno nacional del Frente Amplio, una coalición social-demócrata que reactiva la producción de caña de azúcar en Bella Unión. Este cambio supone una oportunidad para las luchas sociales que la UTAA aprovecha con ocupaciones de tierra favoreciendo un proceso de colonización para los trabajadores rurales. Sin embargo el acceso a la tierra genera nuevas contradicciones, y por tanto nuevos desafíos, por los cambios en la forma de subsunción del trabajo al capital.
Riesgos antrópicos generados por la actividad minera
Directory of Open Access Journals (Sweden)
Ana Violeta Argüello Mejía
2013-10-01
Full Text Available Las actividades productivas generan riesgos antrópicos [1] a mediano y largo plazo. La zona de estudio se ubica en las Parroquias de Pomasqui, San Antonio y Calacalí, donde se han producido riesgos debido a las actividades humanas, en este caso, por la explotación de las canteras para abastecer el mercado de la construcción del Distrito Metropolitano de Quito. La investigación propone determinar los riesgos antrópicos generados por la actividad minera. Los pobladores de la zona identifican que la minería artesanal en sus inicios constituyó una fuente de trabajo, donde sus familias también se involucraban. Actualmente, se observa que en la mayoría de las canteras se utiliza maquinaria especializada y no participan los trabajadores de la zona. Los taludes de las canteras son de 80o y 90o grados, generando amenazas para los trabajadores y moradores de las viviendas aledañas. Uno de los mayores impactos es la contaminación del aire, sin embargo, el suelo y los cursos de agua están siendo afectados por los desperdicios que produce la actividad minera. La población, que está expuesta permanentemente al polvo ocasionado por las canteras y al transporte de material, acusa enfermedades de tipo respiratorio. Así mismo, el ruido ocasionado por el transporte constituye una molestia constante para los pobladores.
Directory of Open Access Journals (Sweden)
Miguel B. Carrasco Guzmán
2016-01-01
Full Text Available Las infecciones de la piel y el tejido celular subcutáneo surgen como un grupo importante de afecciones con una alta morbilidad en edades pediátricas, generalmente relacionada con traumatismo y cuerpos extraños. Se presenta el caso de una escolar femenina de 6 años de edad, con síntomas y signos clínicos que sugieren celulitis en el muslo derecho, por su evolución tórpida se le realizó el estudio ultrasonográfico que confirmó el diagnóstico etiológico de una celulitis secundaria a un traumatismo, provocada por la introducción de un gran cuerpo extraño, que pasó inadvertido para a familia de la menor.
Vasquez, Abel E; Manzo, Ricardo A; Soto, Daniel A; Barrientos, Magaly J; Maldonado, Aurora E; Mosqueira, Macarena; Avila, Anastasia; Touma, Jorge; Bruce, Elsa; Harris, Paul R; Venegas, Alejandro
2015-01-01
The Neisseria meningitidis outer membrane protein PorA from a Chilean strain was purified as a recombinant protein. PorA mixed with AbISCO induced bactericidal antibodies against N. meningitidis in mice. When PorA was fused to the Helicobacter pylori HpaA antigen gene, the specific response against H. pylori protein increased. Splenocytes from PorA-immunized mice were stimulated with PorA, and an increase in the secretion of IL-4 was observed compared with that of IFN-γ. Moreover, in an immunoglobulin sub-typing analysis, a substantially higher IgG1 level was found compared with IgG2a levels, suggesting a Th2-type immune response. This study revealed a peculiar behavior of the purified recombinant PorA protein per se in the absence of AbISCO as an adjuvant. Therefore, the resistance of PorA to proteolytic enzymes, such as those in the gastrointestinal tract, was analyzed, because this is an important feature for an oral protein adjuvant. Finally, we found that PorA fused to the H. pylori HpaA antigen, when expressed in Lactococcus lactis and administered orally, could enhance the antibody response against the HpaA antigen approximately 3 fold. These observations strongly suggest that PorA behaves as an effective oral adjuvant.
Directory of Open Access Journals (Sweden)
Ana Jerónimo
2009-03-01
Full Text Available A intoxicação medicamentosa por dissulfiram é uma situação rara, mas, que pode se apresentar com manifestações cardiovasculares graves e potencialmente fatais, como choque cardiogênico. É apresentado o caso de uma paciente com choque refratário, após intoxicação voluntária por dissulfiram. A avaliação clínica e bioquímica, junto à avaliação ecocardiográfica e à monitorização invasiva, confirmaram tratar-se de um choque cardiogênico associado a esse fármaco. São discutidos os mecanismos de ação conhecidos do dissulfiram e descritos os principais efeitos colaterais, especialmente os cardiovasculares, alertando para a importância da suspeição diagnóstica e da abordagem terapêutica imediata mais adequada nesse contexto.La intoxicación medicamentosa por disulfiram es una situación rara, aunque puede presentarse con manifestaciones cardiovasculares graves y potencialmente fatales, como el shock cardiogénico. Este relato presenta el caso de una paciente con shock refractario, tras intoxicación voluntaria por disulfiram. La evaluación clínica y bioquímica, junto a la evaluación ecocardiográfica y el monitoreo invasivo, confirmaron tratarse de un shock cardiogénico asociado a ese fármaco. A lo largo del presente relato se discuten los mecanismos de acción del disulfiram conocidos, así como se describen los principales efectos colaterales, específicamente los cardiovasculares. En este sentido, también se alerta para la importancia de la sospecha diagnóstica y del abordaje terapéutico inmediato más adecuado a este contexto.Drug intoxication with disulfiram is a rare condition that may lead to severe and potentially fatal cardiovascular manifestations such as cardiogenic shock. We report the case of a female patient with refractory shock after deliberate self-poisoning with disulfiram. Clinical, biochemical and echocardiographic assessment, as well as invasive monitoring confirmed cardiogenic shock
Elasticidad precio de la demanda por autopistas interurbanas en Chile
Directory of Open Access Journals (Sweden)
Rodrigo Saens
2013-07-01
Full Text Available La efectividad de un esquema de tarificación vial para optimizar el uso de infraestructura de transporte depende de la información que se disponga respecto a la elasticidad precio de la demanda por el uso de puentes, túneles y carreteras. El objetivo de este trabajo es estimar la elasticidad precio de la demanda por el uso de autopistas interurbanas en Chile utilizando el método de regresiones aparentemente no relacionadas (SUR y un panel de 48 datos mensuales obtenidos a partir de 21 plazas de peajes (48 x 21. Nuestros resultados muestran que, aún controlando por el precio de la gasolina y el nivel de actividad económica, la demanda por el uso de carreteras resulta ser muy inelástica al precio del peaje, con valores que oscilan entre -0,17 para automóviles y -0,05 para camiones.
Fiebres hemorrágicas por Arenavirus en Latinoamérica
Directory of Open Access Journals (Sweden)
Ella Soto
2010-01-01
Full Text Available Las fiebres hemorrágicas virales producidas por Arenavirus incluyen a los virus endémicos en África (Lassa y el virus de la coriomeningitis linfocítica (LCMV, de distribución mundial, y los Arenavirus del Nuevo Mundo o Complejo Tacaribe, que incluye a los virus endémicos en las Américas (Junín, Machupo, Guanarito, Sabiá, Pichinde, entre otros. Los huéspedes naturales son los roedores y la infección en humanos se produce por el contacto con la orina y excretas. Las manifestaciones clínicas inicialmente son indistinguibles de otras fiebres hemorrágicas producidas por bacterias, parásitos y otros virus, constituyéndose esto en un problema de salud pública, por lo que se requiere realizar el diagnóstico diferencial utilizando técnicas serológicas y moleculares.
Itinerario de la Patria: por tierras del golfo lejano
Directory of Open Access Journals (Sweden)
Adel López Gómez
1965-06-01
Full Text Available Veinticinco años atrás solo primaba en estas infinitudes el imperio de la selva. Desde Dabeiba tórrido hasta Turbo sudoroso y lacustre se empleaba casi una semana a lomo de mula o a quimba de peatón, por una sombría trocha de miasmas y de lodo, abierta a machete por entre la áspera e interminable manigua. Por allí pasaron una y otra vez los pálidos hombres de nuestros enganches, cuando en 1939 iniciamos, a la orilla del Golfo de Urabá, la ingente tarea de construír una carretera hacia el interior para poner al alcance de las llantas antioqueñas la orilla salvaje del Atlántico maicero.
2015. 2. Por qué celebrar primarias
Sanz Díaz, Benito
2015-01-01
¿Por qué celebrar primarias? ¿Beneficia o perjudica a las organizaciones y partidos que las promueven?, ¿Mejora la participación?, ¿La elección de los dirigentes evita la oligarquización y la Ley de Hierro de los partidos políticos que enunció Robert Michels? Un sistema de selección de candidatos con origen en la política norteamericana, fue adaptado por el PSOE, y a continuación iría extendiéndose su práctica a los todos los partidos políticos. Ignacio Urquizu señalaba sobre l...
14 Nobel, preocupados por el CERN
Rivera, A
2003-01-01
"E l presidente del Consejo del CERN (Laboratorio Europeo de Fisica de Particulas, junto a Ginebra), Maurice Bourquin, ha recibido una carta firmada por un grupo de cientificos muy especiales: 14 premios Nobel de Fisica" (1 page).
Mortalidad intrahospitalaria por accidente cerebrovascular
Directory of Open Access Journals (Sweden)
Federico Rodríguez Lucci
2013-08-01
Full Text Available La mortalidad global por accidente cerebrovascular (ACV ha disminuido en las últimas tres décadas, probablemente debido a un mejor control de los factores de riesgo vascular. La mortalidad hospitalaria por ACV ha sido tradicionalmente estimada entre 6 y 14% en la mayoría de las series comunicadas. Sin embargo, los datos de ensayos clínicos recientes sugieren que esta cifra sería sustancialmente menor. Se revisaron datos de pacientes internados con diagnóstico de ACV del Banco de Datos de Stroke de FLENI y los registros institucionales de mortalidad entre los años 2000 y 2010. Los subtipos de ACV isquémicos se clasificaron según criterios TOAST y los ACV hemorrágicos en hematomas intrapanquimatosos, hemorragias subaracnoideas aneurismáticas, malformaciones arteriovenosas y otros hematomas intraparenquimatosos. Se analizaron 1514 pacientes, 1079 (71% con ACV isquémico (grandes vasos 39%, cardioembólicos 27%, lacunares 9%, etiología indeterminada 14%, otras etiologías 11% y 435 (29% con ACV hemorrágico (intraparenquimatosos 27%, hemorragia subaracnoidea 30%, malformaciones arteriovenosas 25% y otros hematomas espontáneos 18%. Se registraron 38 muertes intrahospitalarias (17 ACV isquémicos y 21 ACV hemorrágicos, representando una mortalidad global del 2.5% (1.7% en ACV isquémicos y 4.8% en ACV hemorrágicos. No se registraron muertes asociadas al uso de fibrinolíticos endovenosos. La mortalidad intrahospitalaria en pacientes con ACV isquémico y hemorrágico en nuestro centro fue baja. El manejo en un centro dedicado a las enfermedades neurológicas y el enfoque multidisciplinario por personal médico y no médico entrenado en el cuidado de la enfermedad cerebrovascular podrían explicar, al menos en parte, estos resultados.
