WorldWideScience

Sample records for play frog palace

  1. The Changxin Palace Lantern

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    The Changxin Palace Lantern wasexcavated from the tomb of Dou Wan,wife of the Zhongshanjing Prince LiuSheng, in Mancheng, Hebei Province in1968. It is 48 cm high and gilded all over.The support of the lantern is in the shapeof a pretty maid of honor in a kneelingposition. The maid’s dress specifically reflectsthe women’s dressing during the HanDynasty. Under the conceal of her sedateappearance is a trace of sadness. Holdingthe lantern with her left hand, her right

  2. Hotelli Palace**** renoveerimine = Renovation of the hotel Palace**** / Argo Vaikla

    Index Scriptorium Estoniae

    Vaikla, Argo, 1966-

    2015-01-01

    Hotell Palace Tallinnas Vabaduse väljak 3, valminud 2014. Hoone rekonstrueerimisprojekt Reet Valk (AB Reet Valk), sisearhitektid Katrin Vaikla, Argo Vaikla, Mari-Liis Süld, Riin Luuk. 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  3. Hotelli Palace**** renoveerimine = Renovation of the hotel Palace**** / Argo Vaikla

    Index Scriptorium Estoniae

    Vaikla, Argo, 1966-

    2015-01-01

    Hotell Palace Tallinnas Vabaduse väljak 3, valminud 2014. Hoone rekonstrueerimisprojekt Reet Valk (AB Reet Valk), sisearhitektid Katrin Vaikla, Argo Vaikla, Mari-Liis Süld, Riin Luuk. 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  4. Domestic arrangements at the Grand Master's Palace

    OpenAIRE

    de Piro, Nicholas; Office of the President of Malta

    2012-01-01

    A talk in the Rediscovering the Grandmaster's Palace series entitled: Domestic arrangements at the Grandmaster's Palace. This talk is organised by the Office of the President and delivered by Marquis Nicholas DePiro.

  5. TREASURES AT THE SHENYANG PALACE MUSEUM

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    Shenyang Palace Museum was established in 1926,and became a museum of history and art based on the former imperial palace.It houses treasures,palace articles and historical and cultural artifacts originally collected by the Qing Court.These include Ming

  6. The Acoustics of the Double Elliptical Vault of the Royal Palace of Caserta (Italy)

    OpenAIRE

    Umberto Berardi; Gino Iannace; Amelia Trematerra

    2017-01-01

    This work investigates the acoustic characteristics of the double elliptical vault, which overlooks the Grand Staircase of the Royal Palace of Caserta (Italy). The Royal Palace was built by the architect Luigi Vanvitelli in the Seventeenth Century and it is the largest royal building in Italy. The double elliptical vault presents a great scenography effect. Inside the vault, on the planking level, musicians used to play for the king and his guests when the royal procession, going up the grand...

  7. Potala Palace Reappears with Splendor and Spectacle

    Institute of Scientific and Technical Information of China (English)

    YangCongbiao

    2003-01-01

    The original Potala Palace, built in the 7th century for the meditation by King Songtsen Gampo, was ruined in natural disasters and human wars in ensuring centuries and little had remained. The current structure was rebuilt by the 5th Dalai Lama in the 17th century and became the Winter Palace of Dalai Lamas from that time.

  8. Lama Firemen at thePotala Palace

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    INSIDE the Potala Palace lives its own fire brigade, comprising 11 lamas.Constructed from earth and wood, the Potala Palace houses a large number of priceless cultural relics, as well as silks and satins, such as thangkas and prayer banners. Great importance is therefore attached to fire prevention. Protective clothing and advanced

  9. Evoliution of Castle Palaces in Lithuanian Renaissance

    Directory of Open Access Journals (Sweden)

    Inga Genytė

    2012-05-01

    Full Text Available The article author examines the problem of architecture history associated with the evolution of castle palaces in the current territory of Lithuania in the Lithuanian Renaissance period. The article is based on research papers thematically close to the publication, other literature and archive documents. After prehistory review of castle palaces at a theoretical level and clarifying the conditions for their occurrence, significant development trends of castle palaces during the Renaissance period in current Lithuania territory is revealed. At the beginning of the sixteenth century, Italian, Flemish and Flanders Renaissance reached Lithuania and merged with the local tradition; in the light of the Lithuanian Renaissance castle palaces reached their prosperity period in Lithuania. Castle palaces were distinguished by the diversity of their structural and architectural forms, relatively meaningful connection between function and artistic expression and a sustainable link with the components of environment.Article in Lithuanian

  10. Reuse of London’s crystal palaces

    Directory of Open Access Journals (Sweden)

    Lara Slivnik

    2003-01-01

    Full Text Available The architecture and use of both London crystal palaces, namely Crystal Palace at Sydenham and Alexandra Palace on Muswell Hill are described. They share some common characteristics. Built for two World Fairs, their iron structure was later disassembled, remodelled and consequently rebuilt slightly modified at another location. Both were located outside the city centre, at a central viewpoint within a vast park. Both hosted cultural, educational, and sports events and in the second half of the nineteenth century became the two most visited London leisure time attractions. Advantages and drawbacks of the crystal palace as a building type are reviewed and the role of crystal palaces in Ebenezer Howard’s Garden City is stressed.

  11. Rules and principles of Mycenaean palace administration and economy

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    2008-01-01

    Analysis of the administrative mechanisms shared by various palace administrations at Knossos, Pylos, Thebes, Mycenae......Analysis of the administrative mechanisms shared by various palace administrations at Knossos, Pylos, Thebes, Mycenae...

  12. Rules and principles of Mycenaean palace administration and economy

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    2008-01-01

    Analysis of the administrative mechanisms shared by various palace administrations at Knossos, Pylos, Thebes, Mycenae......Analysis of the administrative mechanisms shared by various palace administrations at Knossos, Pylos, Thebes, Mycenae...

  13. A palace for astronomy in Buenos Aires

    CERN Document Server

    Gangui, Alejandro

    2013-01-01

    In no other epoch of Western history like in the Middle Ages, cosmology was so key an element of culture and, one way or another, the motion of the heavens ended up impregnating the literature of that time. Among the most noteworthy poets we find Dante Alighieri, who became famous for his Commedia, a monumental poem written roughly between 1307 and his death in 1321, and which the critics from XVIth century onwards dubbed Divina. In this and other works, Dante pictures the cosmic image for the world, summing up the current trends of Neoplatonic and Islamic traditions. The Barolo Palace in the city of Buenos Aires is a singular combination of both astronomy and the worldview displayed in Dante's poetic masterpiece. Some links of the Palace's main architectural structure with the three realms of the Comedy have been studied in the past. In this note we consider its unique astronomical flavor, an issue which has not been sufficiently emphasized yet.

  14. A palace for astronomy in Buenos Aires

    Science.gov (United States)

    Gangui, Alejandro

    2011-06-01

    In no other epoch of Western history like in the Middle Ages, cosmology was so key an element of culture and, one way or another, the motion of the heavens ended up impregnating the literature of that time. Among the most noteworthy poets we find Dante Alighieri, who became famous for his Commedia, a monumental poem written roughly between 1307 and his death in 1321, and which the critics from 16th century onwards dubbed Divina. In this and other works, Dante pictures the cosmic image for the world, summing up the current trends of Neoplatonic and Islamic traditions. The Barolo Palace in the city of Buenos Aires is a singular combination of both astronomy and the worldview displayed in Dante's poetic masterpiece. Some links of the Palace's main architectural structure with the three realms of the Comedy have been studied in the past. In this note we consider its unique astronomical flavor, an issue which has not been sufficiently emphasized yet.

  15. The Global Strategy of "Sun and Moon in Daming Palace"

    Institute of Scientific and Technical Information of China (English)

    Sun Donghai

    2010-01-01

    @@ As the most splendid and magnificent architectural complex in Chang'an city,the world renowned capital of the Tang Empire,Daming Palace once served as the office and living place for 17 emperors of the Tang Dynasty.Daming Palace heritage is the national key cultural relics protection unit,and also an archaeological treasure house of palace architectures of the Tang Dynasty.

  16. Fantastic Frogs!

    Science.gov (United States)

    Scott, Kym

    2002-01-01

    Number rhymes can be used in many exciting and different ways to support the early learning goals for mathematics. The rhyme "five little speckled frogs" provides the theme for this display, which was set up in Lewisham's professional development center. It provides a range of ideas which would help develop young children's mathematical learning…

  17. Fantastic Frogs!

    Science.gov (United States)

    Scott, Kym

    2002-01-01

    Number rhymes can be used in many exciting and different ways to support the early learning goals for mathematics. The rhyme "five little speckled frogs" provides the theme for this display, which was set up in Lewisham's professional development center. It provides a range of ideas which would help develop young children's mathematical learning…

  18. BAROQUE RECONSTRUCTION OF THE RECTOR’S PALACE IN DUBROVNIK

    OpenAIRE

    Horvat-Levaj, Katarina; Seferović, Relja

    2006-01-01

    The Rector’s Palace in Dubrovnik has hitherto been evaluated mainly in terms of its predominant Gothic and Renaissance phases of construction. However, comprehensive research on Dubrovnik’s Baroque architecture has demonstrated that a revalorisation of the Baroque phase of the Rector’s Palace is due. This re-evaluation has been stimulated by research on archival documents in the State Archives of Dubrovnik (particularly the Libro della Fabbrica del Palazzo Publico of 1685-1704), which has bro...

  19. Meeting the "Standards" with Vanishing Frogs.

    Science.gov (United States)

    Davidson, Cindy B.; Matthews, Catherine E.; Patrick, Patricia

    2001-01-01

    Explains methods for introducing high school students to the issue of the declining amphibian population. Plays the game Frogs' Futures following a seminar as an instructional strategy. Describes the game, procedures, and rules. (YDS)

  20. Meeting the "Standards" with Vanishing Frogs.

    Science.gov (United States)

    Davidson, Cindy B.; Matthews, Catherine E.; Patrick, Patricia

    2001-01-01

    Explains methods for introducing high school students to the issue of the declining amphibian population. Plays the game Frogs' Futures following a seminar as an instructional strategy. Describes the game, procedures, and rules. (YDS)

  1. Horse Palace photovoltaic pilot project findings report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-06-15

    This paper provided details of a solar photovoltaic (PV) feasibility study conducted as part of the Toronto Exhibition Place's 2010 energy self-sufficiency plan. The 100 kw plant was installed on the roof of the Horse Palace, and when first installed represented the largest urban PV array in Canada. The study was conducted to compare the performance of technology alternatives under otherwise common environmental and operating conditions, to build capacity to operate large roof-mounted PV systems in Toronto, and to gain experience with Ontario's renewable energy standard offer program (RESOP). The initial year of monitoring identified complications with inverters and monitoring equipment, shading issues, and problems with data collection and management. Interconnecting the project with the electricity grid to sell the produced power was a complicated and lengthy procedure. A problem with the baseline performance modeling that was used to assess the project was also identified. In 2008, the project produced 96,724 kWh. Simple payback for the project was estimated at 16.7 years. The plant is now participating in the RESOP and receiving monthly payments. 14 figs., 2 appendices.

  2. [Brief history of cosmetology in the imperial palace of China].

    Science.gov (United States)

    Li, C; Li, J; Liu, D

    2001-07-01

    The development of Chinese Palace's cosmetology is divided into three periods. It is in its embryonic stage that from the Xia to the Western Jin. The drugs and perfumes related to cosmetology were taken seriously by the Palace. The formulation of facial beauty was established. From the Eastern Jin to the end of Tang Dynasty was the forming periods. Cosmetology has been fully developed, and became the physical civilization which could enjoy by both nobels and common people. The developing and enriching time was from the Wu Dai to the end of the Qing Dynasty. The theory of cosmetology achieved a great development. The number of prescriptions of the Palace's cosmetology were increased greatly.

  3. 75 FR 52364 - Notice of Intent To Repatriate Cultural Items: Memphis Pink Palace Museum, Memphis, TN

    Science.gov (United States)

    2010-08-25

    ... Cultural Items: Memphis Pink Palace Museum, Memphis, TN AGENCY: National Park Service, Interior. ACTION... Memphis Pink Palace Museum, Memphis, TN, that meet the definition of unassociated funerary objects under... objects from the site. Officials of the Memphis Pink Palace Museum have determined that, pursuant to 25...

  4. 75 FR 52367 - Notice of Inventory Completion: Memphis Pink Palace Museum, Memphis, TN

    Science.gov (United States)

    2010-08-25

    ... Completion: Memphis Pink Palace Museum, Memphis, TN AGENCY: National Park Service, Interior. ACTION: Notice... Memphis Pink Palace Museum, Memphis, TN. The human remains were removed from Crittenden, Cross, Poinsett... made by Memphis Pink Palace Museum professional staff and consultants in consultation...

  5. Frog eat frog: exploring variables influencing anurophagy

    Directory of Open Access Journals (Sweden)

    G. John Measey

    2015-08-01

    Full Text Available Background. Frogs are generalist predators of a wide range of typically small prey items. But descriptions of dietary items regularly include other anurans, such that frogs are considered to be among the most important of anuran predators. However, the only existing hypothesis for the inclusion of anurans in the diet of post-metamorphic frogs postulates that it happens more often in bigger frogs. Moreover, this hypothesis has yet to be tested.Methods. We reviewed the literature on frog diet in order to test the size hypothesis and determine whether there are other putative explanations for anurans in the diet of post-metamorphic frogs. In addition to size, we recorded the habitat, the number of other sympatric anuran species, and whether or not the population was invasive. We controlled for taxonomic bias by including the superfamily in our analysis.Results. Around one fifth of the 355 records included anurans as dietary items of populations studied, suggesting that frogs eating anurans is not unusual. Our data showed a clear taxonomic bias with ranids and pipids having a higher proportion of anuran prey than other superfamilies. Accounting for this taxonomic bias, we found that size in addition to being invasive, local anuran diversity, and habitat produced a model that best fitted our data. Large invasive frogs that live in forests with high anuran diversity are most likely to have a higher proportion of anurans in their diet.Conclusions. We confirm the validity of the size hypothesis for anurophagy, but show that there are additional significant variables. The circumstances under which frogs eat frogs are likely to be complex, but our data may help to alert conservationists to the possible dangers of invading frogs entering areas with threatened anuran species.

  6. Loong Palace Hotel & Resort—An Oasis of Luxury

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A hotel in suburban Beijing? You will probably be thinking of a modest inn with humble facilities until you arrive at Loong Palace Hotel & Resort and find a magnifi-cent building complex nestling in a cluster of luxurious western-style villas. With light

  7. Prezentatsija fotovõstavki v klube Astoria Palace

    Index Scriptorium Estoniae

    2007-01-01

    Fotograafide Artur Sadovski ja Indrek Galetini fotonäituse "Eludraama" esitlus koostöös moekunstnik Marin Sillaga Tallinna ööklubis Astoria Palace. Alates 13. augustist eksponeeritakse Sadovski ja Galetini fotosid Rahvusraamatukogus. Lisatud 8 värvifotot

  8. The Bishop’s Palace Garden in Ljubljana

    Directory of Open Access Journals (Sweden)

    Ines Unetič

    2011-07-01

    Full Text Available There was not always a market square behind the Bishop’s Palace in Ljubljana. In the sixteenth century, this space was occupied by a garden that was reshaped into a space for market stalls as early as the seventeenth century. The prince-bishops Count Ernst Amadeus Attems and Count Karl Johann von Herberstein tried to appropriate the space as diocesan property, but without success. The empty space (today Pogačar Square, located between the Bishop’s Palace, the Seminary, the Kresija Palace, and the Ljubljanica River, was turned into a public garden by the Illyrian governor only around 1812. However, due to maintenance costs and regime changes, the garden was not kept in its original form for long. As evident in some plans from the first half of the nineteenth century, the garden eventually became two green areas with no garden design features. A garden plan kept in the Archives of Slovenia shows diverse garden elements, opulent flowerbeds and patterns, and architectural garden elements, which indicate that the garden was designed in Biedermeier style. This plan, dating back to 1812, places the Bishop’s Palace garden among the earliest examples of Biedermeier gardens in Central Europe. The garden therefore represents a very interesting and high-quality example in the history of garden design in Slovenia.

  9. Ancient palace complex (300-100 BC) discovered in the Valley of Oaxaca, Mexico.

    Science.gov (United States)

    Redmond, Elsa M; Spencer, Charles S

    2017-04-11

    Recently completed excavations at the site of El Palenque in Mexico's Valley of Oaxaca have recovered the well-preserved remains of a palace complex dated by associated radiocarbon samples and ceramics to the Late Formative period or Late Monte Albán I phase (300-100 BC), the period of archaic state emergence in the region. The El Palenque palace exhibits certain architectural and organizational features similar to the royal palaces of much later Mesoamerican states described by Colonial-period sources. The excavation data document a multifunctional palace complex covering a maximum estimated area of 2,790 m(2) on the north side of the site's plaza and consisting of both governmental and residential components. The data indicate that the palace complex was designed and built as a single construction. The palace complex at El Palenque is the oldest multifunctional palace excavated thus far in the Valley of Oaxaca.

  10. FROG - Fingerprinting Genomic Variation Ontology.

    Directory of Open Access Journals (Sweden)

    E Abinaya

    Full Text Available Genetic variations play a crucial role in differential phenotypic outcomes. Given the complexity in establishing this correlation and the enormous data available today, it is imperative to design machine-readable, efficient methods to store, label, search and analyze this data. A semantic approach, FROG: "FingeRprinting Ontology of Genomic variations" is implemented to label variation data, based on its location, function and interactions. FROG has six levels to describe the variation annotation, namely, chromosome, DNA, RNA, protein, variations and interactions. Each level is a conceptual aggregation of logically connected attributes each of which comprises of various properties for the variant. For example, in chromosome level, one of the attributes is location of variation and which has two properties, allosomes or autosomes. Another attribute is variation kind which has four properties, namely, indel, deletion, insertion, substitution. Likewise, there are 48 attributes and 278 properties to capture the variation annotation across six levels. Each property is then assigned a bit score which in turn leads to generation of a binary fingerprint based on the combination of these properties (mostly taken from existing variation ontologies. FROG is a novel and unique method designed for the purpose of labeling the entire variation data generated till date for efficient storage, search and analysis. A web-based platform is designed as a test case for users to navigate sample datasets and generate fingerprints. The platform is available at http://ab-openlab.csir.res.in/frog.

  11. The Acoustics of the Double Elliptical Vault of the Royal Palace of Caserta (Italy

    Directory of Open Access Journals (Sweden)

    Umberto Berardi

    2017-03-01

    Full Text Available This work investigates the acoustic characteristics of the double elliptical vault, which overlooks the Grand Staircase of the Royal Palace of Caserta (Italy. The Royal Palace was built by the architect Luigi Vanvitelli in the Seventeenth Century and it is the largest royal building in Italy. The double elliptical vault presents a great scenography effect. Inside the vault, on the planking level, musicians used to play for the king and his guests when the royal procession, going up the grand staircase, entered the royal apartments, creating astonishment among the guests who heard the music without understanding from where it was coming. Since the musicians were inside the vault, the long reverberation made the listeners perceive the vault to be enveloped by the music. To investigate this effect, the acoustic characteristics of the double vault were measured, putting the sound source on the planking level of the vault, while the microphones were put along the staircase and in the vestibule towards the royal apartments. Finally, the spatial distribution of several acoustic parameters is evaluated also using architectural acoustic simulations.

  12. The Architect as a Social Designer: The Fun Palace Case

    Directory of Open Access Journals (Sweden)

    Lubomir Savov Popov

    2015-12-01

    Full Text Available The goal of this paper is to discuss how the architectural profession and its work, through development of physical structures, relate to the idea of social design. Toward this end, we explore a number of issues that emerge from this concept—the social role of the architect, the emerging engagements in social design, and the need for corresponding design ethics. Through an applied sociological approach that focuses on interaction, emphasizing collaborative and transformative work within situated contexts, we conduct a case study on a project known as The Fun Palace. Rather than providing a detailed examination of the Fun Palace or its architect, Cedric Price, this paper uses this case to explore and discuss the potential for architecture in social design. Consequently, the study contributes to the ongoing debate on the social role of the architect, the scope of the architectural profession, and involvement with social design.

  13. Knossos: the complete quide to the palace of Minos

    OpenAIRE

    Michailidou, Anna

    2010-01-01

    p. 128 σ. : illustr.; maps ; 24 cm. Introduction; Historical outline; Myth and tradition; History of the excavations;Minoans and Knossos; The archaeological site; Route from Herakleion to Knossos; Tour of the palace; The main features; West court - west facade; West porch - corridor of the procession - central court; South propylaeum - west magazines - piano nobile; Throne room - tripartite shrine - pillar crypts; Grand staircase - hall of the double axes - queen's hall; Upper floor of the...

  14. PENGARUH BAURAN PROMOSI TERHADAP PENINGKATAN PENJUALAN KAMAR PADA HOTEL GRAND PALACE MAKASSAR

    OpenAIRE

    SIOMBO, GLORIS

    2012-01-01

    - GLORIS SIOMBO.2011.Pengaruh Bauran Promosi terhadap Peningkatan Penjualan Kamar pada Hotel Grand Palace Makassar (dibimbing oleh Muh.Asdar dan Abd Razak Munir). Skripsi ini berjudul ???Pengaruh Bauran Promosi Terhadap Peningkatan Penjualan Kamar pada Hotel Grand Palace Makassar ???. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh bauran promosi terhadap peningkatan penjualan kamar pada Hotel Grand Palace Makassar dan diharapkan dapat menjadi masukkan bagi manajer hotel se...

  15. Pokaz modnoi odezhdõ osenne-zimnego sezona Fashion Palace v restorane Gloria

    Index Scriptorium Estoniae

    2008-01-01

    Fashion Palace sügis-talviste kollektsioonide demonstratsioon Tallinna restoranis Gloria. Esmakordselt Eestis presenteeriti ehteid inglise disainerilt Stephen Websterilt. Korraldas Beatrice. 13 värvifotot

  16. Pokaz modnoi odezhdõ osenne-zimnego sezona Fashion Palace v restorane Gloria

    Index Scriptorium Estoniae

    2008-01-01

    Fashion Palace sügis-talviste kollektsioonide demonstratsioon Tallinna restoranis Gloria. Esmakordselt Eestis presenteeriti ehteid inglise disainerilt Stephen Websterilt. Korraldas Beatrice. 13 värvifotot

  17. Yet More Frogs

    Science.gov (United States)

    Shutler, Paul M. E.

    2011-01-01

    Extending a recent paper by Derek Holton, we show how to represent the algorithm for the Frog Problem diagrammatically. This diagrammatic representation suggests a simpler proof of the symmetrical case (equal numbers of frogs of each colour) by allowing the even and odd cases to be treated together. It also provides a proof in the asymmetrical…

  18. Yet More Frogs

    Science.gov (United States)

    Shutler, Paul M. E.

    2011-01-01

    Extending a recent paper by Derek Holton, we show how to represent the algorithm for the Frog Problem diagrammatically. This diagrammatic representation suggests a simpler proof of the symmetrical case (equal numbers of frogs of each colour) by allowing the even and odd cases to be treated together. It also provides a proof in the asymmetrical…

  19. Celadon Figurines Play Instruments

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    This group of figurines, each 0.15m tall, were unearthed from a Tang Dynasty tomb in Changsha in 1977. Music was very developed in the Tang Dynasty. Colorful musical instruments and dances were popular both among the people and in the palace. These vivid-looking figurines wear pleated skirts with small sleeves and open chest, a style influenced by the non-Han nationalities living in the north and west of China. Some of the musical instruments were brought from the Western Regions. The figurines are playing the xiao (a vertical bamboo flute), the konghou (an

  20. Analytical Characterization of Rococo Paintings in Egypt: Preliminary Results from El-Gawhara Palace at Cairo

    OpenAIRE

    Fatma REFAAT; Hussein MAREY MAHMOUD; Atef A. BRANIA

    2012-01-01

    El-Gawhara palace (1813–1814 AD) is situated south of the Mosque of Muhammad Ali in the Cairo Citadel. This palace is an important example of the best early 19th century rococo decorations in Egypt. The present study reports some of the results obtained from the application of different analytical techniques to characterize some rococo paintings at El-Gawhara palace at Cairo, Egypt. The characterization of the studied paintings was carried out by means of optical microscopy (OM), scanning ele...

  1. Laser Cleaning of Peristyle in Diocletian Palace in Split (HR)

    Science.gov (United States)

    Almesberger, D.; Rizzo, A.; Zanini, A.; Geometrante, R.

    Before starting the cleaning program of the peristyle of Diocletian Palace in Split, a series of tests have been performed on it. First of all, the state of conservation of columns and capitals has been assessed applying non-destructive techniques such as thermography, magnetoscopy and superficial ultrasonic tests. All the areas with black crusts, exfoliation and stone cracks have been determined. In this stage, parameters such as water absorption and colour have been estimated in order to compare them with those measured after the cleaning operation. Then, more than 3-month period of tests have been performed to set up all the parameters concerning the application of the laser cleaning techniques. In this chapter, the results of these preliminary investigations are presented.

  2. DANCE CURRICULUM MODEL FOR HIGH SCHOOLS IN PALACES STUDENTS IN ROMANIA

    National Research Council Canada - National Science Library

    Popa Daniela; Neamtu Mircea

    2015-01-01

      The research undertaken was intended to achieve a high school dance curriculum educational Palaces pupils for contribute to the knowledge, skills and abilities to the all practitioners participating in these programs...

  3. The History with Two Prehistories. On the design of the Moscow Palace of Young Pioneers

    Directory of Open Access Journals (Sweden)

    Felix Novikov

    2016-11-01

    Full Text Available The article refers to the history of design of the Moscow Palace of Young Pioneers architectural complex on Leninskie (now Vorobievy Gory viewed in the context of evolution of the national architecture. While speaking about how the project came into being and which way was chosen to find the architectural character, the author proves that the Palace was a pivotal point in the history of Russian architecture and became one of the symbols of Soviet Modernism.

  4. Digitization and the Depoliticization of Museum Access The Situation at the National Palace Museum

    OpenAIRE

    Michelle Chaotzu Wang

    2016-01-01

    Ranked tenth amongst museums across the globe, the National Palace Museum (NPM) in Taipei is a significant interpreter of treasures belonging to the entire ethnic Chinese. But, unlike other national museums of monolithic stature in Europe and the Americas that have largely left political concerns of museum identity and authority to the previous century to adopt a freer identity as an institution of the global age, the National Palace Museum remains dilatory in its level of disclosure. This pa...

  5. The role of heritage tourism - history, protection and maintenance of the Golestan palace

    Directory of Open Access Journals (Sweden)

    Ebtehaj Salimi

    2014-03-01

    Full Text Available one of the major motivations for tourists to travel to different countries and cultural motivations, history and heritage. Despite domestic and foreign tourists, the activity cycle national significance, providing a personal experience and social and cultural change, cultural heritage and contemporary life and society of others is essential. Tourism, as a positive force in the restoration and preservation of cultural heritage, natural history, has increased participation, and   economic features can include heritage, and put them in the rehabilitation and social education, and effective policy to spend. This study, based on an analytical method - a description, and utilization of resources in this area to check the status of historical tourism, preserving and promoting the Golestan Palace, is discussed. Iran, with several historical palaces and museums, with a rich cultural history and heritage is like a palace. The most important underlying factor in Golestan Palace of tourism, culture and heritage is a factor. Some authors emphasize culture, and its role in shaping the growth and development of tourism, and its bilateral relationship as essential, and the cornerstone of culture and heritage tourism development, and tourism funds to maintain and strengthen culture and heritage are considered. Thus, two aspects of tourism for host communities to establish funding for restoration and attention to the palace, and on the other hand, other communities due to the historical significance of Golestan, Golestan Palace will maintain and repair

  6. From Palace Stage to Screen---Brief Discussion on the Transplant of Chinese Classical Dance in the Contemporary Films and TV Plays%从宫廷舞台走向荧屏影视--略谈中国古典舞在当代影视中的移植

    Institute of Scientific and Technical Information of China (English)

    蔡霞

    2014-01-01

    中国古典舞蹈在当代为了时代审美需求而主动与影视结缘。在电影《十面埋伏》和《神话》中展现了传统的“花鼓舞”“孔雀舞”,适应了剧情的需要且赋予其新的表现形式。在电视剧《杨贵妃秘史》和《甄嬛传》中,唐代的“霓裳羽衣舞曲”与“惊鸿舞”也纷纷植入,但前者很好地体现了其审美价值,后者的演绎则并不如人意。可见,中国古典舞在艺术精神传承方面任重道远,与影视结缘,既是机遇亦是挑战。%Nowadays , Chinese classical dance has a close relationship with films and TV plays conforming to the need of the era .In House of Flying Daggers and Legend,Hugou and peacock dances were shown in order to meet the need of plot and given the new forms .In Yang secret history and The Legend of Zhen Huan, feather dress dance and surprise dances were transplanted , the former embodied its beauty , but the latter didn 't. Therefore, there is a still long way to undertake the classical dance.

  7. Frogs In Danger

    Institute of Scientific and Technical Information of China (English)

    李笑; 岳巧玲

    2005-01-01

    If you go out to the field at ni ght inspring or summer,you can hear frogs croaking and singing joyfully here and there.It seems as if they were performing a fiel dsymphony (交响曲).How pleasant and sweet it sounds!It fills nature with music and vitality.

  8. It's a Frog's Life

    Science.gov (United States)

    Coffey, Audrey L.; Sterling, Donna R.

    2003-01-01

    When a preschool teacher unexpectedly found tadpoles in the school's outdoor baby pool, she recognized an unusual opportunity for her students to study pond life up close. By following the tadpoles' development, students learned about frogs, life cycles, habitats. (Contains 1 resource.)

  9. The Brisbane Dental Hospital Building: "The Palace" An Era Ends.

    Science.gov (United States)

    Akers, Harry F; Foley, Michael A; Brown, John P

    2015-01-01

    Constitutional, educational, humanitarian and political considerations underpinned the design and construction of the Brisbane Dental Hospital Building, often colloquially referred to as "The Palace." The Queensland Heritage Council's listing of the Brisbane Dental Hospital Building on The Queensland Heritage Register in 1999 confirms the cultural significance of Nowland's architectural signature, the historical importance of the Wickham Park precinct and prior students' connection with the building. Influences on decisions determining the location, grand design and timing of construction of the Brisbane Dental Hospital Building emanated from a far bigger and largely unrecorded political picture. The authors argue that the political context in two tiers of government, the timing and nature of the proposal, town planning issues, the exigencies of the caries epidemic and Forgan Smith's post-Depression economic reconstruction across Queensland underpinned the project. Hanlon's personal attributes and disdain for the autonomy of the dental profession, together with his desire to reform dental education and to establish statewide government-administred dental clinics, were also relevant. Accordingly, the BDHD portrayed aspiration, purpose, symbolism, and vision. This paper, essentially an integration of dental and mainstream history, assembles and analyzes hitherto scattered and unpublished evidence to fill a gap in the current literature.

  10. Playing Children Adorn Ancient Porcelain

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    Porcelain is one of China’s greatest achievernents. It appeared during the Eastern Han Dynasty (25-220) and developed into three types of blue porcelain, white porcelain and colored porcelain between the Tang and Song dynasties. From the time of the Ming Dynasty (1368-1644), porcelain-making evolved, glazes and colors improved and porcelain was sold overseas. The quaint shapes and colorfully deslgned porcelain of the Ming Dynasty showed the appeal of folklife, but it was mainly used in the palace. Shown here are some pieces decorated with children at play. From these artifacts we can get an idea of the hairstyles, dress and architecture of that time.

  11. The virtual reconstruction of the andalusian palace of Onda (Castellón: Architecture and Territory

    Directory of Open Access Journals (Sweden)

    Fidel Garrido Carretero

    2013-11-01

    Full Text Available This paper presents the virtual reconstruction of the Islamic palace of Onda (Castellón, a site where recent excavations have brought to light an important set of structures dating from the 11th century. Its poor state of preservation allowed a fairly complete reading of the palace plan but there was no hard evidence regarding its elevations. In the context of an ongoing study of the site, a virtual reconstruction of the palace was undertaken in order to facilitate the process of trial and error involved in figuring out its original configuration. A method devised to test reconstructive hypotheses on an active archaeological site is presented, followed by a discussion of results that encompasses the architecture and the urban and regional context of the site.

  12. Analytical Characterization of Rococo Paintings in Egypt: Preliminary Results from El-Gawhara Palace at Cairo

    Directory of Open Access Journals (Sweden)

    Fatma REFAAT

    2012-12-01

    Full Text Available El-Gawhara palace (1813–1814 AD is situated south of the Mosque of Muhammad Ali in the Cairo Citadel. This palace is an important example of the best early 19th century rococo decorations in Egypt. The present study reports some of the results obtained from the application of different analytical techniques to characterize some rococo paintings at El-Gawhara palace at Cairo, Egypt. The characterization of the studied paintings was carried out by means of optical microscopy (OM, scanning electron microscopy equipped with an energy dispersive X-ray detector (EDS and Fourier transform infrared spectroscopy (FT−IR. The obtained results allowed the identification of the chemical composition, structure and the painting technique employed in these paintings. This methodology reveals some useful information on some rococo paintings dating back to the 19th century in Egypt.

  13. GROUND PENETRATING RADAR INVESTIGATIONS FOR ARCHITECTURAL HERITAGE PRESERVATION OF THE HABIB SAKAKINI PALACE, CAIRO, EGYPT

    Directory of Open Access Journals (Sweden)

    Sayed HEMEDA

    2012-09-01

    Full Text Available The modern architectural heritage of Egypt is both varied and vast. It covers all nonecclesiastical buildings, important monumental structures (mansions, municipal buildings in the history of architecture, as well as more common buildings. They include houses (from mansions to simple dwellings, public buildings (schools, administrative buildings, hospitals, industrial buildings (factories, warehouses, mills, bridges, monastic dependencies (drinking foundations, gardens and any other modern structures that fall within the category of monuments and comprise the Egyptian cultural heritage. We present herein a comprehensive Ground Penetration Radar (GPR investigation and hazard assessment for the rehabilitation and strengthening of Habib Sakakini’s Palace, in Cairo, considered one of the most significant architectural heritage sites in Egypt. The palace is located on an ancient water pond at the eastern side of the Egyptian gulf, beside the Sultan Bebris Al-Bondoqdary mosque, a place also called “Prince Qraja al-Turkumany pond”. That pond was drained by Habib Sakakini in 1892, to construct his famous palace in 1897. Eight hundred meters of Ground Penetration Radar (GPR profiling were conducted, to monitor the subsurface conditions. 600 meters were made in the surrounding area of the Palace and 200 m at the basement. The aim was to monitor the soil conditions beneath and around the Palace and to identify potential geological discontinuities, or the presence of faults and cavities. A suitable single and dual antenna were used (500-100 MHZ to penetrate to the desired depth of 7 meters (ASTM D6432. The GPR was also used to detect the underground water. At the building basement the GPR was used to identify the foundation thickness and the soil - basement interface, as well as for the inspection of cracks in some supporting columns, piers and masonry walls. All the results, together with the seismic hazard analysis, will be used for a complete

  14. Lithobates sylvaticus (wood frog)

    Science.gov (United States)

    Fuller, Pam

    2016-01-01

    A single specimen found southwest of Hattiesburg in Timberton (31.270391oN, 89.327675oW; WGS 84). 23 July 2015. Gary, Kat, and Ron Lukens. Verifi ed by Kenneth Krysko, Florida Museum of Natural History (UF-Herpetology 176455). This species has never been recorded from the state of Mississippi before (Dodd 2013. Frogs of the United States and Canada – Volume 2. John Hopkins University Press, Baltimore, Maryland. 982 pp.). According to Dodd (2013), the closest population is located in east central Alabama, approximately 400 km to the northeast, as documented by Davis and Folkerts (1986. Brimleyana 12:29-50).

  15. Generation of transgenic frogs.

    Science.gov (United States)

    Loeber, Jana; Pan, Fong Cheng; Pieler, Tomas

    2009-01-01

    The possibility of generating transgenic animals is of obvious advantage for the analysis of gene function in development and disease. One of the established vertebrate model systems in developmental biology is the amphibian Xenopus laevis. Different techniques have been successfully applied to create Xenopus transgenics; in this chapter, the so-called meganuclease method is described. This technique is not only technically simple, but also comparably efficient and applicable to both Xenopus laevis and Xenopus tropicalis. The commercially available endonuclease I-SceI (meganuclease) mediates the integration of foreign DNA into the frog genome after coinjection into fertilized eggs. Tissue-specific gene expression, as well as germline transmission, has been observed.

  16. LE CORBUSIER: CONCURSOS Y PALACIOS / Le Corbusier: competitions and palaces

    Directory of Open Access Journals (Sweden)

    Fernando Zaparaín Hernández

    2012-11-01

    Full Text Available RESUMEN Cuando Le Corbusier ya había pasado de los cuarenta años se enfrentó a dos concursos internacionales: el Palacio de las Naciones en Ginebra (1926–31 y el Palacio de los Soviets en Moscú (1931–32 con los que intentaba acceder a grandes encargos de estado con mayor escala urbana en los que poner a prueba su ideario moderno sobre arquitectura y urbanismo. En ambos casos estuvo entre los vencedores pero por conveniencia e indecisión, los poderes políticos optaron por soluciones academicistas. Al conocer las decisiones definitivas, Le Corbusier y todos sus contactos del Movimiento Moderno orquestaron diversas polémicas ante los medios de comunicación y los gobernantes por entender que el progreso se veía lastrado por el triunfo de propuestas reaccionarias. Mediante el estudio de la correspondencia con personas particulares como Moser, Giedion, Colly o Stonorov, conservada en la Fundación Le Corbusier, se analizan las relaciones y el tono ideológico en torno a aquellas protestas. En esos textos quedan reflejados los principales rasgos que caracterizan la modernidad como su internacionalización, la seguridad en la propia misión, la defensa de lo nuevo o el método dialéctico.SUMMARY When Le Corbusier had already passed the age of forty he confronted two international competitions: the Palais des Nations in Geneva (1926–1931 and the Palace of the Soviets in Moscow (1931–32, with which he attempted to access large state commissions, with greater urban scale, in which to test his ideas about modern architecture and urbanism. In both cases he was among the winners, but through convenience and indecision the political powers opted for solutions from academicians. Upon knowing the final decisions, Le Corbusier and all his contacts in the Modern Movement orchestrated several controversies with the media, and the people in power, to convey that progress seemed burdened by the triumph of reactionary proposals. The relationships and

  17. Landscape resistance to frog movements

    Science.gov (United States)

    Mazerolle, M.J.; Desrochers, A.

    2005-01-01

    An animal's capacity to recolonize a patch depends on at least two components: its ability to detect the patch and its ability to reach it. However, the disruption of such processes by anthropic disturbances could explain low animal abundance patterns observed by many investigators in certain landscapes. Through field experiments, we compared the orientation and homing success of northern green frogs (Rana clamitans melanota Rafinesque, 1820) and northern leopard frogs (Rana pipiens Schreber, 1782) translocated across disturbed or undisturbed surfaces. We also monitored the path selected by individuals when presented with a choice between a short distance over a disturbed surface and a longer, undisturbed route. Finally, we measured the water loss and behaviour of frogs on substrates resulting from anthropogenic disturbances and a control. When presented with a choice, 72% of the frogs avoided disturbed surfaces. Although able to orient towards the pond of capture when translocated on disturbed surfaces, frogs had a lower probability of homing successfully to the pond than when translocated at a similar distance on an undisturbed surface. Frogs lost the most water on substrates associated with disturbance and in the absence of cover. Our data illustrate that anthropically disturbed areas devoid of cover, such as mined peatlands and agricultural fields, disrupt the ability of frogs to reach habitat patches and are likely explanations to their reduced abundance patterns in such environments. ?? 2005 NRC Canada.

  18. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi.

    Science.gov (United States)

    de Sá, Fábio P; Zina, Juliana; Haddad, Célio F B

    2016-01-01

    Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual displays known in anurans, including five new visual displays. Previously unknown in frogs, we also describe a bimodal inter-sexual communication system where the female stimulates the male to emit a courtship call. As another novelty for frogs, we show that in addition to choosing which limb to signal with, males choose which of their two vocal sacs will be used for visual signaling. We explain how and why this is accomplished. Control of inflation also provides additional evidence that vocal sac movement and color must be important for visual communication, even while producing sound. Through the current knowledge on visual signaling in Neotropical torrent frogs (i.e. hylodids), we discuss and highlight the behavioral diversity in the family Hylodidae. Our findings indicate that communication in species of Hylodes is undoubtedly more sophisticated than we expected and that visual communication in anurans is more widespread than previously thought. This is especially true in tropical regions, most likely due to the higher number of species and phylogenetic groups and/or to ecological factors, such as higher microhabitat diversity.

  19. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi

    Science.gov (United States)

    de Sá, Fábio P.; Zina, Juliana; Haddad, Célio F. B.

    2016-01-01

    Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual displays known in anurans, including five new visual displays. Previously unknown in frogs, we also describe a bimodal inter-sexual communication system where the female stimulates the male to emit a courtship call. As another novelty for frogs, we show that in addition to choosing which limb to signal with, males choose which of their two vocal sacs will be used for visual signaling. We explain how and why this is accomplished. Control of inflation also provides additional evidence that vocal sac movement and color must be important for visual communication, even while producing sound. Through the current knowledge on visual signaling in Neotropical torrent frogs (i.e. hylodids), we discuss and highlight the behavioral diversity in the family Hylodidae. Our findings indicate that communication in species of Hylodes is undoubtedly more sophisticated than we expected and that visual communication in anurans is more widespread than previously thought. This is especially true in tropical regions, most likely due to the higher number of species and phylogenetic groups and/or to ecological factors, such as higher microhabitat diversity. PMID:26760304

  20. Difficult Geotechnical Conditions Under the Palace Complex, Case Study from Cianowice, Near Krakow, Poland

    Science.gov (United States)

    Gil-Mastalerczyk, Joanna; Gil, Regina

    2016-10-01

    The palace complex in Cianowice near Krakow (Lesser Poland, Poland) built around 1890, after 1945 ceased to function as a residential, so the whole building underwent successive devastation. Military activities, ad hoc repairs and long-term shortage of funds in Poland, led to the destruction of the magnificent assumptions. Since 2006. Palace remained completely unsecured and unattended. Performed in 2012-2015 modernization of the historic palace with the expansion of the basement (for residential building multigenerational) has become the occasion for a thorough diagnosis of the prevailing geotechnical conditions and the state of preservation of threads stone and brick walls and vaults chambers basement. Difficult ground conditions, water penetration, lack of insulation of horizontal and vertical has become one of the main causes of the destruction of the foundations and walls of basements. Moisture from the ground, rising damp in the walls (with dissolved salts in it), evaporate causing erosion of the walls. The result it led to the weakening of the structural and breakout layers of walls. The phenomenon has become particularly clear after the geotechnical surveys, excavations and complete discovery of the basement walls. The conducted works related to general technical renovation and restoration, included foundations (lining and insulation), walls, floors and roof. The assumption palace in Cianowice, through appropriate interference with the use of modern and introduction of a new substance, in any manner that emphasizes value and historical monument became possible to restore the important significance of the object and place.

  1. Virtual Application of Darul Arif Palace from Serdang Sultanate using Virtual Reality

    Science.gov (United States)

    Syahputra, M. F.; Annisa, T.; Rahmat, R. F.; Muchtar, M. A.

    2017-01-01

    Serdang Sultanate is one of Malay Sultanate in Sumatera Utara. In the 18th century, many Malay Aristocrats have developed in Sumatera Utara. Social revolution has happened in 1946, many sultanates were overthrown and member of PKI (Communist Party of Indonesia) did mass killing on members of the sultanate families. As the results of this incident, many cultural and historical heritage destroyed. The integration of heritage preservation and the digital technology has become recent trend. The digital technology is not only able to record, preserve detailed documents and information of heritage completely, but also effectively bring the value-added. In this research, polygonal modelling techniques from 3D modelling technology is used to reconstruct Darul Arif Palace of Serdang Sultanate. After modelling the palace, it will be combined with virtual reality technology to allow user to explore the palace and the environment around the palace. Virtual technology is simulation of real objects in virtual world. The results in this research is that virtual reality application can run using Head-Mounted Display.

  2. Near-surface geophysical investigations inside the cloister of an historical palace in Lecce, Italy

    Science.gov (United States)

    Nuzzo, L.; Quarta, T.

    2009-04-01

    Near-surface geophysics can play a major role in the framework of the Cultural Heritages diagnostics as the recourse to non-invasive geophysical methods is usually the only way to gain information on subsurface properties that can affect the stability of historical structures and accelerate degradation processes. In most cases the deterioration of ancient buildings is due to various causes: external, such as pollution, biological degradation and adverse climatic or microclimatic conditions; internal, such as a particular geological or hydro-geological setting or a combination of both. Therefore, being able to discriminate between the different sources and to identify the main process of decay becomes essential for the development of effective remediation actions. The present case study shows the main results of an integrated geophysical campaign performed inside the cloister of an important palace in Lecce, Southern Italy, in order to investigate the possible subsurface causes of deterioration affecting its pillars and walls and, more importantly, some altars of the annexed church. The historical building, named Palazzo dei Celestini, was formerly a monastery directly connected to the Basilica of Santa Croce and nowadays is the head office of the Province of Lecce Administration and the Prefecture. With its rich baroque façade, Palazzo dei Celestini and Santa Croce is the most famous architectural complex of the historical centre of Lecce. Its foundations generally rest on a very shallow and sometimes outcropping wet calcarenitic basement, evidenced by previous geophysical surveys performed in the nearby. The high capillarity of the local fine-grained calcarenitic stone used as building and ornamental material for the historical complex was thought to be responsible for the deterioration problems evidenced at some altars of the church and in the lower portion of the walls and pillars of the palace, although a previous microclimatic study inside the Basilica had

  3. Chemical Composition by Neutron Activation Analysis (INAA of Neo-Assyrian Palace Ware from Iraq, Syria and Israel

    Directory of Open Access Journals (Sweden)

    Alice M W Hunt

    2013-05-01

    Full Text Available Neo-Assyrian Palace Ware is an 8th-7th century B.C.E. fine-ware which originated in Northern Mesopotamia and spread throughout the greater Levant. The mechanism by which Palace Ware moved across the Neo-Assyrian imperial landscape (trade or local imitation/emulation is of great archaeological interest. This dataset provides chemical compositional data, generated using instrumental neutron activation analysis (INAA, for Palace Ware vessels from Nimrud and Nineveh, in the Assyrian imperial core (Iraq, Dūr-Katlimmu, in one of the annexed provinces (Syria, and Tell Jemmeh, located outside the Neo-Assyrian provincial system (Israel.

  4. Effects of elevated CO2 concentration on growth, photosynthetic characteristics and yield of chufa (Cyperus esculentus L.) in Lunar Palace 1

    Science.gov (United States)

    Liu, Guanghui; Liu, Hui; Liu, Hong; Wang, Minjuan; Fu, Yuming; Shao, Lingzhi; Dong, Chen; Yu, Juan

    Elevated CO2 concentration is a common phenomenon in spaceflight environment. Effects of elevated CO2 concentration within short- and long-term on growth, photosynthetic characteristics and yield of chufa (Cyperus esculentus L.) are examined during 90 days in Lunar Palace 1. Elevated CO2 within a short-term induces a large increase in photosynthesis in chufa, long-term expose in elevated CO2 can lead to a smaller increase resulting from the inhibition of photosynthesis. It is indicated that the increased net photosynthesis per unit leaf area at elevated CO2 concentration come from an inhibition of photorespiration and an Increase of photosynthesis substrate. Low stomatal conductance reduced the transpiration. Effects of high CO2 concentration to the growth of whole plants is the main point of this research. The probable CO2 concentration affecting chufa growth is evaluated in Lunar Palace 1, and the mechanisms will be revealed. The proper CO2 concentration for highest production of chufa in spaceflight environment will be figured out, which plays an important role in plant cultivation supporting spaceflight tasks.

  5. To Be or Not to Be...a Frog: The Frog Prince and Shifting Paradigms.

    Science.gov (United States)

    Crane, Lisa Marie

    1997-01-01

    Discusses three modern variations of the classic "Frog Prince" folk tale: "Pondlarker" (Fred Gwynne); "The Frog Prince Continued" (Jon Scieszka); and "The Prince of the Pond" (Donna Jo Napoli). Notes that these variants create a world in which frogs can have values, wisdom, and emotion, and in which frogs can influence the ways of humanity. (RS)

  6. A Comparison of V-Frog[C] to Physical Frog Dissection

    Science.gov (United States)

    Lalley, James P.; Piotrowski, Phillip S.; Battaglia, Barbara; Brophy, Keith; Chugh, Kevin

    2010-01-01

    The purpose of the present study was to examine and compare the effectiveness of virtual frog dissection using V-Frog[C] and physical frog dissection on learning, retention, and affect. Subjects were secondary students enrolled in year-long life science classes in a suburban high school (N=102). Virtual dissections were done with V-Frog[C], a…

  7. 49 CFR 213.137 - Frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frogs. 213.137 Section 213.137 Transportation... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.137 Frogs. (a) The flangeway depth measured from a plane across the wheel-bearing area of a frog on Class 1 track shall not be less than 13/8 inches, or...