Directory of Open Access Journals (Sweden)
Leonardo Ferrerira
2015-01-01
Full Text Available Estados Unidos y Rusia representan el 15 por ciento de la población mundial sin embargo utilizan el 50 por ciento de la órbita geoestacionaria, mientras todo el Tercer Mundo emplea menos del 10 por ciento. Los países del Pacto Andino se encuentran trabajando conjuntamente en el uso compartido de un solo sistemas satelital CONDOR. Pero los críticos norteamericanos consideran que es una manera ineficiente e irracional congestionar el espectro orbital. El artículo se centra en describir este proyecto y la lógica Andina, la soberanía
Hipoglucemia inducida por carcinoma adrenal
Directory of Open Access Journals (Sweden)
Jimena Soutelo
2013-08-01
Full Text Available El carcinoma suprarrenal es una neoplasia maligna infrecuente y de mal pronóstico. La presentación clínica más común es originada por la producción hormonal excesiva, mientras que el desarrollo de hipoglucemia sintomática es excepcional. Presentamos el caso de una mujer de 37 años que ingresó al hospital por síntomas de hipoglucemias graves, hipertensión arterial, hipopotasemia y amenorrea secundaria. En el laboratorio se halló hipoglucemia con insulina inhibida y niveles de andrógenos en rango tumoral. La tomografía computarizada (TC de abdomen y pelvis mostró voluminosa formación heterogénea de aspecto sólido sin plano de clivaje con respecto al parénquima hepático e intenso realce con contraste. Luego de la extirpación de la masa retroperitoneal, evolucionó con valores de glucemia y potasemia normales, estabilizó la presión arterial y recuperó los ciclos menstruales.
Cefaleia por uso excessivo de medicamentos
Directory of Open Access Journals (Sweden)
Ariane Maria Fonseca MIRANDA
2015-01-01
Full Text Available Uma variante da cefaleia crônica diária, a cefaleia por uso excessivo de medicamentos é uma manifestação clínica de frequência ≥ 15 dias por mês, durante 3 meses. Possui um diagnóstico deficiente e um tratamento dividido em etapas, sendo a desintoxicação, a etapa de fundamental importância. Este artigo apresenta uma revisão sobre o tema, contribuindo para o esclarecimento das principais manifestações clínicas, principais teorias envolvendo sua fisiopatologia e a terapêutica farmacológica empregada. A metodologia utilizada foi uma revisão de publicações europeias e americanas, no período de 2001 a 2013, nos idiomas português, inglês e espanhol. Todos os medicamentos utilizados no tratamento sintomático das cefaleias são capazes de cronificar uma cefaleia preexistente, desde que sejam utilizados excessivamente, de forma regular e continuada. A suspensão de tais agentes terapêuticos resultará em melhoria na maioria dos pacientes, porém pode ser necessária a introdução de uma terapia de suporte de transição e/ou terapia profilática. Os tratamentos nao farmacológicos, quando associados ao farmacológico, ampliam a possibilidade de resultados satisfatórios, evitando recaídas.
Directory of Open Access Journals (Sweden)
Florencia del Puerto
2015-04-01
Full Text Available En países donde el Plasmodium ovale no es común, los microscopistas tienden a identificarlo de manera errónea como Plasmodium vivax. En este trabajo reportamos la identificación de la especie P. ovale curtisi por el método de PCR múltiple semianidada (SnM-PCR y la secuenciación de la subunidad pequeña del gen del ARN 18S, en un paciente paraguayo de 44 años de edad que vino en el 2.013 de Guinea Ecuatorial, África Occidental, a quien se le diagnosticó una infección por P. vivax por microscopía convencional. El empleo de métodos moleculares para la identificación de casos importados de infección con especies del género Plasmodium es uno de los objetivos principales en el control y la prevención de la malaria en Paraguay, teniendo en cuenta que el país se encuentra en fase de pre-eliminación de la enfermedad.
Contractura axilar por quemadura tratada con Integra®
Roa G,Ricardo; Las Heras F,Rocío; Piñeros B,José L; Correa S,Gerardo; Norambuena B,Hernán; Marré N,Diego
2011-01-01
Las quemaduras axilares severas son un accidente infrecuente que evolucionan a la retracción generando deficiencias cosméticas y funcionales. Estas cicatrices son difíciles de tratar por las características anatómicas del área, donde la corrección de un vector de movimiento puede alterar otro. Objetivo: Mostrar nuestros resultados utilizando el sustituto cutáneo Integra® en el tratamiento de cicatrices retráctiles axilares por quemadura. Pacientes y Métodos: Se recolectaron antecedentes médic...
¿Por qué fracasan las campañas?
Directory of Open Access Journals (Sweden)
Andrea Castelnuovo
2015-01-01
Full Text Available Analiza tres experiencias en las que puede evidenciarse por qué fracasan las campañas sociales: por la misma razón, fueron concebidas con mensajes destinados a una población que vive y percibe el mundo desde el nivel económico y socio-cultural distinto, el emisor no empata con los perfiles del receptor. Es fundamental empezar por definir qué se debe decir, a quién, y cómo, para luego encontrar los medios más adecuados para su difusión. La espectacularidad y etnocentrismo, las campañas sociales seguirán sirviendo exclusivamente para mejorar las finanzas de los medios de comunicación masivos y secundariamente, para brindar materia prima a humoristas y contestarios.
Estudo dos linfócitos circulantes por anticorpos monoclonais na miastenia grave
Directory of Open Access Journals (Sweden)
Paulo E. Marchiori
1988-09-01
Full Text Available Os autores avaliam os linfócitos T (CD3, CD4, CD8, CD4/8 por anticorpos monoclonais e rosácea em 20 pacientes e linfócitos B por Fab' por imunofluorescência em 9 pacientes com miastenia grave. Observam elevação significante na população de linfócito B e redução nos linfócitos T totais CD3+ por rosáceas. Não foram observadas modificações nas subpopulações celulares com timectomia e corticosteróides.
México en la segunda Guerra Mundial visto por la Diplomacia venezolana
Silva L, Dómel
2013-01-01
Partiendo del análisis de una serie de documentos concernientes a las comunicaciones entre la llamada “Legación de Venezuela” en México y la Cancillería de Venezuela durante los años de la Segunda Guerra Mundial (1939-1945), se esbozará las estrategias en común para ambas naciones; como fue la política de seguridad de cada Estado, enmarcada dentro de la política de seguridad continental. México por su importancia geoestratégica; por el petróleo, por su cercanía con los Estados Unidos y por la...
Directory of Open Access Journals (Sweden)
Enriqueta M. Serafini
2013-02-01
Full Text Available La osteomalacia inducida por tumor es una rara enfermedad del metabolismo óseo caracterizada por el aumento en la excreción de fosfato a nivel renal seguido de hipofosfatemia. Es causada por agentes fosfatúricos producidos por determinados tumores. La resección total del tumor resulta en la completa reversión de las anormalidades bioquímicas, la desaparición de las manifestaciones clínicas y los hallazgos en los estudios por imágenes. Presentamos el caso de un varón de 61 años con cuadro clínico y laboratorio compatibles con osteomalacia oncogénica inducida por tumor mesenquimático de localización rinosinusal. En nuestro caso el diagnóstico histológico correspondió a una neoplasia de tipo vascular: hemangiopericitoma.Tumor-induced osteomalacia is a rare disease of bone metabolism. The characteristic of this disease is an increase in phosphate excretion followed by hypophosphatemia, due to phosphaturic agents produced by different types of tumors. Tumor resection results in complete resolution of clinical, biochemical and radiological abnormalities. We present the case of a 61 year old man with signs, symptoms and laboratory findings consistent with oncogenic osteomalacia due to a rhino-sinusal mesenchymal tumor. The histological diagnosis showed a vascular neoplasm: hemangiopericytoma.
Directory of Open Access Journals (Sweden)
Marcus Vinicius Simões
2007-10-01
Full Text Available Apresenta-se o caso de uma paciente de 71 anos que preencheu os critérios diagnósticos para cardiomiopatia induzida por estresse que foi desencadeada por intenso estresse emocional após atropelamento por bicicleta. O quadro clínico mimetizou o infarto agudo do miocárdio, manifestando-se com dor precordial, supradesnivelamento do segmento ST, seguido por ondas T profundas e prolongamento do intervalo QT, elevação discreta de enzimas cardíacas e cursando com disfunção sistólica apical do ventrículo esquerdo e hipercinesia das porções basais (conferindo o aspecto de "abaloamento apical", mas na ausência de obstrução coronariana subepicárdica. A função ventricular normalizou-se após a segunda semana de evolução.The case presented here is of a 71-yr-old female patient who met the diagnostic criteria for stress-induced cardiomyopathy, which was triggered by intense emotional stress after being hit by a bicycle. The clinical picture mimicked that of an acute myocardial infarction, manifesting as precordial pain, ST-segment depression followed by deep negative T waves and prolonging of the QT interval, slight increase in cardiac enzymes and coursing with transient apical ballooning of the left ventricle and hyperkinesis of the basal walls (conferring the aspect of "apical ballooning", although in the absence of subepicardial coronary obstruction. Ventricular function normalized after the second week of clinical evolution.
Mortalidad por suicidio en la provincia de Pinar del Río
Directory of Open Access Journals (Sweden)
Ana Carmen Valdés Vento
2003-02-01
Full Text Available Se trata de una investigación descriptiva y retrospectiva sobre el comportamiento de la mortalidad por suicidio en la provincia Pinar del Río durante el año 2001, de acuerdo con una serie de variables seleccionadas. Se estudiaron todos los fallecidos por esa causa en el período señalado, que fueron un total de 110 para una tasa de 14,9 por 100 000 habitantes, por lo que es la séptima causa de muerte en la provincia. Llama la atención el amplio predominio del sexo masculino, de la incidencia en la tercera edad, y el hecho de no haber tenido este año el municipio Sandino fallecido alguno por esta causa, así como que el municipio de mayor número de fallecidos por este motivo fue Viñales con una tasa de 26,0 por 100 000 habitantes.A retrospective descriptive research work on the situation of mortality from suicide in Pinar del Río province during 2001 was carried out based on a group of selected variables. All the deaths form this cause, which amounted to 110 persons for a rate of 14.9 per 100 000 pop, were studied. Suicide was the seventh cause of death in the province. It should be underlined that males prevailed, the incidence of the elderly was high and that Sandino municipality had no death from suicide in this year whereas Viñales municipality showed the highest number of deceased, with a mortality rate of 26 per 100 000 pop.