  8. Reel Royal Diversity? The Glass Ceiling in Disney’s Mulan and Princess and the Frog

    Directory of Open Access Journals (Sweden)

    Lauren Dundes

    2016-12-01

    Full Text Available Both in Mulan and Princess and the Frog, Disney eschews a traditional fairytale ending involving palatial opulence by substituting an alternative narrative for women of color. Mulan disguises herself as a male soldier in order to serve in her father’s place. After sharing victory with male companions, she willingly returns home to domesticity and the confines imposed by her gender. Tiana spends two thirds of the movie as a frog, substantially limiting her on-screen time as an African American female. Like Mulan, she is driven to please her father. She fulfills his dream of owning a high-end restaurant, ironically named Tiana’s Palace, the closest she comes to a royal lifestyle. Although protagonists with more realistic lives could potentially enhance viewers’ connection with them and model a work ethic or commitment to home life, the standard and more financially successful Disney narrative immerses viewers in a fantasy world of endless prospects including a life of royalty. These nonwhite heroines instead display a willingness to settle for more modest aspirations in stories replete with stereotypical gender and race-bound tropes. This divergent narrative suggests that protagonists of color are not entitled to a life of leisure and privilege that white Disney princesses enjoy.

  9. 盘龙城商代宫殿基址讨论%A DISCUSSION ON THE SHANG PERIOD PALACE FOUNDATIONS ON THE PANLONGCHENG SITE

    Institute of Scientific and Technical Information of China (English)

    杜金鹏

    2005-01-01

    The large-sized rammed-earth building foundations on the Panlongcheng site at Huangpi are remains of early Shang period palace complex. The No. 1 Panlongcheng palace consists of four rooms with wooden-framed walls. The two rooms in the middle each have two doors on the northern and southern sides respectively;while the two end rooms have only southern doors. So the No. 1 palace must have been in the center of the whole building complex. The roof supported by peripheral columns and wooden-framed walls can be reconstructed to be hipped and single- or double- eaved. The hypothesis that the No. 1 palace may have had projecting-eaves columns has not been confirmed. The No. 2 palace is an open hall without peripheral walls and room division; its roof is supported by peripheral columns only. The idea of reconstructing it as a building with pilasters and multiple rooms seems to lack archaeological evidence. The remaining vestiges show that there were side corridors in the two flanks of the main hall of the No. 2 palace. Referring to the Shang period palace material unearthed from the Shang city-site at Yanshi and other localities, it can be inferred that either of the Nos. 1 and 2 palaces must have had an eastern corridor and a western one, and, in addition, the No. 2 palace must have had a southern corridor with a gate house. The Nos. 1--3 palaces of the Panlongcheng site formed three compounds located one behind another, and belonged to the type of court-and-living building complex. Among them the No. 2 palace was the outer court for holding great ceremonies, the No. 1 palace was the inner court for handling daily administrative affairs, and the No. 3 palace was the king and queen's living place. To the southeast of the No. 2 palace remains a group of rammed-earth house-foundations, which must have been left over from another type of palace building, possibly an ancestral temple. The remaining city-walls at Panlongcheng must have belonged to the peripheral city

  10. Diseases of frogs and toads

    Science.gov (United States)

    Green, D.E.; Converse, K.A.; Majumdar, S.K.; Huffman, J.E.; Brenner, F.J.; Panah, A.I.

    2005-01-01

    This chapter presents information on infectious diseases of free-living frogs and toads that have completed metamorphosis. The diseases discussed in this chapter pertain principally to sub-adult and adult frogs and toads that are at least 60-90 days removed from completion of metamorphosis. The main emphasis of this chapter is the diseases found in amphibians of Canada and the United States. Diseases of recent metamorphs, larvae and amphibian eggs are presented in the chapters Diseases of Amphibian Eggs and Embryos and Diseases of Tadpoles. The smallest disease agents (viruses and bacteria) are presented first, followed by fungi, protozoa, helminths and ectoparasites. Diseases presented in this chapter are Ranaviral (iridovirus) infection Lucke frog herpesvirus (kidney cancer) Frog erythrocytic virus West Nile virus Red-leg disease (bacterial septicemia) Salmonellosis Chytrid fungal infection Basidiobolus fungi Dermosporidiosis Ichthyophoniasis Dermocystidium & Dermomycoides Myxozoa Ribeiroia flukes and Amphibian malformations Clinostomum metacercaria Aspects of each disease are presented to assist the biologist with recognition of diseases in the field. Hence, the major emphases for identification of diseases are the epizootiological aspects (host species, life stage, casualty numbers, etc) and gross findings ('lesions'). Descriptions of the microscopical, ultrastructural and cultural characteristics of each infectious agent were considered beyond the scope of this text. Detailed cultural and microscopical features of these disease agents are available in other reviews (Taylor et al., 2001; Green, 2001). Some diseases, while common in captive and zoo amphibians, are exceptionally rare in free-living frogs and toads, and therefore are omitted from this review. Among the diseases not presented are infections by chlamydia and mycobacteria, which occur principally in captive colonies of African clawed frogs (Xenopus, Hymenochirus, et al.) and northern leopard frogs

  11. Characterization studies of late Ottoman ceramics recovered from Istanbul Tekfur Palace excavation

    Energy Technology Data Exchange (ETDEWEB)

    Geckinli, A.E. [Istanbul Technical Univ. (Turkey). Chemistry and Metallurgical Engineering Faculty; Goektas, A.A.; Sueer, A. [Canakkale Ceramic Factory, Research and Development Lab., Can- Canakkale (Turkey); Yenisehirlioglu, F. [Hacettepe Univ., Dept. of History of Art, Beytepe-Ankara (Turkey)

    2002-07-01

    Tekfur Palace in Istanbul was used as a royal factory for ceramic and glass production between 1719- 1730. Excavation was started at Tekfur Palace in 1995 and lots of ceramic fragments including tiles, European porcelains and, various red and white body pottery were recovered. In addition to those sherds, raw and painting materials, frit and slag were also found. In this paper, the first report on the characterization of ten selected excavated underglaze decorated and also undecorated Tekfur tiles are given. The results compared with the 16. Century high quality Iznik tiles in order to investigate the reasons of the decline of quality in Ottoman ceramic technology during the 18{sup th} Century. (orig.)

  12. Evaluation of Social Carrying Capacity of Topkapi Palace By Employees and Visitors

    Directory of Open Access Journals (Sweden)

    Kurban Ünlüönen

    2009-09-01

    Full Text Available Visitors’ using attraction resources at an optimum level is essential for the sustainable usage of areas. In fact Topkapı Palace arouses a considerable level of interest in terms of resources it has and this interest consequently leads to a concentration of visitors and a high degree of usage. The concentration in the area has utmost importance in terms of visitor carrying capacity. One of the groups who can evaluate the concentration present in this area most efficiently is the employees of the palace who are in continuous interaction with the visitors. One of the main objectives of this study is revealing the opinions of the employees on visitor carrying capacity. In order to gather information from the employees, face-to-face interview technique has been used and the evaluations of the employees have shown that visitor concentration has reached a level which may cause some negative results.

  13. Idea of tourist management of the Radojewo palace park and surrounding areas

    Directory of Open Access Journals (Sweden)

    Agata Mikołajczak

    2013-06-01

    Full Text Available The aim of the study was to create a proper tourist trails in the palace park in Radojewo and surrounding areas, according to protected areas requirements, local space management plan, as well as with harmony with natural and landscape values. The ecotourism was found as the only possible kind of tourism in this area. The present areas management is not sufficient, hence the proposition of supplementation presented here, such as information tables and small architecture elements. Radojewo and its surroundings are a high tourism potential areas. The new bicycle trail is proposed in the neighbourhood of the park. It is meant to create a better communication with surrounding areas. Two kinds of pedestrian trails are suggested on the park area together with proper tourist infrastructure. There is also a necessity to assign the palace as a historical object.

  14. PLAN DE MARKETING PARA UNA EMPRESA DEL SECTOR HOTELERO, SH VALENCIA PALACE

    OpenAIRE

    2015-01-01

    El presente estudio es un plan de marketing realizado por un alumno elaborando su proyecto de final de carrera, un alumno entusiasta y con inquietudes que ha realizado incontables estudios e informes acerca de una gran variedad de negocios, abarcando así varios sectores englobados en el sector servicios. En este estudio ofrecemos al hotel SH Valencia Palace una serie de propuestas de marketing que creemos convenientes realizar. Estas medidas no están dirigidas a garantizar la supervivencia...

  15. The Barolo Palace: medieval astronomy in the streets of Buenos Aires

    CERN Document Server

    Gangui, Alejandro

    2014-01-01

    Cultural heritage relating to the sky in the form of sundials, old observatories and the like, are commonly found in many cities in the Old World, but rarely in the New. This paper examines astronomical heritage embodied in the Barolo Palace in Buenos Aires. While references to Dante Alighieri and his poetry are scattered in streets, buildings and monuments around the Western world, in the city of Buenos Aires, the only street carrying Dante's name is less than three blocks long and, appropriately, is a continuation of Virgilio street. A couple of Italian immigrants -a wealthy businessman, Luis Barolo, and an imaginative architect, Mario Palanti- foresaw this situation nearly a century ago, and did not save any efforts or money with the aim of getting Dante and his cosmology an appropriate monumental recognition, in reinforced concrete. The Barolo Palace is a unique combination of both astronomy and the worldview displayed in the Divine Comedy, Dante's poetic masterpiece. It is known that the Palace's design ...

  16. Seismic Analysis of Historic Masonry Buildings: The Vicarious Palace in Pescia (Italy

    Directory of Open Access Journals (Sweden)

    Luciano Galano

    2012-04-01

    Full Text Available Recent Italian earthquakes have underlined the need for wide monitoring and safety assessment of architectonical heritage. This has emerged also from requirements of the new Italian Technical Recommendations for buildings. Within this subject the paper investigates the seismic vulnerability of a specific monumental masonry building: the Vicarious Palace (Palazzo del Vicario in Pescia, a small town near Florence. The structural behavior of the Palace was investigated using a finite element model in which the non-linearities of the masonry were considered by proper constitutive assumptions. The seismic behavior was evaluated by the pushover method, according to the Italian Technical Recommendations. The results were compared with the ones obtained by a simplified approach based on the kinematic theorem of limit analysis. Comparisons of the expected seismic demand vs the seismic capacity of the Palace confirm the weakness of this type of building to suffer extensive damage under earthquakes, as frequently observed in similar construction typologies. Additionally, the comprehension of the structural behavior under seismic loading allows the identification of a proper retrofitting strategy.

  17. Mechanics of the frog ear

    NARCIS (Netherlands)

    Van Dijk, Pim; Mason, Matthew J.; Schoffelen, Richard L. M.; Narins, Peter M.; Meenderink, Sebastiaan W. F.

    2011-01-01

    The frog inner ear contains three regions that are sensitive to airborne sound and which are functionally distinct. (1) The responses of nerve fibres innervating the low-frequency, rostral part of the amphibian papilla (AP) are complex. Electrical tuning of hair cells presumably contributes to the f

  18. Guinea Worm in a Frog

    Centers for Disease Control (CDC) Podcasts

    2017-03-09

    Dr. Mark Eberhard, a retired parasitologist and CDC guest researcher, discusses Guinea worm infection in a wild-caught frog.  Created: 3/9/2017 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 3/9/2017.

  19. Salmonella Infection and Water Frogs

    Centers for Disease Control (CDC) Podcasts

    2010-01-12

    This podcast, featuring lead investigator Shauna Mettee, discusses the first known outbreak of Salmonella in people due to contact with water frogs.  Created: 1/12/2010 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 1/12/2010.

  20. Care and Feeding of Frogs

    Science.gov (United States)

    Pan, Margaret; Chiang, Eugene

    2012-01-01

    "Propellers" are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.) the longitude residuals of the best-observed propeller, "Blériot," appear consistent with a sinusoid of period ~4 years. Pan & Chiang proposed that propeller moonlets librate in "frog resonances" with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t delay, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t delay exceeds the frog libration period P lib, and if damping from Lindblad torques balances driving from co-orbital torques. If t delay Lt P lib, then the libration amplitude damps to zero. In the case of Blériot, the frog resonance model can reproduce the observed libration period P lib ~= 4 yr. However, our simple feedback prescription suggests that Blériot's t delay ~ 0.01P lib, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  1. CARE AND FEEDING OF FROGS

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Margaret; Chiang, Eugene, E-mail: mpan@astro.berkeley.edu [Department of Astronomy, University of California, Berkeley, CA 94720 (United States)

    2012-01-15

    'Propellers' are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.); the longitude residuals of the best-observed propeller, 'Bleriot', appear consistent with a sinusoid of period {approx}4 years. Pan and Chiang proposed that propeller moonlets librate in 'frog resonances' with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t{sub delay}, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t{sub delay} exceeds the frog libration period P{sub lib}, and if damping from Lindblad torques balances driving from co-orbital torques. If t{sub delay} << Pl{sub ib}, then the libration amplitude damps to zero. In the case of Bleriot, the frog resonance model can reproduce the observed libration period P{sub lib} {approx_equal} 4 yr. However, our simple feedback prescription suggests that Bleriot's t{sub delay} {approx} 0.01P{sub lib}, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  2. Tolerance of Frogs among High School Students: Influences of Disgust and Culture

    Science.gov (United States)

    Prokop, Pavol; Medina-Jerez, William; Coleman, Joy; Fancovicová, Jana; Özel, Murat; Fedor, Peter

    2016-01-01

    Amphibians play an important role in the functioning of ecosystems and some of them inhabit human gardens where they can successfully reproduce. The decline of amphibian diversity worldwide suggests that people may play a crucial role in their survival. We conducted a cross-cultural study on high school students' tolerance of frogs in Chile,…

  3. Tolerance of Frogs among High School Students: Influences of Disgust and Culture

    Science.gov (United States)

    Prokop, Pavol; Medina-Jerez, William; Coleman, Joy; Fancovicová, Jana; Özel, Murat; Fedor, Peter

    2016-01-01

    Amphibians play an important role in the functioning of ecosystems and some of them inhabit human gardens where they can successfully reproduce. The decline of amphibian diversity worldwide suggests that people may play a crucial role in their survival. We conducted a cross-cultural study on high school students' tolerance of frogs in Chile,…

  4. From frog integument to human skin: dermatological perspectives from frog skin biology

    NARCIS (Netherlands)

    Haslam, I.S.; Roubos, E.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R.

    2014-01-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a

  5. From frog integument to human skin: dermatological perspectives from frog skin biology

    NARCIS (Netherlands)

    Haslam, I.S.; Roubos, E.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R.

    2014-01-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a

  6. The Borromini's helicoidal staircase in Barberini Palace: scan laser survey and parametric modeling.

    Directory of Open Access Journals (Sweden)

    Leonardo Paris

    2015-07-01

    Full Text Available The paper concerns the study of the shape and geometry of the helicoidal staircase in Barberini Palace. Integrated models of representation (graphic and 3D have been produced starting from the digital data acquired by a laser scanner, processed and subsequently managed through procedures for optimizing the cloud-points.The realization of the helicoidal staircase in the Barberini Palace has an important rule in the architectural history because  it is a wonderful example of the constructive development of a complex geometric shape which is a helix oval. This stair should be read and interpreted as evidence of a particular period,the Roman Baroque, rich of intertwining and overlapping of ecclesiastical and noble commissions, of alternations in the yards of the greatest artists and architects of the era, often working simultaneously. Borromini proposes a modification to the first design of Maderno, which included a helicoidal staircase to the right of the large porch entrance to the palace, imagining a new oval stair  with a set of six twin columns for each revolution, very similar to the staircase that had been built a few years earlier, in 1585, at the Quirinale Palace by the Mascherino. Borromini had worked a few years earlier, under the direction of Maderno, in the Quirinal Palace, having a possibility to carefully study the Mascherino’s oval stair .Following the death of Maderno (1629 the yard of the Barberini Palace takes over the Bernini. Borromini will initiate a collaboration destined to end soon. The scale will be built in 1633 when now Borromini had already left the yard.The article wants above all to highlight the correlations between form and geometry when designing a campaign of digital acquisition using a laser scanner. Indeed, there are important implications to choice the positioning points of the instrument, with important fallout on the relationship between quality and quantity of a points cloud. The points cloud is a 3D

  7. A Depolarizing Electrogenic Pump in Frog Muscle

    Science.gov (United States)

    1975-08-01

    mw copy AFRRI SR75-20 AUGUST 1975 AFRRI SCIENTIFIC REPORT O ■ to A DEPOLARIZING ELECTROGENIC PUMP IN FROG MUSCLE D. Geduldig D. R...Academy of Sciences - National Research Council. AFRRI SR75-20 August 1975 A DEPOLARIZING ELECTROGENIC PUMP IN FROG MUSCLE D. GEDULDIG* D. R...INTRODUCTION When Na-enriched frog muscles are bathed in Na- and K-free saline, the small amount of potassium which could accumulate outside of the membrane

  8. HARDENING FROG POINTS BY EXPLOSIVE ENERGY,

    Science.gov (United States)

    Experiments were made to determine the most efficient method of strain hardening railroad frog points in order to increase their fatigue resistance...Mechanical strain hardening with rolls 40 mm in diameter under a load of 8 tons produced in standard frogs cast from G13L high-manganese steel (AISI...Hadfield steel) a work-hardened surface layer 3-5 mm thick with a hardness of 340 HB. In other experiments, the frogs were hardened by exploding a

  9. A Feminist Interpretation of the Korean TV Serial Jewel in the Palace

    Institute of Scientific and Technical Information of China (English)

    张颖

    2015-01-01

    The Korean Drama, JewelinthePalace,introduced how Jang-Geum, as a eastern woman, overcame a series of social discrimination, how she surmounted numerous difficulties and dangers, how she got rid of the common prejudice to the feminist. Finally she became the first woman to be the supreme royal physician of her times. She obtained a space for herself as a low class girl in the male dominated society. The thesis attempts to approach it from a feminist perspective to throw a new light on the study of the text.

  10. Fire safety analysis of the Crystal palace based on optimized BIM model

    OpenAIRE

    Semič, Dejan

    2016-01-01

    This master's thesis comprehensively explores fire safety in high-rise buildings. A fire safety analysis was performed on a model of the Crystal Palace skyscraper, which, at 89 meters, is the tallest building in Slovenia today (2016). A BIM model of the entire building was generated (Archicad) to be used with the software for fire (PyroSim) and evacuation analysis (Pathfinder). The BIM model of the building was optimized in a way it could be directly imported into the software for fire and...

  11. Strategic Marketing Analysis and Planning for Gloria Palace San Agustin Thalasso and Hotel in Spain

    OpenAIRE

    Pham, Thu Ngan

    2012-01-01

    The tertiary industry on the Gran Canary Island is increasing sharply, comprising a rising number of visitors per year who have brought more wealth than banana plantations could ever have done. Gloria Palace San Agustín Thalasso & Hotel is one of the famous hotels on the Gran Canary Island and it has just experienced a new and significant renovation. Thus, the necessity of a Strategic Marketing Analysis and Planning, as one possible tool to promote the new, modern and comfortable image and to...

  12. The new prosumers: social televisión audience. Operacion Palace analisys on Twitter

    OpenAIRE

    2014-01-01

    En esta contribución se presentan las mediciones sobre la repercusión en Twitter del programa Operación Palace: la verdadera historia del 23f’ emitido en La Sexta el pasado 23 de febrero. Se pretende conocer la actividad de varios perfiles, etiquetas y usuarios. Para realizar el seguimiento se ha utilizado la herramienta creada por la empresa Pirendo. España es uno de los países que registra mayor índice de comentarios en Twitter sobre programas de televisión durante el prime time y Salvados,...

  13. Of dreams and palaces in the theatre within theatre

    Directory of Open Access Journals (Sweden)

    Margaret Rich Greer

    2014-05-01

    Full Text Available Abstract:This article offers an exploration of the relationship between two metaphysical concepts of human existence that are encapsulated in the titles of the two most canonical plays of Pedro Calderón de la Barca: La vida es sueño and El gran teatro del mundo. How these concepts are dramatized by means of the combination of dreams and theater within theatre in Las fortunas de Andromeda y Perseo, Darlo todo y no dar nada, and the Mojiganga de las visiones de la muerte is studied, as are the ideological implications that we can identify in his use of these dramatic formulations. Resumen:En este trabajo, se explora la relación entre los dos conceptos metafísicos de la existencia humana que encapsulan los títulos de las dos obras más canónicas de Pedro Calderón de la Barça: La vida en sueño y El gran teatro del mundo. Se examina cómo se dramatizan por medio de la combinación del sueño y el teatro dentro del teatro en Las fortunas de Andrómeda y Perseo, Darlo todo y no dar nada y la Mojiganga de las visiones de la muerte. Y se considera las implicaciones ideológicas que podemos identificar en estas formulaciones dramáticas en el Barroco español. 

  14. Care and feeding of frogs

    CERN Document Server

    Pan, Margaret; 10.1088/0004-6256/143/1/9

    2012-01-01

    "Propellers" are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno 2010); the longitude residuals of the best-observed propeller, "Bl\\'eriot," appear consistent with a sinusoid of period ~4 years. Pan and Chiang (2010) proposed that propeller moonlets librate in "frog resonances" with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t_diff, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t_diff exceeds the...

  15. Degradation study of XVIII century graffiti on the walls of Chiaramonte Palace (Palermo, Italy)

    Science.gov (United States)

    Alberghina, M. F.; Barraco, R.; Brai, M.; Casaletto, M. P.; Ingo, G. M.; Marrale, M.; Policarpo, D.; Schillaci, T.; Tranchina, L.

    2010-09-01

    A systematic investigation of the original materials and the degradation phenomena induced by soluble salts on the wall matrix and on the graffiti of the Inquisition jails of Chiaramonte Palace in Palermo (Italy) was carried out. Built in the XIV century, Chiaramonte Palace was used as Inquisition court during the XV-XVI centuries. The ancient graffiti, recently discovered, represent a unique historical witness of the prisoners that lived during that terrible period. In order to study the nature, the amount and the distribution of the salts in the masonry, stone materials sampled at different depth from the wall matrix and saline efflorescences were analysed. Different physical techniques were used, such as X-ray Photoelectron Spectroscopy, X-ray Fluorescence, Laser Induced Breakdown Spectroscopy, X-ray Diffraction and Ionic Chromatography. Results of the chemical and physical characterisation showed that the main cause of the degradation of graffiti and wall paintings was the presence of soluble salts, such as nitrates, chlorides and sulphates. Traces of oxalates, coming from a previous conservation treatment, were also found. The results obtained by the stratigraphical characterisation of soluble salts in the wall matrix can be used to recommend a procedure based on air humidification at high relative humidity values in order to avoid salt crystallisation and to prevent the crumbling process of the graffiti.

  16. The technical research on the huge glazed brick from the relic of Nanyue Kingdom Palace

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    'Qin brick and Han tile' has a great worldwide reputation in the architectural history of China. According to the former archaeological materials, the big hollow brick is usually one meter long and thirty to forty centimeters wide, while the solid brick is generally much smaller. But in 1995, large scale vestiges and structures were unearthed at the center of Guangzhou's old district, from the relic of Nanyue Kingdom Palace, which was built some 2000 years ago during the Western-Han Dynasty, A great number of earthen structural members were discovered, especially the solid glazed bricks in various beautiful patterns with an astonishing thickness and size. Some of them are one meter square, more than 20 centimeters thick, and weight half a ton, which are named ‘Brick No.1 in the world' by excavators. People have shown great interest in how to make these huge glazed bricks at the ancient technical conditions, because it is very difficult to manufacture such huge bricks even with the modern technology. At the request of Guangdong Nanyue Kingdom Palace Museum, Shanghai Institute of Ceramics carried out systematical measurements and analysis on these bricks and studied the physical and chemical forming mechanisms from their chemical compositions, structure, and physical characteristics. Here the technical characteristics of the bricks are also discussed.

  17. The technical research on the huge glazed brick from the relic of Nanyue Kingdom Palace

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    ‘Qin brick and Han tile’ has a great worldwide reputation in the architectural history of China. According to the former archaeological materials, the big hollow brick is usually one meter long and thirty to forty centimeters wide, while the solid brick is generally much smaller. But in 1995, large scale vestiges and structures were un- earthed at the center of Guangzhou’s old district, from the relic of Nanyue Kingdom Palace, which was built some 2000 years ago during the Western-Han Dynasty. A great number of earthen structural members were discovered, especially the solid glazed bricks in various beautiful patterns with an astonishing thickness and size. Some of them are one meter square, more than 20 centimeters thick, and weight half a ton, which are named ‘Brick No.1 in the world’ by excavators. People have shown great interest in how to make these huge glazed bricks at the ancient tech- nical conditions, because it is very difficult to manufacture such huge bricks even with the modern technology. At the request of Guangdong Nanyue Kingdom Palace Museum, Shanghai Institute of Ceramics carried out systematical measurements and analysis on these bricks and studied the physical and chemical forming mechanisms from their chemical compositions, structure, and physical character- istics. Here the technical characteristics of the bricks are also discussed.