Directory of Open Access Journals (Sweden)
Gabriel Moreira Campos
2001-08-01
Full Text Available Este trabalho tem por objetivo demonstrar os principais conceitos acerca do Lucro por Ação (Earnings per Share, o qual se apresenta como um quociente de grande utilidade nas entidades. Serão demonstrados aspectos sobre o assunto presentes no Brasil, bem como as normas aplicáveis nos Estados Unidos, emanadas do Financial Accounting Standards Board (FASB, e as normas internacionais, emanadas do International Accounting Standards Committee (IASC. De forma a possibilitar uma visualização mais completa dos conceitos envolvidos, serão desenvolvidos exemplos de sua aplicação. O Lucro (Resultado por Ação pode ser calculado em sua forma básica e em sua forma diluída. Na forma básica, não são considerados os efeitos dos instrumentos potencialmente dilutivos, ao passo que, no cálculo do Lucro (Resultado por Ação Diluído, são. Como instrumentos financeiros potencialmente dilutivos temos as ações preferenciais conversíveis, as debêntures conversíveis e os bônus de subscrição, que podem ser convertidos em ações ordinárias, caracterizando, assim, o próprio potencial dilutivo desses instrumentos. Dessa forma, o trabalho em questão foi dividido em três partes principais, sendo que nas duas últimas constam os referidos exemplos de cálculo do Lucro por Ação em sua forma básica e em sua forma diluída: • aspectos observados no Brasil; • normas emanadas do FASB; • normas emanadas do IASC.The objective of this paper is to demonstrate the principal concepts about Earnings per Share, which is presented as a quotient of great usefulness for the companies. The subject is presented in three parts: in the first part, we will demonstrate relevant aspects that are present in Brazil. In the second part, the applicable standards in the United States will be discussed, which are issued by the Financial Accounting Standards Board (FASB. In the third part, the international standards are dealt with, which are issued by the
Síndrome oculoglandular de Parinaud causada por esporotricose
Ribeiro,Alexandre Sampaio de Abreu; Bisol,Tiago; Menezes,Marcela Sant'Ana
2010-01-01
A síndrome oculoglandular de Parinaud é uma doença ocular rara causada por diferentes agentes etiológicos, entre eles bactérias, vírus e fungos. É caracterizada por uma conjuntivite granulomatosa, acompanhada de linfadenopatia pré-auricular adjacente e pode trazer sequelas caso não seja prontamente tratada. Neste artigo é relatado o caso de uma jovem técnica de enfermagem e estudante de medicina veterinária apresentando a síndrome oculoglandular de Parinaud causada pelo fungo Sporothrix schen...
Por qué todas las cuentas son falsas
Aerde, Michel van
1994-01-01
Los principales criterios para evaluación y decisión, en la sociedad actual, son inspirados por cálculos económicos. Mucho nos preocupamos de cuentas pero muy poco nos preguntamos de lo que es el dinero. Muy poco reflexionamos filosóficamente, ontológicamente, sobre la naturaleza misma del dinero. ¿Qué es esto que pretende ser la base de nuestra sociedad? El dinero es mentiroso por naturaleza. Es una representación de mucha vida, que no puede ser representada. El dinero es peligroso, se convi...
Alteraciones hepáticas inducidas por la nutrición parenteral
J Salas Salvado; A Recaséns Garica
1993-01-01
Liver disorders induced by parenteral nutrition Alteraciones hepáticas inducidas por la nutrición parenteral Liver disorders induced by parenteral nutrition Alteraciones hepáticas inducidas por la nutrición parenteral
Úlceras por presión causadas por dispositivos clínicos
Iglesias Ruisánchez, Sandra
2017-01-01
Las úlceras por presión (UPP) son lesiones comunes en los pacientes hospitalizados, especialmente en las unidades de cuidados intensivos (UCI). Los enfermos críticos tienen un riesgo elevado de desarrollar UPP, debido principalmente a la limitación de la movilidad, disminuyendo su capacidad para cambiar activamente su posición en la cama o asiento. Además, el efecto de fármacos anestésicos y sedantes, puede causar una pérdida de la percepción sensorial cutánea. Los diferentes dispositivos clí...
Directory of Open Access Journals (Sweden)
Adriana Bessa Fernandes Medeiros
2009-03-01
Full Text Available A úlcera por pressão ainda é considerada um problema grave, especialmente em pessoas idosas e nas situações de adoecimento crônico-degenerativo. O objetivo do estudo consistiu em identificar as produções bibliográficas sobre ações de prevenção e tratamento realizadas por enfermeiros publicadas no período de 1999 a 2004, descrevendo o conhecimento produzido na temática. Trata-se de levantamento bibliográfico descritivo de periódicos de enfermagem indexados na LILACS e MEDLINE, acerca da temática no período de 1999 a 2004. A coleta de dados ocorreu entre os meses de maio a junho de 2005. Procedeu-se o exame do material que compreendeu leitura exaustiva, o que proporcionou a identificação de três aspectos estudados: prevenção das úlceras por pressão, tratamento das úlceras por pressão e cuidados de enfermagem às úlceras por pressão. Concluiu-se ainda a necessidade de pesquisas envolvendo a atuação do enfermeiro na avaliação clínica do cliente e no desenvolvimento de programas de prevenção sistematizados.La úlcera por presión, es todavía considerado un problema grave, especialmente en personas ancianas y en las situaciones de enfermedades crónicas degenerativas. El objetivo del estudio consistió en identificar las producciones bibliográficas sobre las acciones de prevención y tratamiento realizadas por enfermeros y publicadas en el período de 1999 a 2004, describiendo el conocimiento producido sobre el tema. Se trata de levantamiento bibliográfico descriptivo de periódicos de enfermería indexados en el LILACS y MEDLINE, acerca de la temática, en el período de 1999 a 2004. La recolección de datos se realizó entre los meses de mayo a junio de 2005. Se procedió a examinar el material con una lectura exhaustiva, lo que proporcionó la identificación de tres aspectos estudiados: prevención de las úlceras por presión, tratamiento de las úlceras por presión y cuidados de enfermería de las
Intoxicação por monofluoroacetato em animais
Directory of Open Access Journals (Sweden)
Vivian Assunção Nogueira
2011-10-01
Full Text Available O monofluoroacetato (MF ou ácido monofluoroacético é utilizado na Austrália e Nova Zelândia no controle populacional de mamíferos nativos ou exóticos. O uso desse composto é proibido no Brasil, devido ao risco de intoxicação de seres humanos e de animais, uma vez que a substância permanece estável por décadas. No Brasil casos recentes de intoxicação criminosa ou acidental têm sido registrados. MF foi identificado em diversas plantas tóxicas, cuja ingestão determina "morte súbita"; de bovinos na África do Sul, Austrália e no Brasil. O modo de ação dessa substância baseia-se na formação do fluorocitrato, seu metabólito ativo, que bloqueia competitivamente a aconitase e o ciclo de Krebs, o que reduz produção de ATP. As espécies animais têm sido classificadas nas quatro Categorias em função do efeito provocado por MF: (I no coração, (II no sistema nervoso central (III sobre o coração e sistema nervoso central ou (IV com sintomatologia atípica. Neste trabalho, apresenta-se uma revisão crítica atualizada sobre essa substância. O diagnóstico da intoxicação por MF é realizado pelo histórico de ingestão do tóxico, pelos achados clínicos e confirmado por exame toxicológico. Uma forma peculiar de degeneração hidrópico-vacuolar das células epiteliais dos túbulos uriníferos contorcidos distais tem sido considerada como característica dessa intoxicação em algumas espécies. O tratamento da intoxicação por MF é um desafio, pois ainda não se conhece um agente capaz de reverte-la de maneira eficaz; o desfecho geralmente é fatal
positivismo por su reduccionismo epistemológico
Directory of Open Access Journals (Sweden)
Ignacio M. Ibarzábal
2007-01-01
Full Text Available A lo largo de la historia humana puede observarse la constante oscilación entre diversas teorías científicas. Esto puede demostrarse, por ejemplo, a partir de una reflexión sobre la evolución de las ideas filosóficas desde fines de la edad Media hasta la actualidad. este fenómeno no hace más que poner de relieve cierta inseguridad connatural al hombre, que genera la opción por soluciones simplistas, y puras, lo que culmina en muchos casos en una aproximación reduccionista a la realidad. El problema científico que plantea el reduccionismo epistemológico es que éste, al desentenderse de la realidad existencial del hombre, es incapaz de darle respuestas satisfactorias para resolver conflictos. Este inconveniente lo sufre el positivismo jurídico así como también lo ha padecido el iusnaturalismo ingenuo, por su imposibilidad de resolver conflictos jurídicos reales; y esto, a causa de su pretendida aproximación avalorativa que da lugar a dos especies de reduccionismos: el que desconoce tajantemente las valoraciones, y aquél que, reconociéndolas, escoge de manera arbitraria los valores objeto de su conocimiento.
Sea urchin granuloma Granulomas por ouriços-do-mar
Directory of Open Access Journals (Sweden)
André Luiz Rossetto
2006-10-01
Full Text Available Injuries caused by venomous and poisonous aquatic animals may provoke important morbidity in humans. The phylum Echinoderma include more than 6000 species of starfish, sea urchins, sand dollars, and sea cucumbers some of which have been found responsible for injuries to humans. Initial injuries by sea urchins are associated with trauma and envenomation, but later effects can be observed. Sea urchin granuloma is a chronic granulomatous skin disease caused by frequent and successive penetration of sea urchin spines which have not been removed from wounds. The authors report a typical case of sea urchin granuloma in a fisherman and its therapeutic implications.Os acidentes por animais aquáticos traumatizantes e venenosos podem provocar morbidez importante em humanos. Equinodermos marinhos incluem mais de 6000 espécies de estrelas-do-mar, ouriços-do-mar, "bolachas-de-praia" e pepinos-do-mar. Vários equinodermos têm sido responsabilizados por acidentes em humanos. Granulomas por ouriço-do-mar são lesões de caráter granulomatoso, crônicas, causada por acidentes com espículas de ouriço-do-mar. Os autores relatam um caso típico de granulomas por ouriço-do-mar ocorrido em um pescador e enfatizam as implicações terapêuticas aplicadas.
Indultos concedidos por la Cámara de Castilla en tiempos de los Austrias
Directory of Open Access Journals (Sweden)
José Luis de las HERAS SANTOS
2009-12-01
Full Text Available Maquiavelo aconsejaba a los príncipes que se reservaran para sí la disposición de las materias de gracia. Este principio nunca fue olvidado por los reyes castellanos que consideraron el derecho de perdonar como una regalía. A lo largo del Antiguo Régimen se concedieron perdones reales por motivos diversos: políticos, religiosos, acontecimientos cortesanos, triunfos militares de la monarquía, o merced especial que el soberano deseó hacer a algún subdito. Por el número de afectados pueden clasificarse en generales, si absuelven a un colectivo de reos, o particulares, cuando el agraciado es uno solo. Los generales se regulaban por cédula específica que el rey despachaba al efecto. Su cumplimiento era vigilado por comisiones formadas por miembros de la Cámara, y los aspirantes a sus beneficios no necesitaban presentar solicitud personal ante ningún consejo regio, sino que siendo el caso de los incluidos en la cédula, las justicias de la causa se encargaban de su ejecución. Por está razón este tipo de indultos no han dejado huella en los archivos centrales, salvo las cédulas de concesión. Por el contrario, los individuales eran despachados por la Cámara en nombre del rey después de estudiar los autos procesales y han dejado en los archivos de la corona miles de testimonios. Estos van a ser el objeto de nuestro estudio.