  18. The flora of the highest building in Poland (the Palace of Culture and Science in Warsaw

    Directory of Open Access Journals (Sweden)

    Halina Galera

    2014-01-01

    Full Text Available The flora of the Palace of Culture and Science, which is the highest office building in Poland, was analysed. The exterior horizontal surfaces of the building (roofs, terraces, stairs could be regarded as polyhemerobic habitats. A total of 111 species of vascular plants (native species - 65% and 6 species of bryophytes were recorded from an area of 16 500 m2. It was found that the flora was relatively rich in species, of which some occurred in considerable quantities (over 1000 individuals of such species as: Eragrostis minor, Sagina procumbens, Chaenarrhinum minus were encountered. Moreover anemochorous species dominated (85% in the flora of the Palace. Thermophilous species and species indifferent to temperature were also strongly represented. The relatively high incidence of hygrophilous species was noteworthy. With regard to life forms an increased proportion of therophytes and phanerophytes (40% and 22%, respectively was observed. No significant differences were found between the flora of roofs situated on different floors of the building. However, slight differences between - the flora of north-facing and south-facing horizontal roof surfaces were marked.

  19. Conservation of Stone Cladding on the FAÇADE of Royal Palace in Caserta

    Science.gov (United States)

    Titomanlio, I.

    2013-07-01

    The beauty of cultural heritage and monumental architecture, is often linked to their non-structural elements and decorative stones façades cladding. The collapse of these elements causes significant consequences that interest the social, the economic, the historical and the technical fields. Several regulatory documents and literature studies contain methods to address the question of relief and of the risk analysis and due to the non - structural stones security. Among the references are widespread international regulatory documents prepared by the Federal Emergency Management Agency of the United States by Applied Technology Council and California. In Italy there are some indications contained in the Norme Tecniche per le Costruzioni and the Direttiva del Presidente del Consiglio dei Ministri in 2007, finalize to the reduction of seismic risk assessment of cultural heritage. The paper, using normative references and scientific researches, allows to analyze on Royal Palace of Caserta the safety and the preservation of cultural heritage and the vulnerability of non-structural stones façade cladding. Using sophisticated equipments of Laboratory ARS of the Second University of Naples, it was possible to analyze the collapse of stone elements due to degradation caused by natural phenomena of deterioration (age of the building, type of materials, geometries , mode of fixing of the elements themselves). The paper explains the collapse mechanisms of stones façade cladding of Luigi Vanvitelli Palace.

  20. The Ups and Downs of Frogs.

    Science.gov (United States)

    Greene, Janice Schnake; Tamme, Tina

    2001-01-01

    Presents a science activity in which students simulate increases and decreases in frog populations to get a better understanding of different environmental issues affecting animal populations. Includes simulations for both natural frog populations as well as populations affected by human activities. (YDS)

  1. Semi-automated identification of leopard frogs

    Science.gov (United States)

    Petrovska-Delacrétaz, Dijana; Edwards, Aaron; Chiasson, John; Chollet, Gérard; Pilliod, David S.

    2014-01-01

    Principal component analysis is used to implement a semi-automatic recognition system to identify recaptured northern leopard frogs (Lithobates pipiens). Results of both open set and closed set experiments are given. The presented algorithm is shown to provide accurate identification of 209 individual leopard frogs from a total set of 1386 images.

  2. The Ups and Downs of Frogs.

    Science.gov (United States)

    Greene, Janice Schnake; Tamme, Tina

    2001-01-01

    Presents a science activity in which students simulate increases and decreases in frog populations to get a better understanding of different environmental issues affecting animal populations. Includes simulations for both natural frog populations as well as populations affected by human activities. (YDS)

  3. A comparative analysis of frog early development.

    Science.gov (United States)

    del Pino, Eugenia M; Venegas-Ferrín, Michael; Romero-Carvajal, Andrés; Montenegro-Larrea, Paola; Sáenz-Ponce, Natalia; Moya, Iván M; Alarcón, Ingrid; Sudou, Norihiro; Yamamoto, Shinji; Taira, Masanori

    2007-07-17

    The current understanding of Xenopus laevis development provides a comparative background for the analysis of frog developmental modes. Our analysis of development in various frogs reveals that the mode of gastrulation is associated with developmental rate and is unrelated to egg size. In the gastrula of the rapidly developing embryos of the foam-nesting frogs Engystomops coloradorum and Engystomops randi, archenteron and notochord elongation overlapped with involution at the blastopore lip, as in X. laevis embryos. In embryos of dendrobatid frogs and in the frog without tadpoles Eleutherodactylus coqui, which develop somewhat more slowly than X. laevis, involution and archenteron elongation concomitantly occurred during gastrulation; whereas elongation of the notochord and, therefore, dorsal convergence and extension, occurred in the postgastrula. In contrast, in the slow developing embryos of the marsupial frog Gastrotheca riobambae, only involution occurred during gastrulation. The processes of archenteron and notochord elongation and convergence and extension were postgastrulation events. We produced an Ab against the homeodomain protein Lim1 from X. laevis as a tool for the comparative analysis of development. By the expression of Lim1, we were able to identify the dorsal side of the G. riobambae early gastrula, which otherwise was difficult to detect. Moreover, the Lim1 expression in the dorsal lip of the blastopore and notochord differed among the studied frogs, indicating variation in the timing of developmental events. The variation encountered gives evidence of the modular character of frog gastrulation.

  4. Population Structure of the Raccoon Dog on the Grounds of the Imperial Palace, Tokyo, Revealed by Microsatellite Analysis of Fecal DNA.

    Science.gov (United States)

    Saito, Wataru; Amaike, Yosuke; Sako, Takako; Kaneko, Yayoi; Masuda, Ryuichi

    2016-10-01

    The raccoon dog (Nyctereutes procyonoides, Canidae, Carnivora) is highly adaptable to urban environments. Populations of carnivorans inhabiting urban areas sometimes differ ecologically and genetically from those in rural areas. However, there is little information on urban raccoon dogs. This study focused on raccoon dog populations in Tokyo, one of the most highly urbanized cities in the world. We examined the genotypes of 10 microsatellites for 101 fecal samples from raccoon dogs inhabiting the grounds of the Imperial Palace, a green space in central Tokyo. We successfully genotyped 58 samples originating from 31 individuals. We also analyzed muscle tissue samples from raccoon dogs from the grounds of the Imperial Palace, the Akasaka Imperial Grounds (a green space close to the Imperial Palace), and the surrounding urban area, and then investigated the genetic structure and diversity of these populations, and the genetic differentiation among them. The population on the grounds of the Imperial Palace was genetically differentiated from that in the Akasaka Imperial Grounds, suggesting that the roads and buildings act as barriers to gene flow. In addition, the population on the grounds of the Imperial Palace showed greater genetic difference from that in the surrounding area than that in the Akasaka Imperial Grounds. We speculate that the moats around the Imperial Palace restrict individual ranges within the palace grounds and limit migration and gene flow to other areas.

  5. Play Matters

    DEFF Research Database (Denmark)

    Sicart (Vila), Miguel Angel

    , but not necessarily fun. Play can be dangerous, addictive, and destructive. Along the way, Sicart considers playfulness, the capacity to use play outside the context of play; toys, the materialization of play--instruments but also play pals; playgrounds, play spaces that enable all kinds of play; beauty......, the aesthetics of play through action; political play -- from Maradona's goal against England in the 1986 World Cup to the hactivist activities of Anonymous; the political, aesthetic, and moral activity of game design; and why play and computers get along so well....

  6. Residencia Palace

    Directory of Open Access Journals (Sweden)

    Gellner, E.

    1963-12-01

    Full Text Available There are 35 apartments in this six storey block, their floor surface varying between 68 and 210 m2 The attic apartments occupy two floor levels. The apartments have the living room and main bedroom facing south, and only the secondary rooms are on the northern side. The smaller apartments are aligned along a corridor, and the secondary rooms, situated at a different level with respect to the main rooms, are ventilated and illuminated over the ceiling of the latter. The building has two wings, which are served by two independent stairs and lifts. A restaurant is provided on the ground floor, which leads out unto an extensive terrace. The external appearance of this block was made more interesting by breaking up the surface with a number of architectural features, such as overhanging balconies, pillars and brise soleils. Because of these devices, the building does not break up the countrified background too much, nor do the various coproprietors, who come to these flats to spend their holidays in the mountains, feel that they live in a cellular building, similar to their town dwellings.Se disponen 35 apartamentos—cuyas superficies varían entre las seis plantas; los del ático, se desarrollan en dos niveles. Todos ellos presentan la zona de estar y el dormitorio principal orientados al sur; solamente los ambientes secundarios miran al norte. Las unidades más pequeñas están alineadas a lo largo de un corredor, e iluminan y ventilan directamente los correspondientes servicios, aprovechando la diferencia de altura de techo del mismo. Los apartamentos están distribuidos en dos alas, independientemente servidas por escaleras y ascensores; en la planta baja hay un restaurante con una amplia terraza. Se ha logrado, plenamente, aligerar el aspecto exterior del notable volumen del edificio, fraccionando las fachadas, mediante diversas características arquitectónicas—celosías, pilastras, terrazas voladas, etcétera—. Con ello se ha conseguido, por una parte, que el edificio no pese y sea soportado por el ambiente paisajista que lo rodea; y por otra, que los propietarios de los apartamentos, aun funcionando en régimen de copropiedad—para sus vacaciones en la montaña—no se sientan ocupantes de células, como en las casas de la ciudad.

  7. Sugar Palace

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Xiwang Village in Zouping County leads rural China on a path of urbanization Although rural Zouping County is known as a "window of China"from which many foreign scholars got their first impressions of the country,

  8. The Civil Palaces in Gravina street, Alicante: building stones and salt weathering

    Directory of Open Access Journals (Sweden)

    Louis, M.

    2001-06-01

    Full Text Available This paper presents a study into the architecture and construction of the 18th Century Civil Palaces located in Gravina street (Provincial Museum of Fine Arts of Alicante, the building stones used and the mineral related decay processes that these materials have suffered. The original building stones and other stones used in subsequent restorations in these Civil Palaces are bioclastic limestones and/or calcarenites (San Julian Stone and Bateig Stone. Campello stone and other limestones are also present. Granular disintegration and alveolar weathering are the main forms of deterioration developed on the exterior of these Civil Palaces. These stone decay types are related to salt crystallisation, caused by sea spray salts and/or soil capillary waters. Halite is the most common salt found, probably due to the buildings' proximity to the coast. The halite is also present in indoor efflorescences. Gypsum is present in some efflorescences and ettringite on the inner face of the outdoor cladding stone. The cladding has been destroyed and replaced in the last restoration process.

    En este trabajo se realiza un estudio de la arquitectura, construcción y materiales utilizados en los Palacios Civiles del siglo XVIII, situados en la calle Gravina (actual sede del Museo Provincial de Bellas Artes de Alicante. Las rocas utilizadas en la construcción original así como las utilizadas en sustituciones posteriores en estos Palacios Civiles son calizas bioclásticas y/o calcarenitas (Piedra de San Julián y Piedra Bateig. También están presentes la Piedra de Campello y otras calizas. La disgregación granular y la erosión alveolar son las formas de alteración más abundantes en el exterior de estos Palacios Civiles. Estos tipos de alteración están relacionados con la cristalización de sales, procedentes del spray marino y/o de las aguas capilares del suelo. El NaCl es la sal más abundante debido a la proximidad de la costa. La

  9. Population density of tropical forest frogs: relation to retreat sites.

    Science.gov (United States)

    Stewart, M M; Pough, F H

    1983-08-05

    The forest frog Eleutherodactylus coqui defends specific sites for retreats and nests in the Luquillo Forest, Puerto Rico. The hypothesis that shortages of nest and retreat sites limit population size was tested by placing 100 bamboo frog houses in plots measuring 100 square meters in areas of high frog density. These new sites were readily adopted by adult frogs. After one year, experimental plots had significantly more nests and frogs of all sizes than did control plots.

  10. Acoustic Intervention in a Cultural Heritage: The Chapel of the Royal Palace in Caserta, Italy

    Directory of Open Access Journals (Sweden)

    Umberto Berardi

    2015-12-01

    Full Text Available The modern use of ancient heritage sites can be, to say the least, challenging from an acoustical perspective. In fact, modern needs may require acoustical interventions in contrast with the preservation issues of the cultural heritage. This paper deals with this topic in an UNESCO designated world heritage site, the Palatine Chapel of the Royal Palace in Caserta, Italy. Since this chapel is currently being used for meetings and music chamber concerts, the acoustical characteristics of the chapel, originally used for religious purposes, are investigated. Field measurements were undertaken to evaluate the acoustical performance of the empty chapel. The measurements were then used to calibrate and validate a computer simulation model. Different acoustical treatments are then considered and simulations are used to determine the related acoustical improvements. Finally, the benefits of different acoustical treatments which are respectful of the aesthetic and historical value of this cultural heritage are discussed.

  11. Playful Gaming.

    Science.gov (United States)

    Makedon, Alexander

    A philosophical analysis of play and games is undertaken in this paper. Playful gaming, which is shown to be a synthesis of play and games, is utilized as a category for undertaking the examination of play and games. The significance of playful gaming to education is demonstrated through analyses of Plato's, Dewey's, Sartre's, and Marcuse's…

  12. Adapting to confined and isolated environment: Emotional effects and countermeasures in LUNAR PALACE 1

    Science.gov (United States)

    Wang, Ya; Wu, Ruilin

    Most operations in manned spaceflight originate in mental work, and numerous factors in aerospace can cause psychological problems. Among these problems, negative emotions are the most important and critical. Confined isolated environment, limited communication with outside and unpredictable risks may lead to the aggravation and acceleration of depression, anxiety and monotony, which could deteriorate astronauts’ effectiveness and safety.Therefore, the aim of the study is to identify possible change rules over time of emotional states in 90-day isolation period. The experiment is conducted in an analogue space station in Beihang University called LUNAR PALACE 1, which forms 100 percent of carbon and oxygen cycle closed environment, containing one comprehensive cabin and one plant cabin. Three healthy subjects (so called crews) are selected in the research, and they are assigned to tasks every day to imitate astronaut schedule. In order to monitor their emotional states, all crews will complete a questionnaire named profile of mood states (POMS) every week. Considering the limitation of questionnaire survey, we employ another method of automatic analysis. We set a network camera in the staff room (for meal and entertainment) in comprehensive cabin, and the videos will be analyzed through FaceReader, a facial expressions recognition software, to indicate their emotions. In addition, interviews will also be conducted after the experiment isolation period.Previous researches have shown that mission positive impact on crews, support from outside psychologists and surgeons, or surprise presents and favorite foods act well to against negative effects of the Third quarter phenomenon, displacement and other conflictions. Beyond these countermeasures, in LUNAR PALACE 1 we used open network environment to increase crews’ communication with family or friends and provide them digital camera to record their daily life as a kind of recreation.From all these measures, we will

  13. Psychosocial interaction during a 105-day isolated mission in Lunar Palace 1

    Science.gov (United States)

    Wu, Ruilin; Wang, Ya

    2015-08-01

    As they are the most important and critical group in space missions, the crewmembers' emotions and interpersonal interactions have gained attention. The crewmembers are confined in an isolated environment, have limited communication with the outside world, and often undergo unpredictable risks, which may lead to the aggravation and acceleration of depression, displacement, and even interpersonal conflicts. These psychological factors could deteriorate the astronauts' effectiveness and safety. Therefore, the aim of the study is to identify the possible patterns over time regarding changes in the emotional states, cohesion and other group dynamics during a 105-day isolation period. The experiment was conducted in an analogue space station at Beihang University, referred to as Lunar Palace 1, which is the first crew made up of all Chinese members. In the experiment, all the crewmembers completed a profile of mood states (POMS) questionnaire every week, along with the group's environment scale (GES) and work environment scale (WES) every two weeks. Following the experiment's isolation period, semi-structured interviews were also conducted as qualitative data. As a result, the following observations were determined: 1) there was no 3rd quarter phenomenon observed during 80 days isolated experiment for Group 3; and the average positive emotions and cohesion of crew were gradually increased with the process. 2) Significant individual differences were identified; and crewmembers possessed different change patterns on psychological state. 3) Crew structure with 1 male and 2 female, less pre-mission team building, and collectivist culture might influence the psychosocial interaction of crew. In summary, the results from Lunar Palace 1 demonstrated that the emotions and climate of Group 3 was in a good state for a successful mission.

  14. 样式雷与颐和园%YANGSHI LEI AND SUMMER PALACE

    Institute of Scientific and Technical Information of China (English)

    张龙; 王其亨

    2011-01-01

    自雷声瀓至雷献彩,雷氏一门六代,前后150余年,见证了清漪园(颐和园)从始建、辉煌、衰败、焚毁到重生的全过程,其间留下了大量建筑图档。本文结合颐和园的实物遗存,及相关历史文献档案,利用建筑学、社会学和历史学的研究方法,再现清漪-颐和园发展历程,阐述了"世界记忆遗产样式雷建筑图档"核心责任人——样式雷,为颐和园这一世界文化遗产所做的独特贡献,揭示了中国古代建筑设计的家族传承性。%About 150 years, from Lei Shengcheng to Lei Xiancai there are together six generations of Lei's Family who witnessed the whole process of construction, resplendence, decline, burned and restoration of the Qingyi Garden (the former of Summer Palace). Meanwhile, great deals of archives were reserved. Based on the survivals and historical literature and archives, by the method of architectural, sociological and historical, the paper reviews the development process of Summer Palace, explains that Yangshi Lei the core responsibility people of "Memory of the World Heritage Yangshi Lei Archives" made an especial contribution to the development of the Summer Palace, and reveals the family inheritance of ancient Chinese architectural design.

  15. Behaviour of Australian rainforest stream frogs may affect the transmission of chytridiomycosis.

    Science.gov (United States)

    Rowley, Jodi J L; Alford, Ross A

    2007-08-13

    The amphibian disease chytridiomycosis, caused by the pathogen Batrachochytrium dendrobatidis, has been implicated in mass mortalities, population declines and extinctions of amphibians around the world. In almost all cases, amphibian species that have disappeared or declined due to chytridiomycosis coexist with non-declining species. One reason why some species decline from chytridiomycosis and others do not may be interspecific differences in behaviour. Host behaviour could either facilitate or hinder pathogen transmission, and transmission rates in the field are likely to vary among species according the frequency of factors such as physical contact between frogs, contact with infected water and contact with environmental substrates containing B. dendrobatidis. We tracked 117 frogs (28 Litoria nannotis, 27 L. genimaculata and 62 L. lesueuri) at 5 sites where B. dendrobatidis is endemic in the rainforest of tropical northern Queensland and recorded the frequency of frog-to-frog contact and the frequency of contact with stream water and environmental substrates. Frequency of contact with other frogs and with water were highest in L. nannotis, intermediate in L. genimaculata and lowest in L. lesueueri. Environmental substrate use also differed among species. These species-specific opportunities for disease transmission were correlated with conservation status: L. nannotis is the species most susceptible to chytridiomycosis-related declines and L. lesueuri is the least susceptible. Interspecific variation in transmission probability may, therefore, play a large role in determining why chytridiomycosis drives some populations to extinction and not others.

  16. Lbx1 expression and frog limb development.

    Science.gov (United States)

    Sabo, Michelle C; Nath, Kimberly; Elinson, Richard P

    2009-12-01

    In order to identify prospective limb muscle cells in a frog, we cloned Lbx1 from the direct developing frog Eleutherodactylus coqui. Like in embryos of the frog Xenopus laevis but unlike in other vertebrates, EcLbx1 is expressed in all trunk somites. Like in embryos of chick, mouse, and zebrafish, cells expressing EcLbx1 are then found in limb buds, consistent with migration of those cells from somites. EcLbx1 is also expressed in the dorsal spinal cord as in other vertebrates.

  17. Redescription of the Frog Bladder Fluke Gorgoderina attenuata from the Northern Leopard Frog, Rana pipiens

    National Research Council Canada - National Science Library

    Matthew G. Bolek; Scott D. Snyder; John Janovy Jr

    2009-01-01

    .... Morphological comparisons between gravid G. attenuata recovered from bullfrogs and northern leopard frogs indicated statistically significant differences in 11 of 28 morphological characters examined...

  18. Aesthetic Play

    DEFF Research Database (Denmark)

    Bang, Jytte Susanne

    2012-01-01

    to the children’s complex life-worlds. Further, this leads to an analysis of music-play activities as play with an art-form (music), which includes aesthetic dimensions and gives the music-play activities its character of being aesthetic play. Following Lev Vygotsky’s insight that art is a way of building life...

  19. Region 6 Northern Leopard Frog Information

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document contains a collection of completed questionnaires and related additional data regarding the status review of the northern leopard frog. On July 1,...

  20. Malformed frog survey Dahomey NWR - 2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Report contains field data sheets assoicated with malformed frog survey on Dahomey NWR in 2001. Work was done in support of regional sampling on refuges for...

  1. Frog Call Survey Summary 2002-2006

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Since 2002, Patuxent Research Refuge has conducted frog surveys on South Tract, Central Tract, and North Tract locations. These surveys are conducted by Patuxent...

  2. Internal fertilization in an oviparous frog.

    Science.gov (United States)

    Townsend, D S; Stewart, M M; Pough, F H; Brussard, P F

    1981-04-24

    Eleutherodactylus coqui, an oviparous frog, undergoes internal fertilization. If this mode of fertilization occurs in other species of anurans, interpretations of anuran reproductive strategies based on the assumption of external fertilization must be reviewed.

  3. Development of the pseudothumb in frogs

    Science.gov (United States)

    Tokita, Masayoshi; Iwai, Noriko

    2010-01-01

    Frogs have highly conserved hand and foot morphology, possessing four fingers and five toes. As an exception, two Japanese ranid frog species, the Otton frog Babina subaspera and the dagger frog Babina holsti, possess a unique thumb-like structure (the pseudothumb) in the forelimb, giving an appearance of a total of five fingers on the hand. To obtain insights into the developmental mechanisms that generate this novel character, we investigated the hand morphogenesis of the Otton frog. The unique morphological pattern of the pseudothumb was already established in juveniles. Surprisingly, the bud-like structure, which is similar to the area of inductive activity (e.g. feather buds in birds and the carapacial ridge in turtles), was detected over the site where the future prepollex develops in larvae. By contrast, this bud-like structure was not found in larvae of other ranid species. We discuss possible scenarios that would favour the evolution of this very unusual trait in frogs. PMID:20147308

  4. THE TILES FROM THE STOVES OF K. ROZUMOVSKYI’S PALACE AND PARK ENSEMBLE IN BATURYN HISTORICAL AND CULTURAL PRESERVE

    Directory of Open Access Journals (Sweden)

    М. А. Герасько

    2013-10-01

    Full Text Available The theme of this article is the research of the artistic design of the heating system of K. Rozumovskyi’s palace in Baturyn. The object of the research of this theme is thorough study of the production and application of Baturyn tiles in the heating system of the last Ukrainian hetman’s palace. The method of the research of this theme is study of the written sources: the archival documents, the reports of the archaeological expeditions, popular scientific literature, the periodical press and study of the explored material (tiles, made the visual comparative analysis, visiting the museums of local lore. The results of the research can be used in the study of the tiles production and their application in the artistic design of the stove system heating in the 2nd half of the ХVІІІ –beginning ХІХ cent.Purchase on Elibrary.ru > Buy now

  5. Tool path planning of hole-making operations in ejector plate of injection mould using modified shuffled frog leaping algorithm

    Directory of Open Access Journals (Sweden)

    Amol M. Dalavi

    2016-07-01

    Full Text Available Optimization of hole-making operations in manufacturing industry plays a vital role. Tool travel and tool switch planning are the two major issues in hole-making operations. Many industrial applications such as moulds, dies, engine block, automotive parts etc. requires machining of large number of holes. Large number of machining operations like drilling, enlargement or tapping/reaming are required to achieve the final size of individual hole, which gives rise to number of possible sequences to complete hole-making operations on the part depending upon the location of hole and tool sequence to be followed. It is necessary to find the optimal sequence of operations which minimizes the total processing cost of hole-making operations. In this work, therefore an attempt is made to reduce the total processing cost of hole-making operations by applying relatively new optimization algorithms known as shuffled frog leaping algorithm and proposed modified shuffled frog leaping algorithm for the determination of optimal sequence of hole-making operations. An industrial application example of ejector plate of injection mould is considered in this work to demonstrate the proposed approach. The obtained results by the shuffled frog leaping algorithm and proposed modified shuffled frog leaping algorithm are compared with each other. It is seen from the obtained results that the results of proposed modified shuffled frog leaping algorithm are superior to those obtained using shuffled frog leaping algorithm.

  6. From Virtual Frog to Frog Island: Design Studies in a Development Project.

    Science.gov (United States)

    Dev, Parvati; Walker, Decker F.

    1999-01-01

    Explores the efforts of a curriculum development team who set out to create a virtual frog for use in biology education, but instead, after several design studies, developed a virtual world called Frog Island. Argues for incorporating educational design studies into other educational development projects. (CMK)

  7. Expression of steroidogenic factor-1 in frog embryo and developing gonad.

    Science.gov (United States)

    Kawano, K; Furusawa, S; Matsuda, H; Takase, M; Nakamura, M

    2001-07-01

    Steroidogenic factor-1 (SF-1), originally identified as an orphan nuclear receptor that regulates expression of genes encoding cytochrome P-450 steroid hydroxylases, is an essential transcriptional factor for adrenal and gonadal development in mammals. Since sex steroid hormones have been shown to play important roles in the sex determination of frogs, it is of interest to know how SF-1 gene expression is regulated during the sexual development of this organism. A previous study isolated the cDNA of the frog Rana rugosa SF-1 (rrSF-1) and found sexual differences in its gene expression in adult frogs; positive in testis and negative in ovary (Kawano et al., 1998). This study examined rrSF-1 gene expression in frog embryos and developing and mature gonads by immunohistochemical staining using anti-rrSF-1 protein antibody for protein localization and by in situ hybridization analysis for mRNA transcription. The results obtained in this study indicated that cells expressing SF-1 that originate in the mesoderm and endoderm probably migrate into the developing gonad via the dorsal mesentery, genital ridge, and mesorchium or mesovarium. Thus, SF-1 may play an important role in gonadal development in amphibians.

  8. The Interdisciplinary Research of Virtual Recovery and Simulation of Heritage Buildings. Take Lingzhao Xuan in the Palace Museum as an Example

    Directory of Open Access Journals (Sweden)

    Liyu Fang

    2014-12-01

    Full Text Available Due to natural disasters, economic development, tourism development and other factors, many precious heritage buildings have been in endangered situation. How to protect, research and develop these heritage resources effectively has become very urgent and important. Three-dimensional (3D digital technology plays a more and more important role in protecting and using cultural heritage. The article will take the synthetic study on the mode of virtual construction, recovery, simulation and exhibition of Lingzhao Xuan (a heritage building which stopped construction for some reason in the Palace Museum as an example to explore and summary an effective interdisciplinary cooperation mode. Besides, we broaden and deepen the concept of “virtual recovery”, and add the concept “virtual simulation” by means of virtual design and the new achievements which are created by such mode for the first time. This research is aimed to provide reference for the standard application of 3D digital technology and perfect the protection work of heritage buildings.

  9. Aesthetic Play

    DEFF Research Database (Denmark)

    Bang, Jytte Susanne

    2012-01-01

    The present article explores the role of music-related artefacts and technologies in children’s lives. More specifically, it analyzes how four 10- to 11-year old girls use CDs and DVD games in their music-play activities and which developmental themes and potentials may accrue from such activities...... to the children’s complex life-worlds. Further, this leads to an analysis of music-play activities as play with an art-form (music), which includes aesthetic dimensions and gives the music-play activities its character of being aesthetic play. Following Lev Vygotsky’s insight that art is a way of building life...

  10. Playful Membership

    DEFF Research Database (Denmark)

    Åkerstrøm Andersen, Niels; Pors, Justine Grønbæk

    2014-01-01

    This article studies the implications of current attempts by organizations to adapt to a world of constant change by introducing the notion of playful organizational membership. To this end we conduct a brief semantic history of organizational play and argue that when organizations play, employees...... are expected to engage in playful exploration of alternative selves. Drawing on Niklas Luhmann's theory of time and decision-making and Gregory Bateson's theory of play, the article analyses three empirical examples of how games play with conceptions of time. We explore how games represent an organizational...... desire to reach out - not just to the future - but to futures beyond the future presently imaginable. The article concludes that playful membership is membership through which employees are expected to develop a surplus of potential identities and continuously cross boundaries between real and virtual...

  11. Biodeterioration of the Lions Fountain at the Alhambra Palace, Granada (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Sarro, M. Isabel; Garcia, Ana M.; Rivalta, Victor M.; Moreno, Diego A. [Universidad Politecnica de Madrid, Escuela Tecnica Superior de Ingenieros Industriales, Jose Gutierrez Abascal, Madrid (Spain). Departamento de Ingenieria y Ciencia de los Materiales; Arroyo, Irene [Instituto del Patrimonio Historico Espanol, Ministerio de Cultura, El Greco, Madrid (Spain)

    2006-12-15

    Stone works of art exposed to the environment are liable to be deteriorated by the action of biological agents such as bacteria, fungi, mosses, etc. In ornamental fountains, the microorganisms present in water can contribute to these biodeterioration processes. This paper assesses the biodeterioration experienced by the Lions Fountain at the Alhambra Palace in Granada (Spain). Analyses have been made of the biodeterioration of Lions 4, 5 and 9, the biofouling of the fountain basin, and the water supply system. Conventional and molecular biology techniques have identified microorganisms belonging to various microbial groups ({alpha}-, {beta}- and {gamma}-Protebacteria, Chlamydiae/Verrucomicrobia and Eukaryota). Additionally, on the mortar in the sculptures the presence of algae and bryophytes has been observed. X-ray diffraction allowed both the detection of neoformation mineral products that can be related with the presence of microorganisms and the corrosion products in the Lions Fountain. A number of recommendations are made regarding the prevention and control of biodeterioration in this important work of art. (author)

  12. 49 CFR 213.139 - Spring rail frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Spring rail frogs. 213.139 Section 213.139..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.139 Spring rail frogs. (a) The... wing rail shall be solidly tamped and fully and tightly bolted. (c) Each frog with a bolt hole defect...

  13. 49 CFR 213.141 - Self-guarded frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Self-guarded frogs. 213.141 Section 213.141..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.141 Self-guarded frogs. (a) The raised guard on a self-guarded frog shall not be worn more than three-eighths of an inch. (b) If repairs...

  14. Playful Literacy

    DEFF Research Database (Denmark)

    Froes, Isabel

    2017-01-01

    these practices, which compose the taxonomy of tablet play. My contribution lies in identifying and proposing a series of theoretical concepts that complement recent theories related to play and digital literacy studies. The data collected through observations informed some noteworthy aspects, including how...... with tablets’ physical and digital affordances shape children’s digital play. This thesis presents how young children’s current practices when playing with tablets inform digital experiences in Denmark and Japan. Through an interdisciplinary lens and a grounded theory approach, I have identified and mapped...... vocabulary in children’s digital play experiences. These early digital experiences set the rules for the playgrounds and assert digital tablets as twenty-first-century toys, shaping young children’s playful literacy....

  15. Pain perception and anaesthesia in research frogs.

    Science.gov (United States)

    Guénette, Sarah Annie; Giroux, Marie-Chantal; Vachon, Pascal

    2013-01-01

    Frogs possess pain receptors and pathways that support processing and perception of noxious stimuli however the level of organization is less well structured compared to mammals. It was long believed that the experience of pain was limited to 'higher' phylums of the animal kingdom. However, it is now commonly accepted that amphibians possess neuro-anatomical pathways conductive of a complete nociceptive experience. Xenopus laevis frogs have been one of the most popular aquatic research models for developmental studies and genetic research. These frogs have been extensively use in research for their eggs, that can be collected following hormonal stimulation either naturally or by surgical intervention. Many anaesthetics have been used in amphibians such as bath solutions of MS-222, benzocaine and eugenol as well as systemic injections of ketamine or tiletamine, barbiturates, propofol and gas administrations of methoxyflurane, halothane and isoflurane. Most of these anaesthetic drugs produce variability in depth and duration of anaesthesia. MS-222 appears to be one of the most reliable anaesthetics. This review will focus on the evidence of pain perception in frogs and will compare the effectiveness and limitations of different anaesthetics used in Xenopus leavis frogs.

  16. Pretend play.

    Science.gov (United States)

    Weisberg, Deena Skolnick

    2015-01-01

    Pretend play is a form of playful behavior that involves nonliteral action. Although on the surface this activity appears to be merely for fun, recent research has discovered that children's pretend play has connections to important cognitive and social skills, such as symbolic thinking, theory of mind, and counterfactual reasoning. The current article first defines pretend play and then reviews the arguments and evidence for these three connections. Pretend play has a nonliteral correspondence to reality, hence pretending may provide children with practice with navigating symbolic relationships, which may strengthen their language skills. Pretend play and theory of mind reasoning share a focus on others' mental states in order to correctly interpret their behavior, hence pretending and theory of mind may be mutually supportive in development. Pretend play and counterfactual reasoning both involve representing nonreal states of affairs, hence pretending may facilitate children's counterfactual abilities. These connections make pretend play an important phenomenon in cognitive science: Studying children's pretend play can provide insight into these other abilities and their developmental trajectories, and thereby into human cognitive architecture and its development.

  17. Playful Interaction

    DEFF Research Database (Denmark)

    2003-01-01

    The video Playful Interaction describes a future architectural office, and envisions ideas and concepts for playful interactions between people, materials and appliances in a pervasive and augmented working environment. The video both describes existing developments, technologies and designs...... as well as ideas not yet implemented such as playful modes of interaction with an augmented ball. Playful Interaction has been used as a hybrid of a vision video and a video prototype (1). Externally the video has been used to visualising our new ideas, and internally the video has also worked to inspire...

  18. Mediatized play

    DEFF Research Database (Denmark)

    Johansen, Stine Liv

    Children’s play must nowadays be understood as a mediatized field in society and culture. Media – understood in a very broad sense - holds severe explanatory power in describing and understanding the practice of play, since play happens both with, through and inspired by media of different sorts....... In this presentation the case of ‘playing soccer’ will be outlined through its different mediated manifestations, including soccer games and programs on TV, computer games, magazines, books, YouTube videos and soccer trading cards....

  19. Play practices and play moods

    DEFF Research Database (Denmark)

    Karoff, Helle Skovbjerg

    2013-01-01

    The aim of this article is to develop a view of play as a relation between play practices and play moods based on an empirical study of children's everyday life and by using Bateson's term of ‘framing’ [(1955/2001). In Steps to an ecology of mind (pp. 75–80). Chicago: University of Chicago Press......], Schmidt's notion of ‘commonness’ [(2005). Om respekten. København: Danmarks Pædagogiske Universitets Forlag; (2011). On respect. Copenhagen: Danish School of Education University Press] and Heidegger's term ‘mood’ [(1938/1996). Time and being. Cornwall: Wiley-Blackwell.]. Play mood is a state of being...... in which we are open and ready, both to others and their production of meaning and to new opportunities for producing meaning. This play mood is created when we engage with the world during play practices. The article points out four types of play moods – devotion, intensity, tension and euphorica – which...

  20. Survey and Excavation of the Palace-city and the Roads in the Periphery of the Palace Area within the Erlitou Site in Yanshi City, Henan%河南偃师市二里头遗址宫城及宫殿区外围道路的勘察与发掘

    Institute of Scientific and Technical Information of China (English)

    中国社会科学院考古研究所二里头工作队

    2004-01-01

    On the Erlitou site, a palace-city and a network of roads in its periphery have been discovered in recent years. The main road functioned continuously from the early to the late stage of Erlitou culture. The palace-city has a plan in the shape of a vertical rectangle and occupies an area of about 108,000 sq m. It was built at the turn from the second to the third phase of the Erlitou culture and existed to the fourth phase or a little later. This is the remains of the earliest palace-city known so far in China. Among the other important findings are wheel tracks of the early Erlitou culture and turquoise-containiing waist pits of the late Erlitou. The discovery of the palace-city and road network suggests that the Erlitou site is left over from a city large in size and neat in layout.

  1. The propeller and the frog

    CERN Document Server

    Pan, Margaret

    2010-01-01

    "Propellers" in planetary rings are disturbances in ring material excited by moonlets that open only partial gaps. We describe a new type of co-orbital resonance that can explain the observed non-Keplerian motions of propellers. The resonance is between the moonlet underlying the propeller, and co-orbiting ring particles downstream of the moonlet where the gap closes. The moonlet librates within the gap about an equilibrium point established by co-orbiting material and stabilized by the Coriolis force. In the limit of small libration amplitude, the libration period scales linearly with the gap azimuthal width and inversely as the square root of the co-orbital mass. The new resonance recalls but is distinct from conventional horseshoe and tadpole orbits; we call it the "frog" resonance, after the relevant term in equine hoof anatomy. For a ring surface density and gap geometry appropriate for the propeller Bl\\'eriot in Saturn's A ring, our theory predicts a libration period of ~4 years, similar to the ~3.7 yea...

  2. FROG The Fast and Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light ($<3\\textrm{MB}$) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  3. FROG The Fast and Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light ($<3\\textrm{MB}$) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  4. FROG: The Fast & Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light (<3 MB) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  5. The Frog Inner Ear: Picture Perfect?

    OpenAIRE

    Mason, Matthew James; Segenhout, Johannes M.; Cobo-Cuan, Ariadna; Quiñones, Patricia M.; van Dijk, Pim

    2015-01-01

    This is the accepted manuscript of a paper published in the Journal of the Association for Research in Otolaryngology (2015) DOI: 10.1007/s10162-015-0506-z Many recent accounts of the frog peripheral auditory system have reproduced Wever’s (1973) schematic cross-section of the ear of a leopard frog. We sought to investigate to what extent this diagram is an accurate and representative depiction of the anuran inner ear, using three-dimensional reconstructions made from serial sections of Ra...

  6. Birds and frogs in mathematics and physics

    Energy Technology Data Exchange (ETDEWEB)

    Dyson, Freeman J [Institute for Advanced Study, Princeton, NJ (United States)

    2010-11-15

    Some scientists are birds, others are frogs. Birds fly high in the air and survey broad vistas of mathematics out to the far horizon. They delight in concepts that unify our thinking and bring together diverse problems from different parts of the landscape. Frogs live in the mud below and see only the flowers that grow nearby. They delight in the details of particular objects, and they solve problems one at a time. A brief history of mathematics and its applications in physics is presented in this article. (from the history of physics)

  7. Effects of predatory fish on survival and behavior of larval gopher frogs (Rana capito) and Southern Leopard Frogs (Rana sphenocephala)

    Science.gov (United States)

    Gregoire, D.R.; Gunzburger, M.S.

    2008-01-01

    Southern Leopard Frogs, Rana sphenocephala, are habitat generalists occurring in virtually all freshwater habitats within their geographic range, whereas Gopher Frogs, Rana capito, typically breed in ponds that do not normally contain fish. To evaluate the potential for predation by fish to influence the distribution of these species, we conducted a randomized factorial experiment. We examined the survival rate and behavior of tadpoles when exposed to Warmouth Sunfish, Lepomis gulosus, Banded Sunfish, Enneacanthus obesus, and Eastern Mosquitofish, Gambusia holbrooki. We also conducted a choice experiment to examine the survival rate of the two species of tadpoles when a predator is given a choice of both species simultaneously. Lepomis gulosus consumed the most tadpoles and ate significantly more tadpoles of R. capito than R. sphenocephala. Gambusia holbrooki injured the most tadpoles, especially R. capito. Enneacanthus obesus did not have an effect on behavior or survival of either anuran species. Tadpoles of both anurans increased hiding when in the presence of L. gulosus and G. holbrooki, but a greater proportion of R. capito hid than did R. sphenocephala. Our results suggest that R. capito are more vulnerable to predation by fish than are R. sphenocephala. The introduction of fish may play a role in population declines of certain anurans breeding in normally fish-free wetlands, and even small fish, such as mosquitofish, may have significant negative effects on the tadpoles of R. capito. Copyright 2008 Society for the Study or Amphibians and Reptiles.

  8. Playful Organizations

    DEFF Research Database (Denmark)

    Pors, Justine Grønbæk; Åkerstrøm Andersen, Niels

    2015-01-01

    and undecidability. With an empirical point of departure in Danish public school policy and two concrete examples of games utilised in school development, the article analyses how play is a way for organisations to simultaneously decide and also avoid making a decision, thus keeping flexibility and possibilities...... intact. In its final sections, the article discusses what happens to conditions of decision-making when organisations do not just see undecidability as a given condition, but as a limited resource indispensable for change and renewal. The article advances discussions of organisational play by exploring......This article explores how organisational play becomes a managerial tool to increase and benefit from undecidability. The article draws on Niklas Luhmann's concept of decision and on Gregory Bateson's theory of play to create a conceptual framework for analysing the relation between decision...

  9. Geomechanical Investigations for Architectural Heritage Preservation. The Habib Sakakini Palace in Cairo, Egypt

    Directory of Open Access Journals (Sweden)

    Sayed HEMEDA

    2013-03-01

    Full Text Available The understanding of the geotechnical problems and failure mechanisms of stone structures of Sakakini palace (1897 AC entails a comprehensive study on the mechanical behavior of the stones and other construction materials. In addition to micro analysis, geological and geomorphologic interests, several investigations on stone deterioration and engineering geology were performed. First phase included more advanced techniques, which provided additional information on particular aspects of site deterioration and it included laser analysis (LIBS, electron probe micro analysis, micro XRD and XRF analyses, scanning electron microscope analysis coupled with EDX probing, transmission electron microscopy and grain size distribution analysis, permeability and pore size distribution of stone, mortars, core binders and other construction materials. Second phase included the determination of mechanical properties of building stones, such as compressive strength, modulus of elasticity, tensile strength, and shear strength. To obtain reliable values for these properties, a suitable number of samples should be extracted, prepared for testing, and properly tested. The test results are then analyzed to establish the investigated stone properties. The testing program includes extracting seven cylindrical cores from the basement stone walls of Sakakini’s mansion in down town Cairo. The objectives of the study are to provide a characterization of micro structures and the mechanical properties of the stones of Sakakini’s Mansion; The purpose of the present research is to provide recommendations regarding the strengthening and the safety of architectural heritage under long and short-term loading. For this purpose, a set of experimental tests and of advanced numerical analyses are to be carried out.

  10. Parenting for Autism, Language, And Communication Evaluation Study (PALACES): protocol for a pilot randomised controlled trial

    Science.gov (United States)

    Williams, Margiad Elen; Hastings, Richard; Charles, Joanna Mary; Evans, Sue; Hutchings, Judy

    2017-01-01

    Introduction Children with autistic spectrum disorder (ASD) often have associated behavioural difficulties that can present a challenge for parents and parenting. There are several effective social learning theory-based parenting programmes for dealing with behavioural difficulties, including the Incredible Years (IY) parent programmes. However, these programmes typically do not specifically target parents of children with ASD. Recently, a new addition to the IY suite of programmes known as the IY Autistic Spectrum and Language Delays (IY-ASLD) parent programme was developed. The main aims of the present study are to examine the feasibility of delivering this programme within child health services and to provide initial evidence for effectiveness and economic costs. Methods and analysis The Parenting for Autism, Language, And Communication Evaluation Study (PALACES) trial is a pragmatic, multicentre, pilot randomised controlled trial comparing the IY-ASLD programme with a wait-list control condition. 72 parents of children with ASD (aged 3–8 years) will be randomly allocated to either the intervention or control condition. Data will be collected prior to randomisation and 6 months postrandomisation for all families. Families in the intervention condition only will also be followed up at 12 and 18 months postrandomisation. This study will provide initial evidence of effectiveness for the newly developed IY-ASLD parenting programme. It will also add to the limited economic evidence for an intervention targeting parents of children with ASD and provide longer term data, an important component for evaluations of parenting programmes. Ethics and dissemination Approval for the study was granted by the Research Ethics Committee at the School of Psychology, Bangor University (reference number: 2016–15768) and the North Wales Research Ethics Committee, UK (reference number: 16/WA/0224). The findings will be disseminated through research conferences and peer

  11. A Leap-Frog Discontinuous Galerkin Method for the Time-Domain Maxwell's Equations in Metamaterials

    Energy Technology Data Exchange (ETDEWEB)

    Li, J., Waters, J. W., Machorro, E. A.

    2012-06-01

    Numerical simulation of metamaterials play a very important role in the design of invisibility cloak, and sub-wavelength imaging. In this paper, we propose a leap-frog discontinuous Galerkin method to solve the time-dependent Maxwell’s equations in metamaterials. Conditional stability and error estimates are proved for the scheme. The proposed algorithm is implemented and numerical results supporting the analysis are provided.

  12. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs.

    Science.gov (United States)

    Robovska-Havelkova, Pavla; Aerts, Peter; Rocek, Zbynek; Prikryl, Tomas; Fabre, Anne-Claire; Herrel, Anthony

    2014-10-15

    Frog locomotion has attracted wide scientific interest because of the unusual and derived morphology of the frog pelvic girdle and hind limb. Previous authors have suggested that the design of the frog locomotor system evolved towards a specialized jumping morphology early in the radiation of the group. However, data on locomotion in frogs are biased towards a few groups and most of the ecological and functional diversity remains unexplored. Here, we examine the kinematics of swimming in eight species of frog with different ecologies. We use cineradiography to quantify movements of skeletal elements from the entire appendicular skeleton. Our results show that species with different ecologies do differ in the kinematics of swimming, with the speed of limb extension and especially the kinematics of the midfoot being different. Our results moreover suggest that this is not a phylogenetic effect because species from different clades with similar ecologies converge on the same swimming kinematics. We conclude that it is important to analyze frog locomotion in a broader ecological and evolutionary context if one is to understand the evolutionary origins of this behavior.

  13. At Home with Durga: The Goddess in a Palace and Corporeal Identity in Rituparno Ghosh’s Utsab

    Directory of Open Access Journals (Sweden)

    Romita Ray

    2014-03-01

    Full Text Available In this article, I examine the representational strategies used to visualize the pratima (deity of the Hindu goddess, Durga, as a paradigm of time, memory, and corporeal identity, in Rituparno Ghosh’s 2000 Bengali film Utsab. I analyze the body as a dynamic site of memory-formation that shapes new histories in the sprawling colonial palace in which the film’s narrative unfolds with an ancestral Durga festival as its focal point. To this end, I look at how the body of the goddess produces and defines the transience of human experience, the fragility of material history, and the desire for historic relevance.

  14. Odorous and Non-Fatal Skin Secretion of Adult Wrinkled Frog (Rana rugosa) Is Effective in Avoiding Predation by Snakes

    Science.gov (United States)

    Yoshimura, Yuri; Kasuya, Eiiti

    2013-01-01

    The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa) has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes’ responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping) behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes. PMID:24278410

  15. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa is effective in avoiding predation by snakes.

    Directory of Open Access Journals (Sweden)

    Yuri Yoshimura

    Full Text Available The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  16. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa) is effective in avoiding predation by snakes.

    Science.gov (United States)

    Yoshimura, Yuri; Kasuya, Eiiti

    2013-01-01

    The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa) has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping) behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  17. Group play

    DEFF Research Database (Denmark)

    Tychsen, Anders; Hitchens, Michael; Brolund, Thea

    2008-01-01

    of group dynamics, the influence of the fictional game characters and the comparative play experience between the two formats. The results indicate that group dynamics and the relationship between the players and their digital characters, are integral to the quality of the gaming experience in multiplayer......Role-playing games (RPGs) are a well-known game form, existing in a number of formats, including tabletop, live action, and various digital forms. Despite their popularity, empirical studies of these games are relatively rare. In particular there have been few examinations of the effects...... of the various formats used by RPGs on the gaming experience. This article presents the results of an empirical study, examining how multi-player tabletop RPGs are affected as they are ported to the digital medium. Issues examined include the use of disposition assessments to predict play experience, the effect...

  18. ICT-enabled Service Design Suitable for Museums – The Case of the iPalace Channel of the National Palace Museum in Taipei 適用於博物館的資通訊化服務設計─以故宮iPalace 頻道為例

    Directory of Open Access Journals (Sweden)

    黃馨瑩、趙依庭、蔡瑞煌 Shin-Ying Huang, Yiting Chao, Rua-Huan Tsaih

    2013-09-01

    Full Text Available In the service economy, the information and communication technologies (ICT have become more popular and the service of the National Palace Museum (NPM is evolving to be customer-oriented, innovative, and ICT-enabled. This study takes the case of iPalace channel of NPM to explore the suitable communication tool for designing such new ICT-enabled services. This study integrates approaches from the disciplines of service and system engineering to derive such a communication tool for the iPalace channel. Specifically, the proposed communication tool helps the designer comprehensively describe the following three parts: the ICT-enabled service blueprint, the interface table of ICT-enabled service encounter, and the pseudo code of the middle-office and back-office activities that cross the intra -organizational business processes and the inter-organizational workflows. Application results confirm that the proposed communication tool for the iPalace channel can be accepted by the senior managers of NPM, and can effectively and efficiently facilitate the prototype implementation of iPalace channel. pp. 90-105在服務經濟的時代, 由於資通訊科技(Information and Communication Technologies, ICT)的蓬勃發展,國立故宮博物院(以下簡稱故宮)的服務正逐步朝向顧客導向的、創新的、資通訊化的(ICT-enabled)方向發展。本研究以故宮的一個躍進的(radical)資通訊化服務創新─故宮頻道(iPalace channel)─為實例,來說明適用於開發此類型之資通訊化服務,且兼具概���與操作指引的溝通工具設計。本研究整合服務學門與資訊系統學門的設計理論,提出下列之溝通工具:(1)資通訊化服務藍圖(ICT-enabled service blueprint),以顯示服務體系中有關資通訊科技應用的部分之設計藍圖;(2)服務介面表(Interface table of service encounter),以顯示服務體系中有關資通訊

  19. Water Frogs, Aquariums, and Salmonella -- Oh My!

    Centers for Disease Control (CDC) Podcasts

    2009-12-09

    This CDC Kidtastics podcast discusses how people can get Salmonella from water frogs and aquariums.  Created: 12/9/2009 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 12/9/2009.