Directory of Open Access Journals (Sweden)
Pablo Aldaz
2011-01-01
Full Text Available Fundamento: En verano de 2009 se registró en Navarra una onda de gripe A (H1N1 2009. Evaluar su repercusión en consultas de atención primaria con diagnóstico diferente al de gripe. Métodos: Estudiamos las consultas en atención primaria del Servicio Navarro de Salud desde el 21 de junio y al 21 de septiembre de 2009 con diagnósticos de gripe (Clasificación Internacional de Atención Primaria, código R80, síndrome febril (código A03, infección respiratoria aguda de vías altas (código R74 y bronquitis aguda (código R78, y las comparamos con las registradas en el mismo periodo en los tres años previos. Resultados: En verano de 2009 se notificaron 3417 casos de síndrome gripal (5,5 por 1.000 habitantes. Entre las semanas 27 y 31 se produjo un brote de gripe, con más de la mitad (87/160 de los frotis de pacientes con síndrome gripal positivos para el virus (H1N1 2009 sin detectarse otros tipos de virus gripal. Coincidiendo con la onda de síndromes gripales observamos aumentos de consultas por síndrome febril e infección respiratoria de vías altas. En comparación con la media de los tres años anteriores, en el verano del 2009 se produjo un incremento del 44! en consultas por síndrome febril (de 3,6 a 5,3 por 1000: p<0,001, del 6! en consultas por infección de vías altas (de 13,2 a 14,1 por 1000; p<0,001 y del 8! en consultas por bronquitis aguda (de 6,3 a 6,9 por 1000; p=0,003. Estos diagnósticos supusieron 3,2 consultas adicionales por 1.000 habitantes atribuibles a la gripe, es decir, un 58! de consultas adicionales. Conclusiones: La gripe se acompaña de aumento en el número de consultas por síndrome febril y por infección respiratoria de vías altas.
Examenes pulmonares por el método de Abreu: sus resultados
Directory of Open Access Journals (Sweden)
Alfonso Reyes
1950-02-01
definitiva en 1936. Posteriormente el doctor Hanker aplica la Abrengrafía al examen en serio de colectividades. Entre nosotros, fue el doctor Omar Benavides en 1940 quien presentó su trabajo de tesis sobre las primeras abreugrafías tomadas en un aparato ideado por él. En Bogotá, se inició la campaña por este sistema en enero de 1947 con la fundación del Centro Epidemiológico No 1, dirigido por el doctor Antonio Acosta Pinzón.
Micetoma pulmonar por Scedosporium sp, reporte de dos casos
Directory of Open Access Journals (Sweden)
José G. Somocurcio
2009-07-01
Full Text Available Se reporta los dos primeros casos de micetoma pulmonar por Scedosporium sp, en el Perú, tratados quirúrgicamente en el Hospital Nacional Hipólito Unanue. Se practicó resección pulmonar debido a micetoma pulmonar de donde se tomó muestras que fueron enviadas a microbiología y anatomía patológica para cultivo y estudio histopatológico. Se identificó el moho Scedosporium sp en dos pacientes con secuelas cavitarias por tuberculosis, quienes presentaron tos y hemoptisis de dos meses y tres años de evolución, respectivamente. Radiológicamente las cavidades estaban ocupadas por una "bola fúngica". La histopatología indicó presencia de abundantes hifas, indistinguibles de las de Aspergillus sp, mientras que la inmunodifusión para Aspergillus fue negativa.
Bacterial genomic adaptation and response to metals
International Nuclear Information System (INIS)
Van Houdt, R.
2009-01-01
The beta-proteobacterium Cupriavidus metallidurans CH34 (formerly Ralstonia metallidurans) has been intensively studied since 1976 in SCK-CEN and VITO, for its adaptation capacity to survive in harsh (mostly industrial) environments, to overcome acute environmental stresses, for its resistance to a variety of heavy metals and for applications in environmental biotechnology. Recently, CH34 has become a model bacterium to study the effect of spaceflight conditions in several space flight experiments conducted by SCK-CEN (e.g. MESSAGE, BASE). Furthermore, Cupriavidus and Ralstonia species are isolated from the floor, air and surfaces of spacecraft assembly rooms; were found prior-to-flight on surfaces of space robots such as the Mars Odyssey Orbiter and even in-flight in ISS cooling water and Shuttle drinking water, vindicating its role as model bacterium in space research. In addition, Ralstonia species are also the causative agent of nosocomial infections and are among the unusual species recovered from cystic fibrosis (CF) patients. The genomic organization of Cuprivavidus metallidurans CH34 was studied in-depth to identify the genetic and regulatory structures involved in the resistance to heavy metals
GRAVIDADE DE INTOXICAÇÕES POR SANEANTES CLANDESTINOS
Directory of Open Access Journals (Sweden)
Jessica Adrielle Teixeira Santos
2011-01-01
Full Text Available El presente estudio tuvo como objetivo analizar las intoxicaciones por saneantes comercializados clandestinamente, reportadas en el Centro de Control de Intoxicaciones del Hospital Universitario Regional de Maringá. Es un estudio cuantitativo, con análisis retrospectivo de registros epidemiológicos de personas intoxicadas por estos agentes, en el período de enero de 2005 a diciembre de 2009. De los 118 casos reportados, la mayoría (74-62,7% se produjeron en varones, 105 (88,9% necesitaron de asistencia en unidades de atención de emergencia y hospitalización de alta complejidad, en 14 casos (11,8% requirieron de Cuidados Intensivos, y se reportaron cinco óbitos, todos por intoxicación intencional. Los resultados demuestran la gravedad y la letalidad de este tipo de intoxicación, sugieren la necesidad de medidas urgentes de fiscalización y control de la Vigilancia Sanitaria, así como de medidas para la educación de los consumidores, haciendo hincapié en el papel educativo de la Enfermería
Potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae) is a key pest of potato (Solanum tuberosum L., Solanales: Solanaceae) and a vector of "Candidatus Liberibacter solanacearum," the pathogen associated with zebra chip disease. In addition to its presence on cultivated crops, the p...
Por uma estrada do M' Boi Mirim sustentável
Directory of Open Access Journals (Sweden)
Carlos Henrique Santos de Oliveira
2015-10-01
Full Text Available Este artigo trata de avaliar importante via de transporte situada na zona sul da cidade de São Paulo, analisando quais fatores dificultam a circulação de bens e pessoas no espaço urbano, bem como a dificuldade de promover a mobilidade urbana de acordo com os princípios de sustentabilidade, por meio de uma pesquisa qualitativa, exploratória e bibliográfica, com base em um estudo de caso realizado na Estrada do M’ Boi Mirim. Os instrumentos de coleta de dados utilizados foram a observação pessoal, bem como pesquisas em artigos científicos, dissertações e teses relacionadas ao tema. Apesar de essa questão estar sendo amplamente discutida por diversos setores da sociedade, notam-se poucas soluções práticas, haja vista, o crescente uso de transportes individuais motorizados, muitos acidentes nas vias e por muitas vezes, pouca infraestrutura, bem como a falta integração das regiões por meio das vias existentes, principalmente em áreas distantes do centro das cidades.
Algunos aspectos relacionados con las enfermedades tropicales transmitidas por moluscos
Directory of Open Access Journals (Sweden)
A. Mijail Pérez
1999-12-01
Full Text Available Muchas especies de moluscos son hospedantes de diversos parásitos que provocan infecciones muy serias e incluso mortales en seres humanos y ganado. La esquistosomiasis extendida por 74 países, infecta a unos 200 millones de personas y está en segundo lugar, después de la malaria, como causa de la mortalidad humana originada por parásitos. La infección es causada por un platelminto que se desarrolla en caracoles de agua dulce y que desde el agua puede penetrar en la piel de un ser humano y desarrollarse dentro de sus órganos, produciendo distintos grados de infección, hasta provocar la muerte. Distintas especies de esos caracoles están extendidas por Centro América. El cólera, otra enfermedad que también es mortal, se ha encontrado en moluscos bivalvos comestibles colectados en el Golfo de Nicoya, que bordea Nicaragua y Costa Rica Estas epidemias se pueden combatir con diversos métodos de control de los caracoles hospedantes de parásitos.
Fístula vesicovaginal por litíase: relato de caso
Directory of Open Access Journals (Sweden)
Chambô Filho Antônio
2003-01-01
Full Text Available As fístulas de etiologia traumática são raras, sobretudo as intrínsecas por litíase vesical. O manejo dessas fístulas tem controvérsias no que diz respeito à técnica cirúrgica ideal. Uma variedade de tratamentos tem sido descrita, incluindo reparação cirúrgica por vias transvaginal e transabdominal. Os autores relatam o caso de uma paciente com queixa de perda urinária contínua com evolução de seis meses, sendo identificado ao exame especular orifício fistuloso no terço médio da parede anterior da vagina, por onde se exteriorizava urina. Nesta topografia, identificava-se, durante o toque bimanual, estrutura de consistência pétrea. A suspeita de litíase vesical foi confirmada pela radiografia de pelve. O tratamento cirúrgico se deu em dois tempos, com exérese do cálculo vesical e posterior correção da fístula por via vaginal.
Agente topológico de aprendizado por reforço
Arthur Plínio de Souza Braga
2004-01-01
Os métodos de Aprendizagem por Reforço (AR) se mostram adequados para problemas de tomadas de decisões em diversos domínios por sua estrutura flexível e adaptável. Apesar de promissores, os métodos AR frequentemente tem seu campo de atuação prático restrito a problemas com espaço de estados de pequeno ou médio porte devido em muito à forma com que realizam a estimativa da função de avaliação. Nesta tese, uma nova abordagem de AR, denominada de Agente Topológico de Aprendizagem por Reforço (AT...
Detección de anticuerpos antiplasmodium por ELISA en donantes de sangre
Directory of Open Access Journals (Sweden)
Patricia Olaya de Morales
1982-06-01
Full Text Available La malaria, una enfermedad transmitida por mosquitos del genero anopheles, puede ser inducida a través de transfusiones de sangre infectada con alguna de las especies de Plasmodium que afectan al hombre. Con el objeto de determinar el riesgo potencial de infección inducida por transfusiones, se analizaron durante 9 meses y mediante la técnica de E.L.I.S.A., las muestras de suero tomadas a los donantes de sangre del Hospital Militar Central de Bogotá. El 8.6 por mil de las 3114 muestras analizadas, resultaron positivas para anticuerpos antimaláricos y durante el tiempo del estudio fueron detectados 3 casos de malaria inducida por transfusiones.
Dano cavitacional em revestimentos depositados por aspersão termica a chama
Paulo Villani Marques
1996-01-01
Resumo: Quantias elevadas são gastas anualmente na manutenção de turbinas hidráulicas usadas na geração de energia elétrica por causa do ataque cavitacional. Avaliou-se a aplicabilidade de revestimentos metálicos e cerâmicos depositados sobre aço carbono por aspersão térmica a chama na manutenção destes equipamentos em função de sua resistência à erosão por cavitação. Foram realizados ensaios de dureza, rugosidade, ensaio acelerado de cavitação induzida por vibração ultra-sônica, adesão (traç...
Nodulose por Metotrexato Methotrexate Induced Nodulosis
Directory of Open Access Journals (Sweden)
Fernanda Guidolin
2005-08-01
Full Text Available A nodulose por metotrexato (MTX é um dos efeitos colaterais pouco conhecidos do uso desse medicamento em doses baixas. Embora classicamente descrita em casos de artrite reumatóide, tem aparecido, também, em outras doenças reumáticas. Descreve-se aqui um caso de nodulose por MTX em uma paciente com artrite reumatóide soropositiva, que utilizava esse medicamento há um ano, com bom controle do processo articular. Segue-se uma breve revisão sobre o assunto.Methotrexate-induced nodulosis is a rare side effect of this drug when it is used in low doses. Although classically described in rheumatoid arthritis patients, it may also appear in other rheumatic disorders. We describe a seropositive rheumatoid arthritis patient who developed methotrexate-induced nodulosis after using this drug for a year, with good control of articular symptoms. This case presentation is followed by a brief revision on the subject.
Reacciones adversas por antiinflamatorios no esteroideos
Directory of Open Access Journals (Sweden)
Luisa Ivet Sánchez Ricardo
2011-03-01
Full Text Available Se realizó un estudio descriptivo y transversal en el Consultorio Médico de la Familia No. 28 perteneciente al Policlínico Universitario y Docente "Dr. Mario Muñoz Monroy" desde el 1ro. de junio al 31 de diciembre de 2008, con el objetivo de detectar las reacciones adversas más frecuentes provocadas por el consumo de antiinflamatorios no esteroideos. El universo estuvo constituido por 105 pacientes que asistieron a consulta en el tiempo de estudio y de estos se seleccionó una muestra de 60 pacientes, a quienes se les aplicó un cuestionario de preguntas donde se recogieron las variables de análisis. .Las mujeres resultaron las que más antiinflamatorios consumieron y en el rango de edades de 31-59 años. Las reacciones adversas que más se reportaron fueron la epigastralgia y la hipertensión arterial, así mismo se comprobó la automedicación en algunos pacientes.
Engorde de bagres (Rhamdia quelen) en sistema de cultivo intensivo por sexos separados
Comolli, J; Roux, J.P; Sánchez, S; Hernández, D
2013-01-01
El bagre sudamericano (ramdiá o jundiá) se caracteriza por rápido crecimiento en los primeros meses de vida e importante diferencia de desarrollo entre ambos sexos. La madurez sexual del macho es precoz, por lo cual la hembra alcanza un peso vivo 30% mayor que el del macho. El presente trabajo tuvo por objetivo analizar el engorde de especimenes de Rhamdia quelen separados por sexos en un sistema intensivo. Se llevaron a cabo tres tratamientos: TA- hembra, TB- mixto y TC- macho. El engorde se...
Coeficiente de fricción por curvatura no intencional en concreto postensado
Directory of Open Access Journals (Sweden)
Diego Ernesto Dueñas Puentes
2007-09-01
Full Text Available En el presente artículo se establece un coeficiente de fricción por curvatura no intencional (K para puentes de placa y vigas y puentes por voladizos sucesivos a partir de los registros de tensionamiento de algunos puentes postensados construidos en Colombia, el cual es inferior al empleado habitualmente en el diseño de puentes pos-tensados en el país y establecido por el Código Colombiano de Diseño Sísmico de Puentes (CCDSP publicado por el Instituto Nacional de Vías en 1995. Este estudio parte del hecho de que en algunas importantes obras se obtienen alargamientos de torones mayores a los estimados teóricamente, puentes de los cuales se dispone de registros de tensionamiento y de los que se deducen valores de coeficientes más cercanos a los indicados por las últimas ediciones de la Standard Specifications for Highway Bridges, publicada por American Association of State Highway and Transportation Officials “AASHTO”. En Colombia, el CCDSP, considera un coeficiente de fricción por curvatura no intencional (K para cables, con valores entre 0.0050 y 0.00066 m-1, dependiendo del material del que esté fabricado el ducto (acero galvanizado, sin galvanizar, metal brillante, valor superior al encontrado en este trabajo. En este artículo, en primer lugar, se realiza una breve descripción del efecto de fricción a lo largo de los cables, presentando los diferentes valores de coeficientes de fricción indicados en el CCDSP y en “AASHTO.”, en el diseño de puentes preesforzados. Se hace una corta descripción de cada uno de los puentes de los cuales se tienen registros de tensionamiento con el fin de identificar otras variables que intervienen en el proceso de ten-sionamiento como materiales, equipos y mano de obra, y posteriormente, a partir de la validación y tabulación de datos registrados en obra (registros en los cuales se controla la fuerza aplicada y el alargamiento de los torones, se efectuó la evaluación del coeficiente
Directory of Open Access Journals (Sweden)
Pablo Escovedo Helayel
2007-02-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: As técnicas de bloqueios nervosos guiados por ultra-som são baseadas na visualização direta das estruturas nervosas, da agulha de bloqueio e das estruturas anatômicas adjacentes. Desta maneira, é possível depositar a solução de anestésico local precisamente em torno dos nervos e acompanhar a sua dispersão em tempo real, obtendo-se, assim, um bloqueio mais eficaz, de menor latência, menor dependência de referências anatômicas, menor volume de solução anestésica e maior segurança. CONTEÚDO: O artigo revisa os aspectos relativos aos mecanismos físicos para formação de imagens, a anatomia ultra-sonográfica do neuroeixo e dos plexos braquial e lombossacral, os equipamentos e materiais empregados nos bloqueios, os ajustes do aparelho de ultra-som para melhorar as imagens, os planos de visualização das agulhas de bloqueio e as técnicas e o treinamento em bloqueios guiados por ultra-som. CONCLUSÕES: Os passos para se obter sucesso em anestesia regional incluem a identificação exata da posição dos nervos, a localização precisa da agulha, sem lesões nas estruturas adjacentes e, finalmente, a injeção cuidadosa de anestésico local junto aos nervos. Embora a neuroestimulação forneça grande auxílio na identificação dos nervos, esta não consegue, isoladamente, preencher todas essas exigências. Por isso, acredita-se que os bloqueios guiados por ultra-som serão a técnica de eleição para anestesia regional num futuro não muito distante.JUSTIFICATIVA Y OBJETIVOS: Las técnicas de bloqueos nerviosos guiados por ultrasonido se basan en la visualización directa de las estructuras nerviosas, de la aguja de bloqueo y de las estructuras anatómicas adyacentes. De esa manera, se puede depositar la solución de anestésico local precisamente en torno de los nervios y acompañar su dispersión en tiempo real, obteniéndose así, un bloqueo más eficaz, de menor latencia, menor dependencia de
Directory of Open Access Journals (Sweden)
C. P. Fernandez
Full Text Available Resumo Pós de Pb(Zr0,53Ti0,47O3 (PZT e Fe2CoO4 (FCO, foram sintetizados separadamente pelo método Pechini e misturados em ultrassom, nas proporções molares 80/20 e 50/50 (PZT/FCO. Os compósitos preparados foram prensados e submetidos à sinterização em forno convencional e sinterização ultrarrápida assistida por micro-ondas. A caracterização estrutural e microestrutural das amostras foram realizadas por difração de raios X e microscopia eletrônica de varredura, respectivamente. Medidas de constante dielétrica em função da temperatura, resistividade elétrica e coeficiente de acoplamento magnetoelétrico foram também realizadas. Os resultados evidenciaram que o método de mistura do PZT com a FCO por ultrassom foi rápido e eficiente, gerando, após sinterização, compósitos particulados com conectividade global (0-3 e distribuição uniforme de grãos da fase ferromagnética (FCO na matriz ferroelétrica (PZT. Da análise estrutural, verificou-se que a sinterização por micro-ondas propiciou um arranjo diferenciado no esquema de conectividade local na amostra (1-3 e (2-3, relacionada com a intensificação dos processos de difusão que ocorrem nesse tipo de sinterização principalmente em sistemas nanométricos. Pelos altos valores de resistividade obtidos, comprovou-se que a integridade das fases foi conservada nos dois métodos de sinterização, sendo mais eficiente na sinterização por micro-ondas, característica que garantiu o comportamento magnetoelétrico em todos os compósitos estudados neste trabalho. Os valores do campo Hmax foram dependentes da concentração da fase ferrita e da sinterização; para a composição 80/20 de 1,4 e 1,9 kOe, e para 50/50 de 3,5 e 3,0 kOe nas amostras sinterizadas por micro-ondas e convencionalmente, compatíveis com a literatura e que confirmaram a integridade das fases constituintes PZT e FCO.
Variaciones regionales de la mortalidad por homicidios en Jalisco, México
Directory of Open Access Journals (Sweden)
Vega-López María Guadalupe
2003-01-01
Full Text Available El presente estudio busca describir las variaciones regionales de la mortalidad por homicidios en el estado de Jalisco, México, en 1989-1991, 1994-1996 y 1999-2000, analizando a su vez el comportamiento de la tasa de homicidios según género y estratos de bienestar socioeconómico. A partir de la información sobre mortalidad generada por el Instituto Nacional de Estadística, Geografía y Informática, se calcularon tasas ajustadas por edad y género e índices de sobremortalidad masculina. Además, se calcularon razones de tasa y su intervalo de confianza (95%. Los resultados reflejan que la tasa de homicidios presenta una tendencia decreciente en los años 90; que existe un patrón regional de la mortalidad por homicidios, observándose las tasas más altas en regiones periféricas del estado consideradas entre las más pobres; que los municipios ubicados en el estrato de bienestar más bajo presentan un exceso de mortalidad por homicidios estadísticamente significativo, y que hay una evidente sobremortalidad masculina por esta causa. Aspectos como los antes descritos implican tareas y desafíos para la salud pública y para los organismos encargados de preservar la ley y el orden, entre ellos la necesidad de implementar políticas intersectoriales diferenciadas, que tomen en consideración las particularidades que rodean al homicidio y al crimen violento en Jalisco.
Analisis cualitativo asistido por computadora Computer-assisted qualitative analysis
Directory of Open Access Journals (Sweden)
César A. Cisneros Puebla
2003-01-01
Full Text Available Los objetivos de este ensayo son: por un lado, presentar una aproximación a la experiencia hispanoamericana en el Análisis Cualitativo Asistido por Computadora (ACAC al agrupar mediante un ejercicio de sistematización los trabajos realizados por diversos colegas provenientes de disciplinas afines. Aunque hubiese querido ser exhaustivo y minucioso, como cualquier intento de sistematización de experiencias, en este ejercicio son notables las ausencias y las omisiones. Introducir algunas reflexiones teóricas en torno al papel del ACAC en el desarrollo de la investigación cualitativa a partir de esa sistematización y con particular énfasis en la producción del dato es, por otro lado, objetivo central de esta primera aproximación.The aims of this article are: on the one hand, to present an approximation to the Hispano-American experience on Computer-Assisted Qualitative Data Analysis (CAQDAS, grouping as a systematization exercise the works carried out by several colleagues from related disciplines. Although attempting to be exhaustive and thorough - as in any attempt at systematizing experiences - this exercise presents clear lacks and omissions. On the other hand, to introduce some theoretical reflections about the role played by CAQDAS in the development of qualitative investigation after that systematization, with a specific focus on data generation.
Meningitis por Streptococcus suis
Geffner Sclarsky, D. E.; Moreno Muñoz, R.; Campillo Alpera, Mª.S.; Pardo Serrano, F.J.; Gómez Gómez, A.; Martínez-Lozano, Mª.D.
2001-01-01
La infección humana por Streptococcus suis (S. suis) es una zoonosis, con un riesgo ocupacional conocido y que suele presentarse como meningitis purulenta, que tiene baja mortalidad y frecuentes secuelas de hipoacusia y ataxia. Se han publicado menos de 150 casos humanos desde el informe original de hace 30 años. Hay una reconocida distribución geográfica viviendo la mayoría de los afectados en el norte de Europa y el sudeste Asiático. En España se han comunicado dos pacientes con enfermedad ...