  20. Frog egg growth, experiment S003

    Science.gov (United States)

    Young, R. S.; Tremor, J. W.

    1971-01-01

    The objective of experiment was to determine the effect of weightlessness on the ability of a fertilized frog egg to divide normally and to differentiate and form a normal embryo. This experiment was first attempted on the Gemini 8 mission and was completed only partially because of the early termination of that mission.

  1. Female frogs send ultrasonic signals for courtship

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ During their studies of Odorrana tormota,a frog species with recessed tympanic membranes,CAS researchers have found that females go ultrasonic during courtship,revealing an amazingly system for communication.The work was reported online on 8 May by Nature.

  2. Tracking Frogs that sing ultrasonic duet

    Institute of Scientific and Technical Information of China (English)

    XIN Ling

    2009-01-01

    @@ In central China, unique frogs talk by emitting ultrasonic calls, male to show their virility and female for courtship, which are received by tunable ears with amazing accuracy. Prof. SHEN Junxian from the CAS Institute of Biophysics and his collaborators are working diligently to explore the mysteries of unique sound communication in animal kingdom.

  3. Postphenomenological Play

    DEFF Research Database (Denmark)

    Hammar, Emil

    This paper aims to identify an understanding of digital games in virtual environments by using Don Ihde’s (1990) postphenomenological approach to how technology mediates the world to human beings in conjunction with Hans-Georg Gadamer’s (1993) notion of play . Through this tentatively proposed...... amalgamation of theories I point towards an alternative understanding of the relationship between play and game as not only dialectic, but also as socially and ethically relevant qua the design and implementation of the game as technology....

  4. The hormonal regulation of color changes in the sexually dichromatic frog Buergeria robusta.

    Science.gov (United States)

    Tang, Zih-Jing; Lue, Sheng-I; Tsai, May-Jywan; Yu, Teng-Lang; Thiyagarajan, Varadharajan; Lee, Chia-Hun; Huang, Wei-Tung; Weng, Ching-Feng

    2014-01-01

    During the breeding season, dynamic changes in body coloration are regularly observed in the male brown tree frog Buergeria robusta. This study investigated the hypothesis that this sexual dichromatism in male B. robusta is mediated through hormonal regulation. Frogs were exogenously injected with testosterone (T) or estradiol (E2). This manipulation revealed that the body coloration (hue, brightness, and saturation) of the male frog increased significantly (i.e., the brilliant yellow color developed) in response to T but not in response to E2. Concurrently, the levels of expression of brain-derived neurotrophic factor (BDNF) and pituitary adenylate cyclase-activating polypeptide (PACAP) in the pituitary gland were reduced in frogs whose coloration was pale brown on a yellow background. In particular, the weakest expressions of BDNF, PACAP, and PACAP type II receptors (VPAC-1R) were found in male frogs with a brilliant yellow body color during the breeding season regardless of background color. These changes may decrease α-melanocyte-stimulating hormone production associated with the PACAP receptors (VPAC-1R), resulting in the aggregation of black pigment in melanophores and the production of a brilliant yellow body color. The effects of hormones on skin coloration were further examined in isolated skin in vitro. The results of this investigation showed that the dispersion of xanthophores was stimulated by T or prolactin (PRL) and that the melanophores were aggregated by melatonin (MEL) but not by E2. Furthermore, yellow pigments in the xanthophores were significantly dispersed following the PRL+T treatment. In the T+MEL, PRL+MEL, and T+PRL+MEL treatments, xanthophores were dispersed, and melanophores were aggregated and subsequently moved to the low spongiosum layer of the dorsal skin, causing the increase in yellow coloration. These results reveal that multiple hormones play major roles in the regulation of the brilliant yellow coloration of male B. robusta by

  5. Los nuevos prosumidores: audiencias de la televisión social. Análisis de Operación Palace en Twitter / The new prosumers: social televisión audience. Operacion Palace analisys on Twitter

    Directory of Open Access Journals (Sweden)

    Eva Mª Ferreras Rodríguez

    2014-12-01

    Full Text Available En esta contribución se presentan las mediciones sobre la repercusión en Twitter del programa Operación Palace: la verdadera historia del 23f’ emitido en La Sexta el pasado 23 de febrero. Se pretende conocer la actividad de varios perfiles, etiquetas y usuarios. Para realizar el seguimiento se ha utilizado la herramienta creada por la empresa Pirendo. España es uno de los países que registra mayor índice de comentarios en Twitter sobre programas de televisión durante el prime time y Salvados, programa vinculado a este ‘especial’ documental es uno de las emisiones que más impacto consigue en las redes. Así podremos conocer su estrategia, presencia e interacciones en la red Twitter. Abstract Measurements on the impact on Twitter of the Operation Palace: the true story of 23f' program broadcast in the Sixth February 23 are presented in this contribution. It aims to determine the activity of various profiles, tags, and users. To track the activity a tool created by a company called Pirendo has been used. Spain is one of the countries with highest rate of comments on Twitter during the prime time on TV, and Salvados, program linked to this 'special' documentary, is one of the times with most impact achieved in networks. Therefore, we can know their strategy, presence and interactions in the Twitter network.

  6. Clay Play

    Science.gov (United States)

    Rogers, Liz; Steffan, Dana

    2009-01-01

    This article describes how to use clay as a potential material for young children to explore. As teachers, the authors find that their dialogue about the potential of clay as a learning medium raises many questions: (1) What makes clay so enticing? (2) Why are teachers noticing different play and conversation around the clay table as compared to…

  7. Group play

    DEFF Research Database (Denmark)

    Tychsen, Anders; Hitchens, Michael; Brolund, Thea

    2008-01-01

    Role-playing games (RPGs) are a well-known game form, existing in a number of formats, including tabletop, live action, and various digital forms. Despite their popularity, empirical studies of these games are relatively rare. In particular there have been few examinations of the effects of the v......Role-playing games (RPGs) are a well-known game form, existing in a number of formats, including tabletop, live action, and various digital forms. Despite their popularity, empirical studies of these games are relatively rare. In particular there have been few examinations of the effects...... of the various formats used by RPGs on the gaming experience. This article presents the results of an empirical study, examining how multi-player tabletop RPGs are affected as they are ported to the digital medium. Issues examined include the use of disposition assessments to predict play experience, the effect...... RPGs, with the first being of greater importance to digital games and the latter to the tabletop version....

  8. Embryo Development of Tree Frog Polypedates leucomystax at Campus of State University of Malang

    OpenAIRE

    Pearlindah; Emy Kusumawati; Dian Ratri Wulandari; Dwi Listyorini

    2012-01-01

    Tree frogs live in natural places which are unpolluted. Regarding their role as an ecological indicator, the decrease of frogs population in a particular habitat indicates the danger of environment quality decrease. Moreover, this condition can harm the frogs themselves. All kinds of frogs breed in aqueous environment such as ponds, marshes, and farming fields. One of the tree frogs, Polypedates leucomystax, which belongs to Familia Rachophoridae, is widely spread in Indonesia. This frog has ...

  9. Frog tongue acts as muscle-powered adhesive tape

    OpenAIRE

    Kleinteich, Thomas; Gorb, Stanislav N

    2015-01-01

    Frogs are well known to capture fast-moving prey by flicking their sticky tongues out of the mouth. This tongue projection behaviour happens extremely fast which makes frog tongues a biological high-speed adhesive system. The processes at the interface between tongue and prey, and thus the mechanism of adhesion, however, are completely unknown. Here, we captured the contact mechanics of frog tongues by filming tongue adhesion at 2000 frames per second through an illuminated glass. We found th...

  10. The Bear,The Rabbit And The Golden Frog

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Mr. Bear and Mr. Rabbit didn’t like each other very much. One day, while walking through the woods, they came across a golden frog. They were amazed when the frog talked to them. The golden frog admitted that he didn’t often meet anyone, but, when he did, he always gave them six wishes. He told them that they could have 3 wishes each.

  11. Playing Possum

    Directory of Open Access Journals (Sweden)

    Enrico Euli

    2016-07-01

    Full Text Available Our society is drenched in the catastrophe; where the growth of financial crisis, environmental cataclysm and militarization represents its gaudiest and mortifying phenomena. Humans struggle with depression, sense of impotence, anguish towards a future considered a threat.  A possibility to keep us alive can be represented by the enhancement of our ability in ‘playing Possum’, an exercise of desisting and renitence: to firmly say ‘no’. To say no to a world that proposes just one way of being and living free, that imposes as the only unavoidable possible destiny.

  12. Playful Technology

    DEFF Research Database (Denmark)

    Johansen, Stine Liv; Eriksson, Eva

    2013-01-01

    In this paper, the design of future services for children in Danish public libraries is discussed, in the light of new challenges and opportunities in relation to new media and technologies. The Danish government has over the last few years initiated and described a range of initiatives regarding...... in the library, the changing role of the librarians and the library space. We argue that intertwining traditional library services with new media forms and engaging play is the core challenge for future design in physical public libraries, but also that it is through new media and technology that new...

  13. Playful Technology

    DEFF Research Database (Denmark)

    Johansen, Stine Liv; Eriksson, Eva

    2013-01-01

    in the library, the changing role of the librarians and the library space. We argue that intertwining traditional library services with new media forms and engaging play is the core challenge for future design in physical public libraries, but also that it is through new media and technology that new......In this paper, the design of future services for children in Danish public libraries is discussed, in the light of new challenges and opportunities in relation to new media and technologies. The Danish government has over the last few years initiated and described a range of initiatives regarding...

  14. From frog integument to human skin: dermatological perspectives from frog skin biology.

    Science.gov (United States)

    Haslam, Iain S; Roubos, Eric W; Mangoni, Maria Luisa; Yoshizato, Katsutoshi; Vaudry, Hubert; Kloepper, Jennifer E; Pattwell, David M; Maderson, Paul F A; Paus, Ralf

    2014-08-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a research model, for example aiding in the study of ion transport through tight epithelia, where it has served as a model for the vertebrate distal renal tubule and mammalian epithelia. However, it has rarely been considered in comparative studies involving human skin. Yet, despite certain notable adaptations that have enabled frogs to survive in both aquatic and terrestrial environments, frog skin has many features in common with human skin. Here we present a comprehensive overview of frog (and toad) skin ontogeny, anatomy, cytology, neuroendocrinology and immunology, with special attention to its unique adaptations as well as to its similarities with the mammalian integument, including human skin. We hope to provide a valuable reference point and a source of inspiration for both amphibian investigators and mammalian researchers studying the structural and functional properties of the largest organ of the vertebrate body.

  15. TaFROG Encodes a Pooideae Orphan Protein That Interacts with SnRK1 and Enhances Resistance to the Mycotoxigenic Fungus Fusarium graminearum.

    Science.gov (United States)

    Perochon, Alexandre; Jianguang, Jia; Kahla, Amal; Arunachalam, Chanemougasoundharam; Scofield, Steven R; Bowden, Sarah; Wallington, Emma; Doohan, Fiona M

    2015-12-01

    All genomes encode taxonomically restricted orphan genes, and the vast majority are of unknown function. There is growing evidence that such genes play an important role in the environmental adaptation of taxa. We report the functional characterization of an orphan gene (Triticum aestivum Fusarium Resistance Orphan Gene [TaFROG]) as a component of resistance to the globally important wheat (T. aestivum) disease, Fusarium head blight. TaFROG is taxonomically restricted to the grass subfamily Pooideae. Gene expression studies showed that it is a component of the early wheat response to the mycotoxin deoxynivalenol (DON), which is a virulence factor produced by the causal fungal agent of Fusarium head blight, Fusarium graminearum. The temporal induction of TaFROG by F. graminearum in wheat spikelets correlated with the activation of the defense Triticum aestivum Pathogenesis-Related-1 (TaPR1) gene. But unlike TaPR1, TaFROG induction by F. graminearum was toxin dependent, as determined via comparative analysis of the effects of wild-type fungus and a DON minus mutant derivative. Using virus-induced gene silencing and overexpressing transgenic wheat lines, we present evidence that TaFROG contributes to host resistance to both DON and F. graminearum. TaFROG is an intrinsically disordered protein, and it localized to the nucleus. A wheat alpha subunit of the Sucrose Non-Fermenting1-Related Kinase1 was identified as a TaFROG-interacting protein based on a yeast two-hybrid study. In planta bimolecular fluorescence complementation assays confirmed the interaction. Thus, we conclude that TaFROG encodes a new Sucrose Non-Fermenting1-Related Kinase1-interacting protein and enhances biotic stress resistance.

  16. Snake venom-like waprin from the frog of Ceratophrys calcarata contains antimicrobial function.

    Science.gov (United States)

    Liu, Daixi; Wang, Yuwei; Wei, Lin; Ye, Huahu; Liu, Huan; Wang, Ling; Liu, Rui; Li, Dongsheng; Lai, Ren

    2013-02-10

    A 255-bp cDNA encoding an 84-amino acid residue (aa) precursor protein containing 8 half-cysteines was cloned from the skin of the frog, Ceratophrys calcarata. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 63-aa mature peptide with amino acid sequence, NVTPATKPTPSKPGYCRVMDELILCPDPPLSKDLCKNDSDCPGAQKCCYRTCIMQCLPPIFRE. The mature was named ceratoxin. Ceratoxin shares significant sequence similarity with the toxin family of waprins containing the whey acidic protein-type (WAP) four-disulfide core domain found in snake venoms. Antimicrobial and trypsin-inhibitory abilities of recombinant ceratoxin were tested. Recombinant ceratoxin showed strong antimicrobial activities against wide spectrum of microorganisms including Gram-negative and Gram-positive bacteria and fungi. It had no serine protease-inhibitory activity. The current results suggested that the snake venom-like waprin with antimicrobial activities in the frog skin plays a role in innate immunity.

  17. Playing cards.

    Science.gov (United States)

    1977-01-01

    Mrs. Zahia Marzouk, vice-president of the Alexandria Family Planning Association and a living legend of Egyptian family planning, does not believe in talking about problems. She is far too busy learning from people and teaching them. Her latest brainstorm is a set of playing cards designed to help girls and women to read and learn about family planning at the same time. The 5 packs of cards, representing familiar words and sounds, and each with a family planning joker, took Mrs. Marzouk 6 months to design and paint by hand. They have now been printed, packed into packets provided by UNICEF, and distributed to some 2000 literacy groups in factories and family planning clinics. Each woman who succeeds in learning to read is encouraged to teach 4 others. They then go to the family planning clinic to be examined and gain a certificate. For the teacher who has made them proficient there is a special prize. Girls at El Brinth village outside Alexandria are pictured playing cards at the family planning center where they are learning various skills including how to read.

  18. The role of extensional viscosity in frog tongue projection

    Science.gov (United States)

    Noel, Alexis; Wagner, Caroline; McKinley, Gareth; Mendelson, Joe; Hu, David

    2014-11-01

    Frogs and other amphibians capture insects through high-speed tongue projection, some achieving tongue accelerations of over fifty times gravity. In this experimental study, we investigate how a frog's sticky saliva enables high-speed prey capture. At the Atlanta zoo, we used high-speed video to film the trajectory of frog tongues during prey capture. We have also designed and built a portable extensional rheometer; by following the capillary-driven thinning in the diameter of a thread of saliva we characterize the relaxation time and extensional viscosity and so infer the adhesive force between the frog tongue and prey.

  19. Comparative Study of Folk Furniture and Palace Furniture Culture%民俗家具与宫廷家具文化的比较研究

    Institute of Scientific and Technical Information of China (English)

    行焱

    2013-01-01

    民俗家具和宫廷家具文化都是我国传统文化的重要组成部分,它们分别代表着两种不同的文化形态.前者属于基础文化,后者则属于上层文化.民俗家具是宫廷家具创造的基础和前提,宫廷家具是民俗家具的提炼和升华.我国宫廷家具在明清时期发展到鼎盛,得益于我国民俗家具文化深厚的积淀.通过对二者的比较研究,为现代家具设计提供借鉴.%Folk furniture and Palace furniture is an important part of Chinese traditional culture, they represent two different cultural paterns .Basis which belongs to a culture, which belongs to the upper culture. Folk furniture is the basis and prerequisite of Palace furniture creation, Palace furniture is refined and sublimation of folk furniture. Development of Palace furniture in Ming and Qing dynasties in China to its heyday, benefit from superb folk art, fusion of multi-culture and closely related. This article through a comparative study of the two, provide some reference for modern furniture design.

  20. 阿房宫前殿遗址的考古勘探与发掘%ARCHAEOLOGICAL PROSPECTION AND EXCAVATION OF THE ANTERIOR HALL SITE OF THE EPANGGONG PALACE

    Institute of Scientific and Technical Information of China (English)

    李毓芳; 孙福喜; 王自力; 张建锋

    2005-01-01

    The Epanggong Palace site of Qin period lies to the south of the Weihe River and to the west of the old Zaohe River course that extends 13 km west of Xi'an City. It stands opposite to the Qin capital Xianyang across the river. From October 2002 to December 2004, the Epanggong Palace Archaeological Team made a prospection on the anterior hall site,covering :350, 000 sq m, and revealed an area of 3, 000 sq m by trial and extensive excavations. The results include a rough understanding of the limits of the hall and the layout of its auxiliary buildings. It can be confirmed that the rammed earth foundations of the hall represents just the anterior hall of that of the Qin Epanggong Palace. What merits special notice is that there are no fire traces on the site of the anterior hall of the Qin Epanggong Palace, which forms a clear contrast to the archaeologically excavated Nos. 1-3 palaces in the Qin capital Xianyang that were destroyed by a great fire. Thus the excavations prove that the historically handed-down belief taking the Qin Epanggong Palace to have been fired by Xiang Yu is actually incorrect. There are no any building remains on the excavated hall foundations, which demonstrate that the anterior hall was not completed and that the Qin Epanggong Palace was destroyed not by fire。

  1. Versailles, un palais paré d’ocre, de pourpre et d’or Versailles: A palace clad in ochre, crimson and gold

    Directory of Open Access Journals (Sweden)

    Frédéric Didier

    2010-02-01

    history of taste in the time of Louis XIV and his successors, where colour had its place in the architectural composition.From the Porcelain Trianon to the Marble Trianon, from the Bosquets (groves of the Petit Parc to Marie-Antoinette’s Hameau (hamlet, these plays of colour were sought after and cultivated to their full expression. To the ‘blue, white and red’ trilogy of the chateau under Louis XIII, Louis XIV had no hesitation in adding the gleam of gold and marble. Furthermore, the various finishes added to these materials reflect this taste for strong contrasts: gilded and tinned lead trimmings, bricks painted in red ochre with white mortar joints. And above all, the window casings, whose original clear yellow ochre tone was a far cry from today’s natural stone colour, which supplanted the pearl-grey of the nineteenth century.Thus the gradually emerging image of Versailles differs significantly from the generally accepted idea of the ‘French-style’ classical palace.

  2. Exploration of the Potala Palace in the Qing Dynasty with Historical Anthropology%清代布达拉宫的历史人类学考察

    Institute of Scientific and Technical Information of China (English)

    陈鹏辉

    2015-01-01

    The history of the Potala Palace in the Qing dynasty reflects the history of the Tibetan history in the the Qing dynasty. The 5th Dalai Lama started its construction on the site where the king Songtsan Gambo (Srong-bstan-sgam-po) once built a palace. In 1653, the 5th Dalai Lama moved to the Potala Palace, which was the be⁃ginning of the Potala Palace serving as political and religious center. From then on, the Potala Palace became as the place where the following Dalai Lamas enthrone, live, practice religion, take office, and die as well as do oth⁃er religious activities. The Potala Palace witnessed the development of Tibet in the Qing dynasty. In the late Qing dynasty, the Potala Palace appeared frequently in historical records in regard of its architecture style, politi⁃cal and religious status.%清代布达拉宫的历史是一部清代西藏的历史。五世达赖喇嘛修建布达拉宫时追叙吐蕃时期松赞干布在红山之顶修建宫殿的历史,寓意其所修建的布达拉宫是对吐蕃历史的继承。1653年,五世达赖喇嘛受清廷册封后移住布达拉宫,开启了布达拉宫作为清天下秩序中西藏地方政、教权力中心的历史。五世达赖喇嘛之后,布达拉宫作为历辈达赖喇嘛坐床、驻锡、修行、执政、圆寂以及各种宗教活动的举行地,见证了清代西藏地方历史的发展。在晚清布达拉宫的历史书写中,无论其作为古代西藏建筑的集大成者地位,还是其在清代西藏地方历史创造中重要的政教地位,都成为史家笔下彪炳史册的书写。

  3. Faint Infrared-Excess Field Galaxies FROGs

    CERN Document Server

    Moustakas, L A; Zepf, S E; Bunker, A J

    1997-01-01

    Deep near-infrared and optical imaging surveys in the field reveal a curious population of galaxies that are infrared-bright (I-K>4), yet with relatively blue optical colors (V-I20, is high enough that if placed at z>1 as our models suggest, their space densities are about one-tenth of phi-*. The colors of these ``faint red outlier galaxies'' (fROGs) may derive from exceedingly old underlying stellar populations, a dust-embedded starburst or AGN, or a combination thereof. Determining the nature of these fROGs, and their relation with the I-K>6 ``extremely red objects,'' has implications for our understanding of the processes that give rise to infrared-excess galaxies in general. We report on an ongoing study of several targets with HST & Keck imaging and Keck/LRIS multislit spectroscopy.

  4. Convergent evolution across the Australian continent: ecotype diversification drives morphological convergence in two distantly related clades of Australian frogs.

    Science.gov (United States)

    Vidal-García, M; Keogh, J S

    2015-12-01

    Animals from different clades but subject to similar environments often evolve similar body shapes and physiological adaptations due to convergent evolution, but this has been rarely tested at the transcontinental level and across entire classes of animal. Australia's biome diversity, isolation and aridification history provide excellent opportunities for comparative analyses on broad-scale macroevolutionary patterns. We collected morphological and environmental data on eighty-four (98%) Australian hylid frog species and categorized them into ecotypes. Using a phylogenetic framework, we tested the hypothesis that frogs from the same ecotype display similar body shape patterns: (i) across all the Australian hylids, and (ii) through comparison with a similar previous study on 127 (97%) Australian myobatrachid species. Body size and shape variation did not follow a strong phylogenetic pattern and was not tightly correlated with environment, but there was a stronger association between morphotype and ecotype. Both arboreal and aquatic frogs had long limbs, whereas limbs of fossorial species were shorter. Other terrestrial species were convergent on the more typical frog body shape. We quantified the strength of morphological convergence at two levels: (i) between fossorial myobatrachid and hylid frogs, and (ii) in each ecomorph within the hylids. We found strong convergence within ecotypes, especially in fossorial species. Ecotypes were also reflected in physiological adaptations: both arboreal and cocooned fossorial frogs tend to have higher rates of evaporative water loss. Our results illustrate how adaptation to different ecological niches plays a crucial role in morphological evolution, boosting phenotypic diversity within a clade. Despite phylogenetic conservatism, morphological adaptation to repeatedly emerging new environments can erase the signature of ancestral morphotypes, resulting in phenotypic diversification and convergence both within and between diverse

  5. A perchlorate sensitive iodide transporter in frogs

    OpenAIRE

    Carr, Deborah L.; James A. Carr; Ray E. Willis; Pressley, Thomas A.

    2008-01-01

    Nucleotide sequence comparisons have identified a gene product in the genome database of African clawed frogs (Xenopus laevis) as a probable member of the solute carrier family of membrane transporters. To confirm its identity as a putative iodide transporter, we examined the function of this sequence after heterologous expression in mammalian cells. A green monkey kidney cell line transfected with the Xenopus nucleotide sequence had significantly greater 125I uptake than sham-transfected con...

  6. Colour schemes and façade work at Drottningholm and Stockholm palaces Les couleurs des façades des palais royaux de Drottningholm et de Stockholm

    Directory of Open Access Journals (Sweden)

    Jan Lisinski

    2008-06-01

    Full Text Available Jan Lisinski présente les couleurs des façades des palais royaux de Drottningholm et de Stockholm. Les deux palais furent construits au xviie siècle mais firent l’objet de modifications par la suite. La présentation commence par un bref rappel historique centré sur les différentes couleurs utilisées pour les façades puis aborde la façon dont doivent être traitées les façades aujourd’hui. Il sera question en particulier du traitement des pierres, des plâtres, des maçonneries, des aciers et des cuivres... Les façades des deux palais sont actuellement en restauration mais les solutions mises en œuvre sont différentes. Au palais Royal de Stockholm, le plâtre est simplement nettoyé alors qu’au palais Drottningholm on refait les plâtres puis les peintures à la chaux.Jan Lisinski presents the colours of the façades of the royal palaces of Drottningholm and of Stockholm. The two palaces were constructed in the seventeenth century, but have undergone successive modifications. The presentation begins with a brief historical overview of the different colours used for the façades, then discusses the way the treatments are to be carried out. In particular, the treatment of stone, plaster, masonry, steel and copper will be examined. The façades of the two palaces are currently being restored, but the solutions for each are quite different. For the Royal Palace of Stockholm, the plaster is simply being cleaned, while at Drottningholm Palace, the plaster will be redone, then painted with lime paint.