Apendicitis por Paracoccidioides brasiliensis.
MUÑOZ URRIBARRI, Ana Beatriz; CHAPARRO DAMMERT, Eduardo; FERRUFINO LLACH, Juan Carlos; VASQUEZ FLORES, Luciola
2012-01-01
La paracoccidioidomicosis es la micosis más prevalente en Sudamérica. La forma aguda afecta el sistema fagocítico mononuclear de niños y personas inmunocomprometidas. El compromiso gastrointestinal es frecuente y su patogenia implica diseminación hematógena y linfática. La linfadenomegalia abdominal causa obstrucción intestinal y abdomen agudo. En este artículo damos a conocer el caso de un niño con compromiso gastrointestinal por apendicitis. Este es el primer caso reportado de apendicitis p...
Evaluación docente y aprendizaje por competencia de los estudiantes
Segovia Suller, Cirilo
2016-01-01
Métodos Estadísticos para la Investigación es una asignatura que genera un grado de dificultad en la enseñanza del docente y el aprendizaje del alumno. En el aula se investigó si existe una relación entre la evaluación docente y el aprendizaje por competencias de los estudiantes. El objetivo era determinar la relación entre la evaluación docente y el aprendizaje por competencias de los estudiantes, para luego formular la hipótesis: la evaluación docente se relaciona con el aprendizaje por com...
Fiebre Tifoidea Diagnóstico por pruebas inmunoenzimáticas: Elisa
Directory of Open Access Journals (Sweden)
Miguel Guzmán
1981-06-01
Full Text Available Este trabajo describe el desarrollo y normalización de una técnica inmunoenzimática para el diagnóstico indirecto de la Fiebre Tifoidea. El método permite un análisis simple y objetivo de los resultados. La reacción enzimática es proporcional a la concentración de anticuerpos en el suero contra el antígeno somático-0, por tanto, el método es cuantitativo. Por lo demás, la técnica tiene un alto grado de especificidad para Salmonella typhi, ya que los sueros de pacientes con Salmonelosis causada por Salmonella enteritidis serotipos paratyphi A, B y typhimurium dieron resultados negativos, en forma similar a los presentados por el grupo control antes de la vacunación específica. Los resultados obtenidos con esta técnica permitieron definir el nivel de anticuerpos que puede presentar una población control supuestamente sana frente a los niveles inducidos por la enfermedad. Los resultados postvacunales en el grupo control mostraron títulos sorprendentemente bajos; un análisis de este fenómeno se presentó en forma amplia. Igualmente se proponen futuras investigaciones sobre este campo.
HOSPITALIZACIONES EVITABLES POR INSUFICIENCIA CARDÍACA. VARIABLES RELACIONADAS
Directory of Open Access Journals (Sweden)
Victoria Ruiz-Romero
2016-01-01
Full Text Available Los ingresos hospitalarios evitables por insuficiencia cardiaca (IC son un problema para los sistemas de salud, consumen recursos, generan morbilidades adicionales y alta mortalidad. El objetivo del estudio fue conocer los factores de riesgo de las personas hospitalizadas por insuficiencia cardiaca. Métodos: Se constituyó un grupo con médicos de atención primaria y hospitalaria. Se realizaron auditorías de las historias clínicas de 110 pacien - tes de la poblacion de la comarca del Aljarafe con mayores tasas de ingreso por insuficiencia cardiaca y estudio descriptivo y comparativo con T-Student y U-Mann Whitney para cuantitativas y λ 2 y Fisher para cualitativas. Resultados: Los pacientes que ingresaron por IC tenían 78,1 años (SD: 9,56 de media; 73 (66,4% fueron mujeres; un Índice Barthel de 45,0 de media; un 53,5% con grado III de la NYHA y 17 (15,5% institucionaliza - dos. El 70% presentaban 3-5 comorbilidades, hipertensión (87,3%, dislipe - mia (60,0% diabetes (57,3%, enfermedad renal crónica (56,4%, anemia (53,2% o fibrilación auricular (52,7%. Fallecieron al ingreso 23 (20,9% pacientes. Conclusiones: Los ingresos se dieron en personas mayores con múl - tiples enfermedades (hipertensión, diabetes, EPOC, enfermedad renal y escasa capacidad para actividades básicas de la vida diaria. El fallecimiento hospitalario se asoció a edad avanzada, ser mujer, menor uso de betabloqueantes y la no inclusión del paciente en el proceso asistencial.
161. Necrosis por presión del septo de salida ventricular causado por dos implantes adyacentes
Directory of Open Access Journals (Sweden)
A. González Calle
2012-04-01
Conclusiones: Esta complicación ilustra que los tejidos entre dos dispositivos duros y con movimiento uno conrespecto al otro pueden desarrollar necrosis por presión y fricción y, consecuentemente, perforación. Probablemente, hubiera sido preferible sustituir el homoinjerto pulmonar con stent en el momento de la sustitución valvular aórtica.
Uso de contraceptivos por puérperas adolescentes
Directory of Open Access Journals (Sweden)
Fernanda Schulz da Rosa
2014-07-01
Full Text Available Objetivo: Indagar el uso de métodos contraceptivos por las puérperas adolescentes a fin de relacionar su (desuso con el embarazo en la adolescencia. Método: Estudio transversal, descriptivo, realizado por medio de un instrumento estructurado con 181 puérperas adolescentes que tuvieron sus partos en el hospital participante de la investigación. Los datos fueron recolectados en el período de diciembre de 2008 a diciembre de 2009. Resultados: El 64,1% de las puérperas usaba algún método contraceptivo antes del embarazo; los métodos más utilizados fueron el anticoncepcional oral (51% y el preservativo masculino (29%. Para el 75% de las adolescentes el embarazo fue planeado y justificado por el deseo y la voluntad propia de experimentar la maternidad. Conclusión: Considerando que casi la mitad de las adolescentes entrevistadas deseaba el embarazo, se deduce que investigar y discutir apenas el uso o no de los métodos contraceptivos no es adecuado. Es necesario profundizar las investigaciones acerca de los significados de ser madre en la adolescencia.
Extracción de sustancias asistida por ultrasonido (EUA
Directory of Open Access Journals (Sweden)
Rocío Azuola
2007-11-01
Full Text Available Compuestos presentes en los vegetales con propiedades funcionales o tecnológicas, han cobrado gran importancia en los mercados de alimentos, farmacéuticos y cosméticos. Se buscan métodos eficientes, económicos y favorables al ambiente para la extracción de estas sustancias. Se ha realizado un estudio bibliográfico de las publicaciones recientes sobre diferentes métodos de extracción y su comparación a las extracciones asistidas por ultrasonido (EAU con el fin de evaluar su eficacia y viabilidad industrial. Se ha encontrado que la EAU es más eficiente que los métodos de extracción tradicionales, y más económica y sencilla que los métodos de extracción no tradicionales como la extracción asistida por microondas, por lo cual se comprueba su viabilidad industrial.
Mortalidad por accidentes de tránsito en Bayamo, Cuba 2011
Directory of Open Access Journals (Sweden)
Arlines Piña-Tornés
Full Text Available Con el objetivo de describir la mortalidad por accidentes de tránsito en Bayamo, Cuba, en el año 2011 se realizó una revisión de los pacientes lesionados y fallecidos a causa de accidentes de tránsito, registrados en Hospital Carlos M. de Céspedes. Se atendieron en emergencias 1365 lesionados, predominando el grupo etario de 25 a 44 años con 372 pacientes (27,3%, y el sexo masculino con 1071 (78,5%. Fallecieron 46 personas, en su mayoría del mismo grupo de edad y de sexo masculino. Los traumatismos múltiples (52,6% y cráneofaciales (34,2% fueron las localizaciones predominantes. Se destacaron los atropellos por vehículo de motor con mortalidad del 26,3%. En conclusión, la mortalidad por accidentes de tránsito predomina en adultos jóvenes masculinos; cuyas consecuencias fatales son debido a traumatismos múltiples por atropellos.
Directory of Open Access Journals (Sweden)
Martín, O.
2006-10-01
Full Text Available An artificial neural network is proposed as a tool for predicting from three parameters (weld time, current intensity and electrode sort if the quality of a resistance spot weld reaches a certain level or not. The quality is determined by cross tension testing. The fact of reaching this quality level or not is the desired output that goes with each input of the artificial neural network during its supervised learning. The available data set is made up of input/desired output pairs and is split randomly into a training subset (to update synaptic weight values and a validation subset (to avoid overfitting phenomenon by means of cross validation.
Se propone una red neuronal artificial como herramienta para predecir, a partir de tres parámetros operativos (tiempo de soldadura, intensidad de corriente y tipo de electrodo, si la calidad de una unión soldada por resistencia por puntos alcanza o no un cierto nivel. El entrenamiento de la red neuronal conlleva que la calidad se determine previamente mediante ensayos de tracción en probetas en cruz. El hecho de alcanzar o no el citado nivel de calidad constituye la respuesta objetivo que acompaña a cada entrada de la red neuronal artificial durante su aprendizaje supervisado. El conjunto de datos disponible está formado por pares entrada/salida objetivo y se divide de forma aleatoria en un subconjunto de entrenamiento (para actualizar los valores de los pesos sinápticos y en un subconjunto de validación (para combatir el fenómeno de overfitting mediante validación cruzada.
Directory of Open Access Journals (Sweden)
Alexis Hugo Cantero Ronquillo
2012-03-01
Full Text Available En el tratamiento del cáncer de mama, además de la agresión quirúrgica, en ocasiones mutilante, seguida o precedida por las molestias inherentes a los tratamientos oncoespecíficos, a veces persisten "heridas", que aunque invisibles, no siempre cierran totalmente, y afectan durante mucho tiempo, o toda la vida, a un grupo importante de pacientes y familiares cercanos. El proyecto "Alas por la vida" propone nuevas alternativas en el tratamiento de la mujer con cáncer de mama, que puedan prepararla para una nueva etapa, y vivir con el estatus de enferma crónica, que no refleje invalidez en el desempeño de sus funciones, que alcance la recuperación de su equilibrio biopsicosocial, y, consecuentemente, el disfrute de una adecuada calidad de vida. Mediante intercambios entre sobrevivientes de la enfermedad, familiares y profesionales, charlas científicas, sesiones de preguntas y respuestas, reflexiones de operadas en su lucha contra el cáncer de mama y también de sus esposos, así como con actividades socioculturales, etc., se han logrado resultados muy positivos por este grupo, lo que se refleja en encuestas realizadas a tal efecto. El Grupo de Apoyo a Pacientes Mastectomizadas "Alas por la vida", ha resultado ser un instrumento muy útil para elevar la autoestima y mejorar la calidad de vida de las sobrevivientes, que a la vez ha fortalecido y humanizado nuestra lucha contra el cáncer de mama, y se han aglutinando crecientemente más seguidores en esta noble causa, por lo que recomendamos se organicen proyectos similares en todas las provincias del país.In the treatment of beast cancer besides the surgical aggression occasionally mutilating followed or precedes by the molecules inherent to specific oncologic treatments, sometimes the "wounds" persist that although invisibles, not always are totally closed involving for much time or for life to a significant group of patients and close relatives.The project "Alas por la Vida" proposes
Distribuição espacial da violência: mortalidade por causas externas em Salvador (Bahia, Brasil
Directory of Open Access Journals (Sweden)
Paim Jairnilson Silva
1999-01-01
Full Text Available O presente estudo teve como objetivo descrever a distribuição da mortalidade por causas externas no espaço urbano de Salvador, Estado da Bahia, Brasil, em 1991. Foram calculados indicadores de mortalidade por causas externas e por tipos específicos de violência. A mortalidade proporcional por causas externas foi de 15% e a taxa de mortalidade correspondeu a 78,0 óbitos por 100 000 habitantes. As taxas de mortalidade por homicídios e por acidentes de transporte foram de 32,2 e 21,8 por 100 000 habitantes, respectivamente. Os idosos apresentaram um maior risco de morte por causas externas, seguidos dos adultos jovens e adolescentes. No caso dos idosos, 38% das mortes foram por acidentes de transporte e 28%, por quedas. Em relação aos jovens, predominam os homicídios, especialmente no sexo masculino e na faixa etária de 15 a 29 anos. Constatou-se uma distribuição desigual da mortalidade por causas externas no espaço urbano, penalizando, especialmente no caso dos homicídios, as populações residentes em bairros pobres, com taxas superiores ao coeficiente médio de Salvador. É necessário desenvolver medidas de prevenção e controle, incluindo políticas públicas e ações programáticas de saúde, orientadas para o espaço social sujeito a maior risco de morte por causas externas.
Mastitis bovina causada por Staphylococcus coagulasa negativos
Bonetto, César C.
2014-01-01
El presente Trabajo de Tesis se desprende como una línea de investigación del grupo de la UNRC dedicado al estudio de la problemática de la mastitis bovina tanto en aspectos básicos como aplicados con estudios genéticos, epidemiológicos y de virulencia de los principales microorganismos involucrados en la mastitis bovina. Staphylococccus coagulasa negativo (SCN) es un grupo bacteriano formado por varias especies que por lo general eran considerados flora oportunista de la piel y age...
La curiosidad por la naturaleza
Directory of Open Access Journals (Sweden)
José Vicente Rodríguez
2016-07-01
Full Text Available Esta actitud es un instrumento estratégico para estimular procesos de desarrollo realmente sostenibles, donde se aproveche la admiración que nos embarga al conocer y apreciar lo que nos rodea para responsablemente utilizar y conservar nuestros recursos naturales. Con esta reflexión deseo resaltar esa motivación de escudriñar lo desconocido, que fue también la virtud que propició el desarrollo de la personalidad de Francisco José de Caldas y Tenorio, uno de nuestros primeros y connotados sabios colombianos, y en cuyo honor se constituyó la revista de divulgación científica más importante del país, que en estos momentos cumple 76 años de existencia. Caldas tuvo curiosidad por todo lo que existía en su entorno; inicialmente en su natal Popayán, donde se maravilló por lo natural, lo que lo motivó y llevó más allá de su tierra a formar parte de la mayor empresa de exploración científica adelantada en ese entonces en territorio americano: la primera Expedición Botánica al nuevo Reino de Granada, de José Celestino Mutis.
Directory of Open Access Journals (Sweden)
Leonardo Henrique Cunha Ferraro
2014-01-01
Full Text Available Justificativa e objetivo: o uso do ultrassom para acompanhar o correto posicionamento da agulha e a dispersão do anestésico local permitiu a redução do volume de anestésico local necessário para o bloqueio de nervos periféricos. Existem poucos trabalhos sobre o volume mínimo efetivo de anestésico local para o bloqueio do plexo braquial via axilar (BPVA. Este estudo foi conduzido com o objetivo de determinar o volume mínimo efetivo (VE90 de bupivacaína 0,5% comadrenalina (1:200.000 para o BPVA guiado por ultrassom. Método: o método up-and-down proposto por Massey e Dixon foi usado para o cálculo do volume mínimo efetivo. A dose inicial foi de 5 ml por nervo (radial, mediano, ulnar e musculocutâneo. No caso de falha do bloqueio, o volume era aumentado em 0,5 mL por nervo. O sucesso do bloqueio resultava na diminuição do volume em 0,5 mL por nervo para o paciente subsequente. O sucesso do bloqueio foi definido como bloqueio da função motora ≤ 2 segundo a escala de Bromage modificada, ausência de sensibilidade térmica e de resposta ao pinprick. Foi definido como critério para término do estudo a obtenção de cinco casos de falha seguidos de casos de sucesso. Resultados: foram incluídos 19 pacientes no estudo. O volume mínimo efetivo (VE90 de bupi-vacaína 0,5% com 1:200.000 de adrenalina foi de 1,56 ml (IC 95% 0,99-3,5 por nervo. Conclusão: este trabalho corrobora alguns estudos que mostram que é possível obter anestesia cirúrgica com baixos volumes de anestésico local para bloqueios de nervo periférico guiados por ultrassom.
Producción de energía por combustión de basuras en bogotá
Morales Gilede, Abel
2010-01-01
Este estudio tiene por objeto hacer un avalúo de la posibilidad de producir energía por medio de la incineración de las basuras provenientes de la ciudad de Bogotá. El estudio se desarrolló con base en la información existente. Elaborada especialmente por EDIS. Por contratos realizados por esta entidad con diferentes compañías y con la colaboración del Instituto de Investigaciones Tecnológicas y complementada por los Laboratorios de la Universidad Nacional. Con base en estos estudios se obtuv...
Directory of Open Access Journals (Sweden)
Tzu-Chao Lin
2018-04-01
Full Text Available Background/Purpose: Bloodstream infection is a leading cause of mortality among burn patients. This study aimed to evaluate the risk factors, causative pathogens, and the relationship between bloodstream infections and other infections among burn patients from the Formosa Fun Coast Dust Explosion. Methods: This retrospective study evaluated the demographic and clinical characteristics, infection types, causative pathogen(s, and isolates' antibiotic susceptibilities from patients who were hospitalized between June 27 and September 31, 2015. Results: Fifty-eight patients were admitted during the study period (36 males, mean age: 22.6 years. The mean burned total body surface area (TBSA was 40% for all patients. Eighteen (31% patients with mean TBSA of 80% had 66 episodes of bloodstream infections caused by 92 isolates. Twelve (18.2% episodes of bloodstream infections were polymicrobial. Acinetobacter baumannii (19, 20.7%, Ralstonia pickettii (17, 18.5%, and Chryseobacterium meningosepticum (13, 14.1% were the most common pathogens causing bloodstream infections. A high concordance rate of wound cultures with blood cultures was seen in Staphylococcus aureus (3, 75% and C. meningosepticum (8, 61.5% infections. However, no Ralstonia isolate was found in burn wounds of patients with Ralstonia bacteremia. A high concordance rate of central venous catheter cultures with blood cultures was noted in Ralstonia mannitolilytica (5, 62.5% and Chryseobacterium indologenes (3, 60% infections. Approximately 21.1% of A. baumannii strains were resistant to carbapenem. All S. aureus isolates were susceptible to methicillin. Conclusions: Waterborne bacteria should be considered in patients of burns with possible water contact. Empirical broad-spectrum antibiotics should be considered for patients who were hospitalized for severe sepsis, or septic shock with a large burn. Antibiotic treatment should be administered based on the specific pathogens and their detection
Lin, Tzu-Chao; Wu, Rui-Xin; Chiu, Chih-Chien; Yang, Ya-Sung; Lee, Yi; Lin, Jung-Chung; Chang, Feng-Yee
2018-04-01
Bloodstream infection is a leading cause of mortality among burn patients. This study aimed to evaluate the risk factors, causative pathogens, and the relationship between bloodstream infections and other infections among burn patients from the Formosa Fun Coast Dust Explosion. This retrospective study evaluated the demographic and clinical characteristics, infection types, causative pathogen(s), and isolates' antibiotic susceptibilities from patients who were hospitalized between June 27 and September 31, 2015. Fifty-eight patients were admitted during the study period (36 males, mean age: 22.6 years). The mean burned total body surface area (TBSA) was 40% for all patients. Eighteen (31%) patients with mean TBSA of 80% had 66 episodes of bloodstream infections caused by 92 isolates. Twelve (18.2%) episodes of bloodstream infections were polymicrobial. Acinetobacter baumannii (19, 20.7%), Ralstonia pickettii (17, 18.5%), and Chryseobacterium meningosepticum (13, 14.1%) were the most common pathogens causing bloodstream infections. A high concordance rate of wound cultures with blood cultures was seen in Staphylococcus aureus (3, 75%) and C. meningosepticum (8, 61.5%) infections. However, no Ralstonia isolate was found in burn wounds of patients with Ralstonia bacteremia. A high concordance rate of central venous catheter cultures with blood cultures was noted in Ralstonia mannitolilytica (5, 62.5%) and Chryseobacterium indologenes (3, 60%) infections. Approximately 21.1% of A. baumannii strains were resistant to carbapenem. All S. aureus isolates were susceptible to methicillin. Waterborne bacteria should be considered in patients of burns with possible water contact. Empirical broad-spectrum antibiotics should be considered for patients who were hospitalized for severe sepsis, or septic shock with a large burn. Antibiotic treatment should be administered based on the specific pathogens and their detection points. Copyright © 2017. Published by Elsevier B.V.
A INFLUÊNCIA DO AMBIENTE DE VAREJO NAS COMPRAS POR IMPULSO EM AEROPORTOS
Directory of Open Access Journals (Sweden)
Jorge Brantes Ferreira
2015-10-01
Full Text Available O fluxo de passageiros em aeroportos comerciais internacionais cresce a cada ano. Mais passageiros representam mais consumidores em fluxo e mais negócios. As condições particulares dos aeroportos criam experiências de varejo únicas, com evidências de comportamento de compra por impulso. Este estudo avalia a importância do ambiente de varejo e das emoções no comportamento de compra por impulso de consumidores em aeroportos aplicando uma versão do modelo de Mohan et al. (2013. Os dados foram coletados por meio de uma survey envolvendo 218 clientes do duty free shop de um grande aeroporto brasileiro e analisados por equações estruturais. Os resultados indicam que o ambiente de compras exerce grande influência sobre as emoções do consumidor e que estas têm forte influência sobre sua vontade de comprar por impulso.
EL MODELO LIBERAL COMO UN MODELO DEPREDADOR POR NATURALEZA
Directory of Open Access Journals (Sweden)
Julián Sabogal Tamayo
2003-07-01
Full Text Available Tuve la oportunidad de participar, por gentil invitación de la profesora Gertrudis Quijano, en el Diplomado de Geografía, lo cual me permitió acercarme un poco a quines estudian esta disciplina y me animó luego a participar en este Congreso, sobre una temática aparentemente lejana de mi formación de Economista. Mi contribución en esta conferencia se encamina al área del Medio Ambiente, que es uno de los componentes del Congreso que nos convoca. Espero hacerme entender y que mis reflexiones sean de alguna utilidad para ustedes, no necesariamente que estén de acuerdo conmigo, sino que mis planteamientos merezcan su atención y se puedan convertir para ustedes en objeto de discusión y ser involucrados en sus actividades académicas particulares. Creo que es necesario que los profesionales de las ciencias sociales, incluida la Geografía, vuelvan a pensar en los temas trascendentes y reversar la tendencia de los últimos lustros que invita solamente a preocuparse por temas llamados prácticos, por el día a día. Yo suelo preguntarles a mis estudiantes, cuando me expresan sus deseos de adquirir saberes prácticos, que les permitan ganarse la vida, y..., ¿quién pensará por ustedes? Recordemos al gran Oscar Wilde quien afirmaba que el medio seguro de no saber nada de la vida es intentar hacerse útil.