  7. Discussion of impact of relics activation on protection and utilization approaches-take the old summer palace as an example

    Science.gov (United States)

    Xiaoqi, J.

    2015-08-01

    As the popularization of cultural relics and the rapid development of cultural tourism industry, a large number of cultural relic tourism resources goes into public eyes. Activation of relics has became an important way for tourist to contact and understand culture relics. The way of how to properly interpret the historical sense and cultural uniqueness to the masses of tourists in order to achieve social service functions of relic resources has always been research focal point of site protection and utilization, so nowadays it has important significance to protection and utilization of heritage resources in our country. From the point of activation of relics and based on the analysis of resource characteristic, the paper in depth discuss ways of activation of relics of the Old Summer Palace, in order to provide reference for sustainable development of sites tourism in China.

  8. Zabór Palace in the Light of the Latest Discoveries - Interior of the Elevation using Sgraffito Technology

    Science.gov (United States)

    Bielinis-Kopeć, Barbara

    2016-12-01

    The property in Zabór from the fifteenth century belonged, among others, to families: von Tschammer, von Dyhrn, Montani, von Dünnewald, von Cosel and von Schönaich-Carolath. The testimony of its magnificence is a palace built by Count Johann Heinrich von Dünnewald in the 4th quarter of the seventeenth century, in the type of early baroque French residence, which, after 1745 was expanded in a magnificent baroque residence by Count Friedrich August von Cosel. In 2014 during the renovation of the monument one encountered a mannerist sgraffito, and facades of the old previously unknown buildings, were decorated with it, dating back probably to the early seventeenth century, which sheds a new light on the history of the monument and its construction phases.

  9. Analytical Study of the Materials Used in Mural Paintings in the Love Chamber of El Sakakeny Palace

    Directory of Open Access Journals (Sweden)

    Kholod Khairy Salama

    2017-07-01

    Full Text Available In the present study, a comprehensive investigation has been undertaken into mural paintings dating to the 19 th century and painted by Italian students. They were initially located in El Sakakeny Palace in El Sakakeny Square in Egypt. The analytical instruments used for investigation were Optical Microscopy, Scanning Electron Microscopy with EDX, X-Ray diffraction and Fourier Transform Infrared coupled with Attenuated Total Reflectance (FTIR-ATR. The analysis revealed that the pigments used in the mural paintings were hematite, litharge, zincate, gold oxide, Goethite (brown ochre and malachite mixed with linseed oil or animal glue. The original ground layer comprises zincate with gypsum. The medium used in the ground layer is animal glue and the support is limestone.

  10. The physical, chemical, and microscopic properties of masonry mortars from Alhambra Palace (Spain in reference to their earthquake resistance

    Directory of Open Access Journals (Sweden)

    Hanifi Binici

    2016-03-01

    Full Text Available Al-Andalus mortar is an ancient binding material (lime mortar that was used for centuries in numerous historical buildings in Al-Andalus, Granada (Spain. The physico-chemical and microscopic properties of Al-Andalus mortars in Granada were studied as part of an investigation into the mineral raw materials present in the territory of Spain. Scanning electron microscope and X-ray diffraction analyses of eight main types of mortars were performed to show the presence of calcite, gypsum, quartz, and muscovite minerals with organic fibers. Chemical analyses of the specimens showed that high SiO2+Al2O3+Fe2O3 contents yielded high values of hydraulicity and cementation indices. A significant result of this study was that mortars with high hydraulicity and cementation indices have high mechanical strengths. This characteristic may be the main reason for the earthquake resistance of the historical Alhambra Palace.

  11. Dietary and Food Processing for a 90-day Bioregenerative Life Support Experiment in the Lunar Palace 1

    Science.gov (United States)

    Zhao, Zhiruo; Fu, Yuming; Dong, Chen; Liu, Guanghui

    A 4-day cycle dietary menu was developed to meet the requirements of balanced diet of the crew within the 90-day closed experiment of bioregenerative life support in the Lunar Palace 1. The menu consisted of items prepared from crops and insect grown inside the system, as well as prestored food. Dairy recipe was composed of breads, vegetables, meats and soups, which provided about 2900 kcal per crew member per day. During food processing, to maximize nutrient recovery and minimize waste production, the whole wheat grains and chufa nuts were milled. Further, the carrot leaves and yellow mealworms were used as salad materials and bread ingredients, respectively. The sensory acceptability of the dishes in the menu was evaluated by flavor, texture, and appearance. Our results show that all dishes in the 4-day cycle menu were highly acceptable, which satisfies nutritional requirement of the crew members in the closed habitation.

  12. Zabór Palace in the Light of the Latest Discoveries - Interior of the Elevation using Sgraffito Technology

    Directory of Open Access Journals (Sweden)

    Bielinis-Kopeć Barbara

    2016-12-01

    Full Text Available The property in Zabór from the fifteenth century belonged, among others, to families: von Tschammer, von Dyhrn, Montani, von Dünnewald, von Cosel and von Schönaich-Carolath. The testimony of its magnificence is a palace built by Count Johann Heinrich von Dünnewald in the 4th quarter of the seventeenth century, in the type of early baroque French residence, which, after 1745 was expanded in a magnificent baroque residence by Count Friedrich August von Cosel. In 2014 during the renovation of the monument one encountered a mannerist sgraffito, and facades of the old previously unknown buildings, were decorated with it, dating back probably to the early seventeenth century, which sheds a new light on the history of the monument and its construction phases.

  13. Monitoring of Vibrations for the Conservation of Cultural Heritage the Case of the Summer Palace in Beijing

    Science.gov (United States)

    Gao, X.; Zhang, L.; Liu, G.; Ba, Z.

    2017-08-01

    In order to research the influence of the environmental vibration and the protection of the architectural heritage, CMG-5TCDE accelerometer was used to obtain the real-time vibration monitoring data of the Grand Stage in the Garden of Virtuous Harmony in Summer Palace. This paper employs the control variable method and the multivariate statistical analysis, integrating monitoring statistics with wind speed and transportation observation statistics to make interrelated analysis, in order to study the response rules and impact degree of the Grand Stage under the environmental vibration impact. The analyses of the vibration monitoring statistic of the recent two years show that the vibration acceleration of the Grand Stage is below 10mm/s2, which is remarkable related with factors such as visitors flow rate, transportation and weather.

  14. MONITORING OF VIBRATIONS FOR THE CONSERVATION OF CULTURAL HERITAGE:THE CASE OF THE SUMMER PALACE IN BEIJING

    Directory of Open Access Journals (Sweden)

    X. Gao

    2017-08-01

    Full Text Available In order to research the influence of the environmental vibration and the protection of the architectural heritage, CMG-5TCDE accelerometer was used to obtain the real-time vibration monitoring data of the Grand Stage in the Garden of Virtuous Harmony in Summer Palace. This paper employs the control variable method and the multivariate statistical analysis, integrating monitoring statistics with wind speed and transportation observation statistics to make interrelated analysis, in order to study the response rules and impact degree of the Grand Stage under the environmental vibration impact. The analyses of the vibration monitoring statistic of the recent two years show that the vibration acceleration of the Grand Stage is below 10mm/s2, which is remarkable related with factors such as visitors flow rate, transportation and weather.

  15. Cloning of interleukin-10 from African clawed frog (Xenopus tropicalis), with the Finding of IL-19/20 homologue in the IL-10 locus.

    Science.gov (United States)

    Qi, Zhitao; Zhang, Qihuan; Wang, Zisheng; Zhao, Weihong; Gao, Qian

    2015-01-01

    Interleukin-10 (IL-10) is a pleiotropic cytokine that plays an important role in immune system. In the present study, the IL-10 gene of African clawed frog (Xenopus tropicalis) was first cloned, and its expression pattern and 3D structure were also analyzed. The frog IL-10 mRNA encoded 172 amino acids which possessed several conserved features found in IL-10s from other species, including five-exon/four-intron genomic structure, conserved four cysteine residues, IL-10 family motif, and six α-helices. Real-time PCR showed that frog IL-10 mRNA was ubiquitous expressed in all examined tissues, highly in some immune related tissues including kidney, spleen, and intestine and lowly in heart, stomach, and liver. The frog IL-10 mRNA was upregulated at 24 h after LPS stimulation, indicating that it plays a part in the host immune response to bacterial infection. Another IL, termed as IL-20, was identified from the frog IL-10 locus, which might be the homologue of mammalian IL-19/20 according to the analysis results of the phylogenetic tree and the sequence identities.

  16. Frogs and snakes from the island of Morotai (Moluccas)

    NARCIS (Netherlands)

    Brongersma, L.D.

    1948-01-01

    Van Kampen (1924, p. 284) mentions only two species of frogs from Morotai Island; the identification of one of these was considered to be doubtful. Of snakes De Jong (1928, p. 149) records five species from this island. The study of a small collection of frogs and snakes from Morotai, presented to t

  17. Modeling potential river management conflicts between frogs and salmonids

    Science.gov (United States)

    Steven F. Railsback; Bret C. Harvey; Sarah J. Kupferberg; Margaret M. Lang; Scott McBain; Hart H. Welsh

    2016-01-01

    Management of regulated rivers for yellow-legged frogs (Rana boylii) and salmonids exemplifies potential conflicts among species adapted to different parts of the natural flow and temperature regimes. Yellow-legged frogs oviposit in rivers in spring and depend on declining flows and warming temperatures for egg and tadpole survival and growth,...

  18. Coleman Revisited: School Segregation, Peers, and Frog Ponds

    Science.gov (United States)

    Goldsmith, Pat Rubio

    2011-01-01

    Students from minority segregated schools tend to achieve and attain less than similar students from White segregated schools. This study examines whether peer effects can explain this relationship using normative models and frog-pond models. Normative models (where peers become alike) suggest that minority schoolmates are a liability. Frog-pond…

  19. Using a Phototransduction System to Monitor the Isolated Frog Heart

    Science.gov (United States)

    Stephens, Philip J.

    2015-01-01

    A simple and inexpensive method of monitoring the movement of an isolated frog heart provides comparable results to those obtained with a force transducer. A commercially available photoresistor is integrated into a Wheatstone bridge circuit, and the output signal is interfaced directly with a recording device. An excised, beating frog heart is…

  20. Using a Phototransduction System to Monitor the Isolated Frog Heart

    Science.gov (United States)

    Stephens, Philip J.

    2015-01-01

    A simple and inexpensive method of monitoring the movement of an isolated frog heart provides comparable results to those obtained with a force transducer. A commercially available photoresistor is integrated into a Wheatstone bridge circuit, and the output signal is interfaced directly with a recording device. An excised, beating frog heart is…

  1. Importance of riparian remnants for frog species diversity in a highly fragmented rainforest

    Science.gov (United States)

    Rodríguez-Mendoza, Clara; Pineda, Eduardo

    2010-01-01

    Tropical forests undergo continuous transformation to other land uses, resulting in landscapes typified by forest fragments surrounded by anthropogenic habitats. Small forest fragments, specifically strip-shaped remnants flanking streams (referred to as riparian remnants), can be particularly important for the maintenance and conservation of biodiversity within highly fragmented forests. We compared frog species diversity between riparian remnants, other forest fragments and cattle pastures in a tropical landscape in Los Tuxtlas, Mexico. We found similar species richness in the three habitats studied and a similar assemblage structure between riparian remnants and forest fragments, although species composition differed by 50 per cent. Frog abundance was halved in riparian remnants compared with forest fragments, but was twice that found in pastures. Our results suggest that riparian remnants play an important role in maintaining a portion of frog species diversity in a highly fragmented forest, particularly during environmentally stressful (hot and dry) periods. In this regard, however, the role of riparian remnants is complementary, rather than substitutive, with respect to the function of other forest fragments within the fragmented forest. PMID:20554561

  2. Neuronal intermediate filaments in the developing tongue of the frog Rana esculenta

    Directory of Open Access Journals (Sweden)

    K Zuwala

    2009-06-01

    Full Text Available The expression of several neuronal intermediate filament (NIF proteins was investigated in the tongue of metamorphosing tadpoles (stage 38-45 of Gosner and in adult individuals of the frog, Rana esculenta by means of immunohistochemistry. Results showed that nerve fibres at early stages of tongue development expressed peripherin (a NIF protein usually found in differentiating neurones as well as the light- and medium molecular weight NIF polypeptide subunits (NF-L and NF-M, respectively; in the adult frog, peripherin was still found in nerve fibres reaching the fungiform papilla together with NF-M, but NF-L immunoreactivity was absent therein. Clusters of epithelial cells expressing peripherin were found in the early developing tongue before differentiation of taste organs, and NF-L and NF-H immunoreactivities were present in basal (Merkel cells of the adult frog taste disc. Results indicate that neurones innervating the adult frog’s taste disc maintain a certain plasticity in their cytoskeleton and that neuronal-like cells are present in the undifferentiated and differentiated tongue epithelium possibly playing a role in the developing and mature taste organ.

  3. Arginine vasotocin promotes calling behavior and call changes in male túngara frogs.

    Science.gov (United States)

    Kime, Nicole M; Whitney, Tina K; Davis, Ellen S; Marler, Catherine A

    2007-01-01

    In the túngara frog, Physalaemus pustulosus, males alter calling behavior with changes in their social environment, adding 'chucks' to their advertisement calls in response to the calls of conspecific males. Other studies demonstrate that adding chucks increases the attractiveness of calls to females but also increases the risk of bat predation. In the current study, subcutaneous injections of the neuropeptide hormone arginine vasotocin (AVT) significantly increased chuck production in male túngara frogs. The effects of AVT on chuck production did not depend on the presence of playback stimuli, suggesting that AVT increased either the males' general motivation to produce chucks or their responsiveness to the calls of distant males. Injections of AVT also increased the probability that males would call and decreased the latency to call after injection, supporting the hypothesis that AVT influences motivation to call. Finally, AVT inhibited a drop in call rate after the termination of a playback stimulus and increased call rate at a lower dose of AVT. The effects of AVT on chucks and call rate appear to be independent of each other, as there was no correlation between change in chuck production and change in call rate in individual males. We conclude that AVT may play an important role in socially-mediated call changes that result from competition for mates. The behavioral changes induced by AVT might increase a male's attractiveness to females, and also may be consistent with an aggressive response to another túngara frog male. Copyright 2007 S. Karger AG, Basel.

  4. A Threshold Dosage of Testosterone for Female-to-Male Sex Reversal in Rana rugosa Frogs.

    Science.gov (United States)

    Oike, Akira; Kodama, Maho; Nakamura, Yoriko; Nakamura, Masahisa

    2016-10-01

    Androgens play a critical role in testicular differentiation in many species of vertebrates. While female-to-male sex reversal can be induced by testosterone (T) in some species of amphibians, the mechanism still remains largely unknown even at the histological level. In this study, we determined a threshold dosage of T to induce female-to-male sex reversal in the Japanese frog Rana (R.) rugosa. Tadpoles were allowed to metamorphose into frogs with T present in the rearing water. At 0.2 ng/mL T, female frogs formed tissue comprising a mixture of ovary and testis, the so-called ovotestis, the size of which was significantly smaller than the wild-type ovary. Histological changes occurring in the oocytes of T-treated ovaries induced oocyte degeneration in the masculinizing ovaries leading to their final disappearance. In parallel, many germ cells emerged in the cortex of the ovotestis and, later, in the medulla as well. RT-PCR analysis revealed upregulated expression of CYP17 and Dmrt1 but not 17βHSD in the ovotestis, and downregulation of Pat1a expression. Furthermore, immunohistology revealed CYP17-positive signals in the cortex of the masculinizing ovary, spreading throughout the whole area as the testis developed. These results indicate that oocytes are sensitive to T in the ovary of R. rugosa and that male-type germ cells expand in the masculinizing gonad (testis) contemporaneous with oocyte disappearance. © 2016 Wiley Periodicals, Inc.

  5. Helminth parasites of the leopard frog Lithobates sp. Colima (Amphibia: Ranidae) from Colima, Mexico.

    Science.gov (United States)

    Cabrera-Guzmán, Elisa; Garrido-Olvera, Lorena; León-Règagnon, Virginia

    2010-08-01

    The helminth fauna inhabiting Lithobates sp. Colima from Ticuizitán, Colima, Mexico, comprises 10 species: 4 digeneans ( Clinostomum sp., Glypthelmins quieta , Haematoloechus sp., and Langeronia macrocirra ), 5 nematodes ( Aplectana itzocanensis , Cosmocerca podicipinus , Foleyellides striatus , Oswaldocruzia subauricularis , and Rhabdias sp.), and 1 cestode (Cyclophyllidea). Glypthelmins quieta , L. macrocirra , and A. itzocanensis represent new host records. These observations, added to previous records from Acapulco, Guerrero, Mexico, indicate that the helminth fauna of Lithobates sp. from Colima comprises 25 taxa. Frogs are being parasitized by 3 infection routes: ingestion of intermediate host, skin penetration by larval forms, and transmission by vectors. Species of Aplectana , Cosmocerca , Foleyellides , and Oswaldocruzia occurred in high prevalence in Colima, similar to a previous study on the same frog species from Guerrero. In Colima, Glypthelmins , Haematoloechus , and Rhabdias also occurred in high prevalence. Haematoloechus species reached the highest mean intensity in both localities. The semiaquatic habits of this species of frog and the availability of particular feeding resources appear to determine the helminth composition and infection levels; however, co-speciation events also play an important role structuring these helminth communities.

  6. Pulmonary and cutaneous O₂gas exchange: a student laboratory exercise in the frog.

    Science.gov (United States)

    Tattersall, Glenn J; Currie, Suzanne; LeBlanc, Danielle M

    2013-03-01

    Gas exchange in animals is ultimately diffusion based, generally occurring across dedicated respiratory organs. In many aquatic amphibians, however, multiple modes of gas exchange exist, allowing for the partitioning of O2 uptake and CO2 excretion between respiratory organs with different efficiencies. For example, due to the physical properties of O2 being vastly different between air and water phases, the lung and skin play disproportionately important roles in O2 uptake. Many aquatic frogs are renowned for their cutaneous gas exchange capacity, where often the majority of CO2 is excreted across the skin. Furthermore, the roles of these gas exchange organs change with the animal's behavior. Under diving conditions, most of the frog's gas exchange needs must be met by the skin. In this article, we describe an interactive undergraduate laboratory that allows a class of students to share equipment while assessing pulmonary and cutaneous respiration in frogs provided with an air/water choice and under enforced dive conditions. Concepts explored in this laboratory exercise include animal energetics, diving reflex, pulmonary and cutaneous gas exchange processes, diffusion-based gas flux, and O2 debt.

  7. 49 CFR 213.355 - Frog guard rails and guard faces; gage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.355... Higher § 213.355 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs... distance between the gage line of a frog to the guard line 1 of its guard rail or guarding face,...

  8. The Observation of Frog Species at State University of Malang as a Preliminary Effort on Frog Conservation

    Directory of Open Access Journals (Sweden)

    Dian Ratri Wulandari

    2013-04-01

    Full Text Available Frog is an amphibian which is widely spread around the world. Indonesia houses 450 species which represent 11% of frog species in the world. In Java Island alone, there live 42 species of frogs and toads. Frogs can be used as an environment indicator in that the presence of frog in a particular place indicates that the place stays natural and unpolluted. The 1st Campus of State University of Malang, which is located in the heart of Malang District, has been developing rapidly currently. Thus, it requires the construction of new various facilities to support its huge activities. Extensive construction can be destructive even damaging to the habitat of frog, which potentially threats the frog’s life, if it does not take the environmental impact into careful consideration. This study is aimed to identify the species of frog which survives at State University of Malang with, particularly the frog species found in 1995. Species identification was conducted by observing the morphological character. This study found that there were four species with three species remained survived in 1995; those were Duttaphrynus melanostictus, Polypedates leucomystax, and Kaloula baleta; and one new species called Rana chalconota. This study also revealed that there were four species which were extinct; those were Fejervarya cancrivora, Fejervarya limnocharis, Ingerophrynus biporcatus, and Occidoziga lima. This situation shows the decreasing amount of species from 7 to 4 within the last 17 years. This result indicates that there is a serious environmental degradation which causes the losing of frog habitats. Further research is needed to study the ecological condition changing in order to save the frog species.

  9. The gastrocoel roof plate in embryos of different frogs.

    Science.gov (United States)

    Sáenz-Ponce, Natalia; Santillana-Ortiz, Juan-Diego; del Pino, Eugenia M

    2012-02-01

    The morphology of the gastrocoel roof plate and the presence of cilia in this structure were examined in embryos of four species of frogs. Embryos of Ceratophrys stolzmanni (Ceratophryidae) and Engystomops randi (Leiuperidae) develop rapidly, provide comparison for the analysis of gastrocoel roof plate development in the slow-developing embryos of Epipedobates machalilla (Dendrobatidae) and Gastrotheca riobambae (Hemiphractidae). Embryos of the analyzed frogs develop from eggs of different sizes, and display different reproductive and developmental strategies. In particular, dorsal convergence and extension and archenteron elongation begin during gastrulation in embryos of rapidly developing frogs, as in Xenopus laevis. In contrast, cells that involute during gastrulation are stored in the large circumblastoporal collar that develops around the closed blastopore in embryos of slow-developing frogs. Dorsal convergence and extension only start after blastopore closure in slow-developing frog embryos. However, in the neurulae, a gastrocoel roof plate develops, despite the accumulation of superficial mesodermal cells in the circumblastoporal collar. Embryos of all four species develop a ciliated gastrocoel roof plate at the beginning of neurulation. Accordingly, fluid-flow across the gastrocoel roof plate is likely the mechanism of left-right asymmetry patterning in these frogs, as in X. laevis and other vertebrates. A ciliated gastrocoel roof plate, with a likely origin as superficial mesoderm, is conserved in frogs belonging to four different families and with different modes of gastrulation.

  10. Frog community responses to recent American bullfrog invasions

    Institute of Scientific and Technical Information of China (English)

    Yiming LI; Zhunwei KE; Yihua WANG; Tim M. BLACKBURN

    2011-01-01

    Native species may decline quickly when confronted with an exotic species to which they are not adapted. The extent of decline may depend on the abundance of an invader and the length of time since it first arrived in the community (residence time), and the interaction between these two variables. We tested these effects using data on the effects of American bullfrog Lithobates catesbeianus invasion on native frog communities in 65 permanent lentic waters on islands in the Zhoushan Archipelago, China. We examined variation in native frog abundance and species richness in relation to features of the American bullfrog invasion, habitat disturbance, characteristics of the water body and fish communities and the presence of red swamp crayfish.Bullfrog invaded sites had lower native frog density and species richness, higher submerged vegetation cover and greater frequency of repairs to the water body than did non-invaded sites. The minimum adequate general linear mixed models showed that both native frog density and species richness were negatively related to post-metamorphosis bullfrog density, and that native frog species richness was also positively related to the vegetation cover. There was no effect on either native frog density or species richness of residence time or its interaction with bullfrog density, or of the abundance of bullfrog tadpoles. The results suggested that post-metamorphosis bullfrogs had impacts on native frog communities in the islands, and that the extents of these impacts are proportional to post-metamorphosis bullfrog density.

  11. Landing on branches in the frog Trachycephalus resinifictrix (Anura: Hylidae).

    Science.gov (United States)

    Bijma, Nienke N; Gorb, Stanislav N; Kleinteich, Thomas

    2016-04-01

    Frogs (Lissamphibia: Anura) are famous for their saltatory or hopping locomotion, which is related to numerous anatomical specialisations that are characteristic for the group. However, while the biomechanics of take-off in frogs have been studied in detail, much less is known on how frogs land after a jump. Besides terrestrial and aquatic species, several lineages of frogs adopted an arboreal lifestyle and especially the biomechanics of landing on challenging, small, and unpredictable substrates, such as leaves or branches, are virtually unknown. Here we studied the landing kinematics of the arboreal frog Trachycephalus resinifictrix (Hylidae) on a wooden stick that was used to mimic a small tree branch. We observed two different landing behaviours: (1) landing on the abdomen and (2) attachment with the toes of either the forelimb or the hindlimb. In the latter case, the frogs performed a cartwheel around the stick, while they were only attached by their adhesive toe pads. We estimated the forces that act on the toes during this behaviour to be up to fourteen times the body weight of the animals. This behaviour demonstrates the remarkable adhesive capabilities of the toe pads and the body control of the frogs.

  12. The wood frog (Rana sylvatica): a technical conservation assessment

    Science.gov (United States)

    Muths, E.; Rittmann, S.; Irwin, J.; Keinath, D.; Scherer, R.