Directory of Open Access Journals (Sweden)
Vega García López
2009-12-01
Full Text Available Background: The retrospective investigation of a fatal sporadic Legionnaires' disease identified an unknown case of occupational hypersensitivity pneumonitis in a swine breeder. Methods: Chest high-resolution computed tomography, bronchoalveolar lavage, lung biopsy, arterial gasometry, pulmonary function tests and autopsy were performed. It was studied the presence of Legionella by serology and risk water samples were analyzed to identify the Legionella's source. Results: HP and Legionella pneumophila pneumonia diagnostics were confirmed. Lung fibrosis, a restrictive functional pattern, decreased diffusion, hypoxemia and bronchoalveolar lavage lymphocytosis were evidenced. Legionella´s source was detected in a shower and a positive serology in the patient. Autopsy verified pulmonary fibrosis and the septic shock leaded to Legionella causing the death. Conclusions: Chronic cough and pulmonary infiltrates in a farmer should suspect the presence of hypersensitivity pneumonitis. Later diagnosis carries a worse prognosis, the offending antigens exposure can't be avoided and fibrotic stage enhanced opportunity infection disease.Introducción: La investigación retrospectiva sobre un fallecimiento aislado por Legionelosis, hizo aflorar un caso de neumonitis por hipersensibilidad en un granjero cuidador de cerdos. Métodos: Se realizaron las siguientes pruebas: tomografía axial computerizada de alta resolución, lavado broncoalveolar, biopsia pulmonar, gasometría arterial, pruebas de función respiratoria y autopsia. Se estudió la presencia de Legionella por serología y se analizaron las muestras de fuentes de riesgo para identificar el foco de Legionella. Resultados: El estudio confirmó los diagnósticos de neumonitis por hipersensibilidad y neumonía por Legionella pneumophila. Las pruebas realizadas objetivaron la fibrosis pulmonar, un patrón respiratorio funcional restrictivo, un descenso de la difusión pulmonar, hipoxemia y la presencia de
Riesgos antrópicos generados por la actividad minera
Ana Violeta Argüello Mejía; Enriqueta Cantos Aguirre; Jorge Vitery Moya
2013-01-01
Las actividades productivas generan riesgos antrópicos [1] a mediano y largo plazo. La zona de estudio se ubica en las Parroquias de Pomasqui, San Antonio y Calacalí, donde se han producido riesgos debido a las actividades humanas, en este caso, por la explotación de las canteras para abastecer el mercado de la construcción del Distrito Metropolitano de Quito. La investigación propone determinar los riesgos antrópicos generados por la actividad minera. Los pobladores de la zona identifican qu...
Responsabilidad civil por accidentes en espectáculos taurinos
Caballero Moreno, María Araceli
2016-01-01
El trabajo versa sobre la responsabilidad civil aplicada al campo de los espectáculos taurinos, explicando el régimen de responsabilidad aplicable, regulado en el art. 1.902 de nuestro Código Civil, centrándose especialmente en quién debe asumir la responsabilidad en caso de producirse daños a los espectadores del festejo por los propios animales, si la propia víctima por haber llevado a cabo una conducta imprudente aplicando la teoría de la asunción del riesgo o los organizadores del festejo...
Invalidez por dor nas costas entre segurados da Previdência Social do Brasil
Directory of Open Access Journals (Sweden)
Ney Meziat Filho
2011-06-01
Full Text Available OBJETIVO: Descrever as aposentadorias por invalidez decorrente de dor nas costas. MÉTODOS: Estudo descritivo com dados do Sistema Único de Informações de Benefícios e dos Anuários Estatísticos da Previdência Social em 2007. A taxa de incidência de dor nas costas como causa das aposentadorias por invalidez foi calculada segundo as variáveis idade e sexo, nos estados. Os dias de trabalho perdidos por invalidez decorrente de dor nas costas foram calculados segundo atividade profissional. RESULTADOS: A dor nas costas idiopática foi a primeira causa de invalidez entre as aposentadorias previdenciárias e acidentárias. A maioria dos beneficiários residia em área urbana e era comerciário. A taxa de incidência de dor nas costas como causa das aposentadorias por invalidez no Brasil foi de 29,96 por 100.000 contribuintes. Esse valor foi mais elevado entre os homens e entre as pessoas mais velhas. Rondônia exibiu taxa quatro vezes superior ao esperado (RT = 4,05 e a segunda maior taxa, referente à Bahia, foi de aproximadamente duas vezes o esperado (RT = 2,07. Os comerciários foram responsáveis por 96,9% dos dias perdidos por invalidez. CONCLUSÕES: A dor nas costas foi uma importante causa de invalidez em 2007, sobretudo entre comerciários, com grandes diferenças entre os estados.
Fisiopatología molecular en la infección por Helicobacter pylori
Directory of Open Access Journals (Sweden)
Franklin Torres Jiménez
2016-01-01
Full Text Available La infección por Helicobacter pylori es el proceso de colonización bacteriana más común a nivel mundial. En 1994 la Agencia Internacional para la Investigación en Cáncer ( IARC catalogó al Helicobacter Pylori como un carcinógeno tipo I. La infección por esta bacteria incrementa el riesgo de padecer cáncer gástrico hasta 6 veces más que los individuos que no presentan la infección. Colombia tiene una prevalencia de infección por Helicobacter pylori del 86 % en adultos mayores de 20 años y del 80% en niños mayores de 8 años. La infección persistente y recidivante de la mucosa gástrica puede generar una respuesta inflamatoria, o procesos silentes, que en el peor de los casos puede progresar a un adenocarcinoma gástrico tipo difuso o intestinal. Existen múltiples factores que influyen en las consecuencias clínicas de la infección por Helicobacter pylori: en mención: predisposición genética del huésped, inmunorregulación genética del paciente infectado, factores ambientales y heterogeneidad de los factores de virulencia de las diversas cepas. Por lo anterior se infiere que las patolo - gías gástricas, en especial la gastritis y el adenocarcinoma, son padecimientos de etiología multifactorial que pueden originarse por diversas causas o condiciones. En esta revisión se analizarán los principales aspectos relacionados con la fisiopatología molecular en la infección por Helicobacter pylori , en particular tópicos correspondientes a los factores de virulencia.
Ansiedad percibida por los pacientes hospitalizados por quemaduras, en una Unidad de Quemados
Directory of Open Access Journals (Sweden)
M. Alcázar-Gabás
2014-06-01
Full Text Available El presente trabajo, pretende describir el estado de ansiedad que experimentan los pacientes ingresados en una Unidad de Quemados. Uno de los factores clave en los cuidados del paciente quemado es una buena atención psicológica. La realidad demuestra que es el profesional de enfermería quien observa los síntomas emocionales durante los primeros días de ingreso y trata de responder a esa demanda de cuidado. Pretendemos, a través de la medición del nivel de ansiedad que perciben los pacientes ingresados en la Unidad de Quemados elegida para nuestro estudio durante el primer semestre del año 2009, identificar a aquellos que estén en riesgo de padecer mayores niveles de ansiedad durante su hospitalización, para así poder establecer un plan de cuidados adaptado a las necesidades emocionales de cada uno. Los resultados obtenidos nos permiten concluir que los pacientes quemados ingresados en la Unidad de Quemados presentaron niveles elevados de ansiedad que son superiores entre la población femenina, así como en aquellos pacientes con lesiones de mayor extensión. Determinamos también que los pacientes ingresados por quemaduras en la Unidad de Quemados a estudio fueron mayoritariamente varones, de nacionalidad española, residentes en medio urbano con una media de edad de 50 años, siendo las quemaduras producidas por llama en accidentes domésticos la causa más frecuente.
Diferencias salariales por género en el departamento de Santander, Colombia
Directory of Open Access Journals (Sweden)
Alexandra Cortés Aguilar
2016-01-01
Full Text Available Este trabajo analiza los factores que influyen en el salario por hora y sus diferencias por género para el departamento de Santander durante los años 2012 a 2014. Específicamente, se explora si dicho diferencial obedece o no a un factor discriminatorio en el mercado de trabajo santandereano, utilizando los datos proporcionados por la Gran Encuesta Integrada de Hogares GEIH. Luego de presentar un análisis descriptivo del mercado laboral santandereano, se realizan estimaciones econométricas aplicando la metodología Blinder-Oaxaca para evidenciar la existencia de un componente discriminatorio. Los resultados indican que, para el total de la muestra en la región santandereana, entre un 25 % y 30 % de las diferencias salariales por género se asocian al componente discriminatorio no explicado.
Directory of Open Access Journals (Sweden)
Mario Ernesto
2003-07-01
Full Text Available En medio de la crisis de desempleo, pobreza y desigualdad que afronta Colombia, las pequeñas y medianas empresas se han convertido en una alternativa importante de generación de trabajo y valor agregado. Sin embargo, éstas deben aprovechar las ventajas que se otorgaron al país en el marco del ATPDEA, por medio del cual los Estados Unidos concedió preferencias arancelarias a más de cinco mil seiscientos productos que estuvieron vigentes durante más de diez años, y que luego, a partir de septiembre del 2002, se ampliaron en más de seiscientos productos. En este trabajo se presentan los rubros de la lista adicional, que presentan posibilidades de exportación a los Estados Unidos por parte de las PyMES de Bogotá y Cundinamarca.
Busato, Fábio André
2004-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica Este trabalho consistiu em avaliar comparativamente os principais parâmetros envolvidos no processo de moldagem por injeção, utilizando os termoplásticos PP, ABS e PA 6,6, em insertos fabricados pelo processo convencional em aço ABNT 1045 e pelo processo de ferramental rápido por estereolitografia. As cavidades selecionadas tiveram todas a mesma forma geomét...
Consecuencias del estrés oxidativo de la piel por radiaciones ultravioleta
Alvarez Fontanet, Ernesto
1995-01-01
Se ha avanzado en el conocimiento de la participación de las especies reactivas del oxígeno en la fisiopatología de muchas entidades y fenómenos patológicos. La piel es probablemente uno de los órganos que con mayor frecuencia sufre estrés oxidativo. Las radiaciones ultravioleta constituyen el principal factor generador de estrés oxidativo a este nivel. El fotoestrés oxidativo de la piel por radiaciones ultravioleta está mediado por diferentes mecanismos y favorecido por diversas circunstanci...
Diferencia salarial por género en ejecutivos peruanos en Lima Metropolitana
Gómez Flores, Robert Efrain; Huapaya Ames, Milagros del Carmen; Rojas Zegarra, Jhon Alexander; Salinas Valencia, Eder Velver
2017-01-01
vii, 106 h. : il. ; 30 cm En la presente investigación se describen cuáles son los factores que determinan la diferencia salarial por género en ejecutivos peruanos en Lima Metropolitana y su impacto en cada factor. Dicho estudio se realizó considerando los siguientes factores: (a) estereotipos por género, (b) prejuicios por género, (c) cultura organizacional y (d) educación. Asimismo, esta investigación se basó en un estudio cualitativo, con propósito descriptivo y explicativo,...