    2005-01-01

    Overall, the wood frog (Rana sylvatica) is ranked G5, secure through most of its range (NatureServe Explorer 2002). However, it is more vulnerable in some states within the USDA Forest Service Region 2: S3 (vulnerable) in Colorado, S2 (imperiled) in Wyoming, and S1 (critically imperiled in South Dakota (NatureServe Explorer 2002); there are no records for wood frogs in Kansas or Nebraska. Primary threats to wood frog populations are habitat fragmentation (loss of area, edge effects, and isolation) and habitat loss due to anthropogenic causes (e.g., wetland draining, grazing) and natural changes as habitat succession occurs. Wood frogs are most conspicuous at breeding sites early in the spring, when snow and ice are often still present at pond margins. They tolerate frezzing and hibernate terrestrially in shallow depressions, under leaf litter, grasses, logs, or rocks (Bagdonas 1968, Bellis 1961a); there are no reports of aquatic hibernation for this species (Licht 1991, Pinder et al. 1992). Wood frogs require semi-permanent and temporary pools of natural origin and adjacent wet meadows, and landscape alterations that shorten the hydroperiod of ponds can result in catastrophic tadpole mortality. Plant communities utilized by wood frogs in the Rocky Mountains are hydric to mesic and include sedge and grass meadows, willow hummocks, aspen groves, lodgepole pine forests, and woodlands with leaf litter and/or herbaceous understory (Maslin 1947, Bellis 1961a, Roberts and Lewin 1979, Haynes and Aird 1981). Wood frogs are likely to disperse into surrounding marsh and woodlands soon after oviposition (Heatwole 1961, Haynes and Aird 1981). In the arly fall, wood frogs begin to seek hibernacula at or just below the ground surface, generally in upland forest habitat (Regosin et al. 2003). Licht (1991) demonstrated shelter-seeking behavior at 1.5 [degrees] C. Once they have concealed themselves for hibernation, wood frogs are very difficult to detecta?|

  13. 基于增强现实技术的古代宫殿类APP设计研究%ANCIENT PALACE APP DESIGN BASED ON AUGMENTED REALITY

    Institute of Scientific and Technical Information of China (English)

    国祺; 董健

    2016-01-01

    A researches on application of the Augmented Reality APP in ancient palace. Finding the common point through a survey of the Augmented Reality application status and APP of ancient palace in domestic and overseas. The Shenyang Palace Museum designing practice for instance. The developing of the Augmented Reality technology provide both new ways in APP design and new experiences for user. The three-dimensional Augmented Reality make more opportunity come true in the basis of One-dimensional character and Two-dimensional image. By programming the Shenyang Palace Museum APP, one can provide basic reference for application of the Augmented Reality in future.%对应用增强现实技术的古代宫殿类APP进行研究。通过对增强现实技术的应用现状以及国内外古代宫殿类APP进行调研,找到两者之间的结合点,以沈阳故宫为例进行设计实践。增强现实技术的发展为智能移动应用的设计提供了新思路,也为使用者带了新的体验方式,在一维文字和二维图片的基础上,三维的增强现实技术让更多可能变为现实,通过对沈阳故宫APP设计,能够为今后应用增强现实技术的设计实践提供基本参考。

  14. The Roles of The Dance Education Institute and The Ngayogyakarta Hadiningrat Palace in The Inheritance Process of Yogyakarta Classical Dance Style

    OpenAIRE

    Muhammad Fazli Taib Bin Saearani

    2015-01-01

    This study aims to examine the roles of the Ngayogyakarta Palace, formal educational institutions, and non-formal educational institutions in the inheritance of the classical court dance of Yogyakarta or Tari Klasik Gaya Yogyakarta (TKGY). The method employed was a qualitative method through interviews and observations with a number of informants from dance institutions in Yogyakarta. Based on the interviews, a number of independent and collaborative roles among the three types of institution...

  15. Active control of ultrasonic hearing in frogs

    Science.gov (United States)

    Gridi-Papp, Marcos; Feng, Albert S.; Shen, Jun-Xian; Yu, Zu-Lin; Rosowski, John J.; Narins, Peter M.

    2008-01-01

    Vertebrates can modulate the sound levels entering their inner ears in the face of intense external sound or during their own vocalizations. Middle ear muscle contractions restrain the motion of the middle ear ossicles, attenuating the transmission of low-frequency sound and thereby protecting the hair cells in the inner ear. Here we show that the Chinese concave-eared torrent frog, Odorrana tormota, can tune its ears dynamically by closing its normally open Eustachian tubes. Contrary to the belief that the middle ear in frogs permanently communicates with the mouth, O. tormota can close this connection by contraction of the submaxillary and petrohyoid muscles, drastically reducing the air volume behind the eardrums. Mathematical modeling and laser Doppler vibrometry revealed that the reduction of this air volume increases the middle ear impedance, resulting in an up to 20 dB gain in eardrum vibration at high frequencies (10–32 kHz) and 26 dB attenuation at low frequencies (3–10 kHz). Eustachian tube closure was observed in the field during calling and swallowing. Besides a potential role in protecting the inner ear from intense low-frequency sound and high buccal air pressure during calling, this previously unrecognized vertebrate mechanism may unmask the high-frequency calls of this species from the low-frequency stream noise which dominates the environment. This mechanism also protects the thin tympanic membranes from injury during swallowing of live arthropod prey. PMID:18658240

  16. Active control of ultrasonic hearing in frogs.

    Science.gov (United States)

    Gridi-Papp, Marcos; Feng, Albert S; Shen, Jun-Xian; Yu, Zu-Lin; Rosowski, John J; Narins, Peter M

    2008-08-05

    Vertebrates can modulate the sound levels entering their inner ears in the face of intense external sound or during their own vocalizations. Middle ear muscle contractions restrain the motion of the middle ear ossicles, attenuating the transmission of low-frequency sound and thereby protecting the hair cells in the inner ear. Here we show that the Chinese concave-eared torrent frog, Odorrana tormota, can tune its ears dynamically by closing its normally open Eustachian tubes. Contrary to the belief that the middle ear in frogs permanently communicates with the mouth, O. tormota can close this connection by contraction of the submaxillary and petrohyoid muscles, drastically reducing the air volume behind the eardrums. Mathematical modeling and laser Doppler vibrometry revealed that the reduction of this air volume increases the middle ear impedance, resulting in an up to 20 dB gain in eardrum vibration at high frequencies (10-32 kHz) and 26 dB attenuation at low frequencies (3-10 kHz). Eustachian tube closure was observed in the field during calling and swallowing. Besides a potential role in protecting the inner ear from intense low-frequency sound and high buccal air pressure during calling, this previously unrecognized vertebrate mechanism may unmask the high-frequency calls of this species from the low-frequency stream noise which dominates the environment. This mechanism also protects the thin tympanic membranes from injury during swallowing of live arthropod prey.

  17. How frog embryos replicate their DNA reliably

    Science.gov (United States)

    Bechhoefer, John; Marshall, Brandon

    2007-03-01

    Frog embryos contain three billion base pairs of DNA. In early embryos (cycles 2-12), DNA replication is extremely rapid, about 20 min., and the entire cell cycle lasts only 25 min., meaning that mitosis (cell division) takes place in about 5 min. In this stripped-down cell cycle, there are no efficient checkpoints to prevent the cell from dividing before its DNA has finished replication - a disastrous scenario. Even worse, the many origins of replication are laid down stochastically and are also initiated stochastically throughout the replication process. Despite the very tight time constraints and despite the randomness introduced by origin stochasticity, replication is extremely reliable, with cell division failing no more than once in 10,000 tries. We discuss a recent model of DNA replication that is drawn from condensed-matter theories of 1d nucleation and growth. Using our model, we discuss different strategies of replication: should one initiate all origins as early as possible, or is it better to hold back and initiate some later on? Using concepts from extreme-value statistics, we derive the distribution of replication times given a particular scenario for the initiation of origins. We show that the experimentally observed initiation strategy for frog embryos meets the reliability constraint and is close to the one that requires the fewest resources of a cell.

  18. An Investigation of the Chronological Years of the Poets and Musical Officials in Dacheng Palace%大晟府词人及乐官编年考略

    Institute of Scientific and Technical Information of China (English)

    张春义

    2015-01-01

    The chronological research for the poets and musical officials in Dacheng Palace helped to bring the study of the literature and status of the officials in the Song Dynasty to a depth.Today,according to the rele-vant historical data,40 new musical officials in Dacheng Palace have been found based on the 29 people that had been found in the previous study.Among them,44 “poets and musical officials in Dacheng Palace who were confirmed in the investigation”have been listed with a roughly chronological record,while the remaining 26 are classified as “officials to be verified as musical officials in Dacheng Palace”,which will wait for further study in the academic field.%大晟府词人及乐官的编年,有助于宋代文学及职官研究的深入。今据相关史料,在前贤所考定29人的基础上,新又考出40名大晟府乐官。其中,对44名“可考任时和官职的大晟府词人及乐官”作了大致的编年,其余26人则归入“待考任时或官职的大晟府乐官”部分,以供学界进一步研究。

  19. Study ethnomathematics of aboge (alif, rebo, wage) calendar as determinant of the great days of Islam and traditional ceremony in Cirebon Kasepuhan Palace

    Science.gov (United States)

    Syahrin, Muhammad Alfi; Turmudi, Puspita, Entit

    2016-02-01

    This research attempts to show about the relationship between mathematics and culture. Paradigm that emerged currently, that mathematics is an abstract concept and difficult, therefore mathematics is not favored by most students. In the reality, indirectly mathematics is present in a culture of a society. Ethnomathematics study is a study to examine how does a group of people in a particular culture understand, express, and use the concepts and practices of culture that depicted mathematically. This research was conducted in Cirebon precisely in Kasepuhan Palace, which was in RW 04, Kasepuhan village, Lemah Wungkuk district, Cirebon city, West Java. The focus of the study and research purposes was the application of aboge (alif rebo wage) calendar as the calculation of days and the calendar rules determine the time of days, great days of Islam and traditional ceremony in Kasepuhan Palace. Qualitative methods with the principles of ethnography such as studies in ethnomathematics i.e observation, interviews, documentation and fieldnotes were used in this research. The findings of this ethnomathematics study show that the determining great days of Islam and the days of palace traditional ceremony have a close relationship with the counts and principles in mathematics. This study provides recommendations that mathematics is closely related to culture due to ethnomathematics.

  20. Biosensor, ELISA, and frog embryo teratogenesis assay: Xenopus (FETAX) analysis of water associated with frog malformations in Minnesota

    Science.gov (United States)

    Garber, Eric A. E.; Erb, Judith L.; Downward, James G.; Priuska, Eric M.; Wittliff, James L.; Feng, Wenke; Magner, Joseph; Larsen, Gerald L.

    2001-03-01

    Between 1995 and 1997 over 62% of the counties in Minnesota reported the presence of malformed frogs. While most sites have recently shown a decline in malformed frog populations, one site in northeastern Minnesota with no prior history of containing malformed frogs was recently discovered to contain > 67% malformed Rana pipiens (northern leopard frogs). As part of an effort to study the presence of hormonally active agents in fresh water sources, water samples were collected from lakes in Minnesota containing malformed frogs and analyzed for the presence of hormonally active compounds using a novel evanescent field fluorometric biosensor and the frog embryo teratogenesis assay: Xenopus (FETAX) bioassay. The waveguide based biosensor developed by ThreeFold Sensors (TFS biosensor, Ann Arbor, MI) detects the presence of estrogenic compounds capable of interacting with free human ER-a and by inhibiting binding to an immobilized estrogen. The FETAX bioassay is a developmental assay, which measures teratogenicity, mortality, and inhibition of growth during the first 96 hours of organogenesis and thereby provides a universal screen for endocrine disruptors. TFS biosensor and FETAX screening of the water samples suggest a relationship between estrogenic activity, mineral supplementation, and the occurrence of malformed frogs.

  1. Evolution of vertebrate transient receptor potential vanilloid 3 channels: opposite temperature sensitivity between mammals and western clawed frogs.

    Directory of Open Access Journals (Sweden)

    Shigeru Saito

    2011-04-01

    Full Text Available Transient Receptor Potential (TRP channels serve as temperature receptors in a wide variety of animals and must have played crucial roles in thermal adaptation. The TRP vanilloid (TRPV subfamily contains several temperature receptors with different temperature sensitivities. The TRPV3 channel is known to be highly expressed in skin, where it is activated by warm temperatures and serves as a sensor to detect ambient temperatures near the body temperature of homeothermic animals such as mammals. Here we performed comprehensive comparative analyses of the TRPV subfamily in order to understand the evolutionary process; we identified novel TRPV genes and also characterized the evolutionary flexibility of TRPV3 during vertebrate evolution. We cloned the TRPV3 channel from the western clawed frog Xenopus tropicalis to understand the functional evolution of the TRPV3 channel. The amino acid sequences of the N- and C-terminal regions of the TRPV3 channel were highly diversified from those of other terrestrial vertebrate TRPV3 channels, although central portions were well conserved. In a heterologous expression system, several mammalian TRPV3 agonists did not activate the TRPV3 channel of the western clawed frog. Moreover, the frog TRPV3 channel did not respond to heat stimuli, instead it was activated by cold temperatures. Temperature thresholds for activation were about 16 °C, slightly below the lower temperature limit for the western clawed frog. Given that the TRPV3 channel is expressed in skin, its likely role is to detect noxious cold temperatures. Thus, the western clawed frog and mammals acquired opposite temperature sensitivity of the TRPV3 channel in order to detect environmental temperatures suitable for their respective species, indicating that temperature receptors can dynamically change properties to adapt to different thermal environments during evolution.

  2. Recording Information on Architectural Heritage Should Meet the Requirements for Conservation Digital Recording Practices at the Summer Palace

    Science.gov (United States)

    Zhang, L.; Cong, Y.; Wu, C.; Bai, C.; Wu, C.

    2017-08-01

    The recording of Architectural heritage information is the foundation of research, conservation, management, and the display of architectural heritage. In other words, the recording of architectural heritage information supports heritage research, conservation, management and architectural heritage display. What information do we record and collect and what technology do we use for information recording? How do we determine the level of accuracy required when recording architectural information? What method do we use for information recording? These questions should be addressed in relation to the nature of the particular heritage site and the specific conditions for the conservation work. In recent years, with the rapid development of information acquisition technology such as Close Range Photogrammetry, 3D Laser Scanning as well as high speed and high precision Aerial Photogrammetry, many Chinese universities, research institutes and heritage management bureaux have purchased considerable equipment for information recording. However, the lack of understanding of both the nature of architectural heritage and the purpose for which the information is being collected has led to several problems. For example: some institutions when recording architectural heritage information aim solely at high accuracy. Some consider that advanced measuring methods must automatically replace traditional measuring methods. Information collection becomes the purpose, rather than the means, of architectural heritage conservation. Addressing these issues, this paper briefly reviews the history of architectural heritage information recording at the Summer Palace (Yihe Yuan, first built in 1750), Beijing. Using the recording practices at the Summer Palace during the past ten years as examples, we illustrate our achievements and lessons in recording architectural heritage information with regard to the following aspects: (buildings') ideal status desired, (buildings') current status

  3. RECORDING INFORMATION ON ARCHITECTURAL HERITAGE SHOULD MEET THE REQUIREMENTS FOR CONSERVATION Digital Recording Practices at the Summer Palace

    Directory of Open Access Journals (Sweden)

    L. Zhang

    2017-08-01

    Full Text Available The recording of Architectural heritage information is the foundation of research, conservation, management, and the display of architectural heritage. In other words, the recording of architectural heritage information supports heritage research, conservation, management and architectural heritage display. What information do we record and collect and what technology do we use for information recording? How do we determine the level of accuracy required when recording architectural information? What method do we use for information recording? These questions should be addressed in relation to the nature of the particular heritage site and the specific conditions for the conservation work. In recent years, with the rapid development of information acquisition technology such as Close Range Photogrammetry, 3D Laser Scanning as well as high speed and high precision Aerial Photogrammetry, many Chinese universities, research institutes and heritage management bureaux have purchased considerable equipment for information recording. However, the lack of understanding of both the nature of architectural heritage and the purpose for which the information is being collected has led to several problems. For example: some institutions when recording architectural heritage information aim solely at high accuracy. Some consider that advanced measuring methods must automatically replace traditional measuring methods. Information collection becomes the purpose, rather than the means, of architectural heritage conservation. Addressing these issues, this paper briefly reviews the history of architectural heritage information recording at the Summer Palace (Yihe Yuan, first built in 1750, Beijing. Using the recording practices at the Summer Palace during the past ten years as examples, we illustrate our achievements and lessons in recording architectural heritage information with regard to the following aspects: (buildings’ ideal status desired, (buildings

  4. REGULATING EFFECTS OF VASCULAR ENDOTHELIAL GROWTH FACTOR AND ANGⅡ ON FROG'S PERICARDIAL STOMATA, MESOTHELIUM AND ANGIOGENESIS

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Objective. To observe the regulating effects of vascular endothelial growth factor (VEGF) and angiotensinⅡ (ANG II) on the frog's pericardium, lymphatic stomata and angiogenesis so as to reveal their effects and mechanism on the mesothelial permeability, lymphatic stoma regulation and myocardial hypertrophy. Methods. VEGF and ANGⅡ were injected into the frog's peritoneal cavity so as to examine the changes of the pericardial stromata by using transmission electron microscopy, scanning electron microscopy and computerized imaging analysis. Results. Scattered distributed pericardial stomata were found on the parietal pericardium of the frog with a few sinusoid mesothelial cells, whose blood supply was directly from the cardiac chambers flowing into the trabecular spaces of the myocardium (because there are no blood vessels in the myocardium of the frog). The average diameters of the pericardial stomata in VEGF and ANGⅡ groups were 1.50 μ m and 1.79 μ m respectively, which were much larger than those in the control group (0.72 μ m, P< 0.01); the average distribution densities of the stomata were 8.25/0.1 mm2 and 12.80/0.1 mm2 in VEGF and ANGⅡ groups, which were also much higher than those in the control group (3.57/0.1 mm2, P< 0.01); the sinusoid areas in VEGF and ANGⅡ groups were 2442.95 μ m2/0.1 mm2 and 2121.79 μ m2/0.1 mm2, which were larger than that in the control group (995.08 μ m2 /0.1 mm2 , P< 0.01); no angiogenesis was found in the frogs of the experimental groups. Conclusions. VEGF and ANGⅡ could strongly regulate the pericardial stomata by increasing their numbers and openings with larger diameters and higher distribution density. They could also increase the sinusoid areas with the result of the higher permeability of the pericardium, which clearly indicated that VEGF and ANGⅡ could speed up the material transfer of the pericardial cavity and play an important role in preventing myocardial interstitial edema. Yet there was no strong

  5. Connectin filaments in stretched skinned fibers of frog skeletal muscle

    Science.gov (United States)

    1984-01-01

    Indirect immunofluorescence microscopy of highly stretched skinned frog semi-tendinous muscle fibers revealed that connectin, an elastic protein of muscle, is located in the gap between actin and myosin filaments and also in the region of myosin filaments except in their centers. Electron microscopic observations showed that there were easily recognizable filaments extending from the myosin filaments to the I band region and to Z lines in the myofibrils treated with antiserum against connectin. In thin sections prepared with tannic acid, very thin filaments connected myosin filaments to actin filaments. These filaments were also observed in myofibrils extracted with a modified Hasselbach-Schneider solution (0.6 M KCl, 0.1 M phosphate buffer, pH 6.5, 2 mM ATP, 2 mM MgCl2, and 1 mM EGTA) and with 0.6 M Kl. SDS PAGE revealed that connectin (also called titin) remained in extracted myofibrils. We suggest that connectin filaments play an important role in the generation of tension upon passive stretch. A scheme of the cytoskeletal structure of myofibrils of vertebrate skeletal muscle is presented on the basis of our present information of connectin and intermediate filaments. PMID:6384237

  6. Grain by grain yields bread, brick by brick produces a (tourist palace

    Directory of Open Access Journals (Sweden)

    Anton Gosar

    1999-12-01

    Full Text Available The following article presents results of a multi-national project focusing on the development of tourism, in accordance with the principles of sustainability in the Three border area of Austria, Italy and Slovenia. This area was the candidate for the Winter Olympics 2006. The paper registers tourist demand and offerings; through the concept of "bricklaying" the existing tourist attractions are glued together into one single tourist product. In particular the fact that this is an area where the Romance (Italian, Germanic (Austrian and Slavonic (Slovenian peoples and culture meet plays in important role in promotional and sustainable development aspects. History plays in important role as well.

  7. Frog: The fast and realistic OpenGL event displayer

    Energy Technology Data Exchange (ETDEWEB)

    Quertenmont, Loic, E-mail: loic.quertenmont@cern.c [Center for Particle Physics and Phenomenology CP3, Universite catholique de Louvain, Chemin du cyclotron 2, B-1348-Louvain-la-Neuve (Belgium)

    2010-04-01

    FROG is a generic framework dedicated to visualisation of events in high energy physics experiment. It is suitable to any particular physics experiment or detector design. The code is light (< 3 MB) and fast (browsing time {approx} 20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OpenGL and Glut libraries. Moreover, Frog does not require installation of heavy third party libraries for the visualisation. This documents describes the features and principles of Frog version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally the application of FROG for physic experiment/environement, such as Gastof, CMS, ILD, Delphes will be presented for illustration.

  8. Frog: The fast & realistic OpenGL event displayer

    Science.gov (United States)

    Quertenmont, Loïc

    2010-04-01

    FROG [1] [2] is a generic framework dedicated to visualisation of events in high energy physics experiment. It is suitable to any particular physics experiment or detector design. The code is light (< 3 MB) and fast (browsing time ~ 20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OpenGL[3] and Glut [4] libraries. Moreover, Frog does not require installation of heavy third party libraries for the visualisation. This documents describes the features and principles of Frog version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally the application of FROG for physic experiment/environement, such as Gastof, CMS, ILD, Delphes will be presented for illustration.

  9. Dahomey NWR Malformed Frog Survey Data 2003-2004

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Data set contains information concerning surveys for malformed frog collections on Dahomey NWR in MS from 2003-2004. Data were collected as part of the national...

  10. Modeling synchronized calling behavior of Japanese tree frogs

    Science.gov (United States)

    Aihara, Ikkyu

    2009-07-01

    We experimentally observed synchronized calling behavior of male Japanese tree frogs Hyla japonica; namely, while isolated single frogs called nearly periodically, a pair of interacting frogs called synchronously almost in antiphase or inphase. In this study, we propose two types of phase-oscillator models on different degrees of approximations, which can quantitatively explain the phase and frequency properties in the experiment. Moreover, it should be noted that, although the second model is obtained by fitting to the experimental data of the two synchronized states, the model can also explain the transitory dynamics in the interactive calling behavior, namely, the shift from a transient inphase state to a stable antiphase state. We also discuss the biological relevance of the estimated parameter values to calling behavior of Japanese tree frogs and the possible biological meanings of the synchronized calling behavior.

  11. Final Critical Habitat for Oregon Spotted Frog (Rana pretiosa)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of FINAL critical habitat for Rana pretiosa (Oregon Spotted Frog). Maps published in the Federal Register 2016.

  12. Final Critical Habitat for Oregon Spotted Frog (Rana pretiosa)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of FINAL critical habitat for Rana pretiosa (Oregon Spotted Frog). Maps published in the Federal Register 2016.

  13. California Red-Legged Frogs in coastal dune drainages (2015)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — California Red-legged Frogs (Rana draytonii) are typically regarded as inhabitants of permanent ponds, marshes, and slow-moving streams, but their ecology in other...

  14. FROG: The Fast And Realistic OpenGL Event Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG [1] [2] is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light (< 3 MB) and fast (browsing time 20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL [3] and GLUT [4] libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This documents describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally the application of FROG for physic experiment/environement, such as Gastof, CMS, ILD, Delphes will be presented for illustration.

  15. Oregon Spotted Frog (Rana pretiosa) Monitoring at Jack Creek 2015

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains information from mark-recapture surveys conducted in 2015 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa) monitoring effort...

  16. The need for water quality criteria for frogs.

    OpenAIRE

    Boyer, R; Grue, C. E.

    1995-01-01

    Amphibians are considered reliable indicators of environmental quality. In the western United States, a general decline of frog populations parallels an apparent worldwide decline. The factors thought to be contributing to declines in frog populations include habitat loss, introduction of exotic species, overexploitation, disease, climate change, and decreasing water quality. With respect to water quality, agroecosystems use 80-90% of the water resources in the western United States, frequent...

  17. Research on Non-Destructive Testing Technology in Conservation Repair Project of Ancestral Temple in Mukden Palace

    Science.gov (United States)

    Yang, J.; Fu, M.

    2017-08-01

    Due to the use of wood and other non-permanent materials, traditional Chinese architecture is one of the most fragile constructions in various heritage objects today. With the increasing emphasis on the protection of cultural relics, the repair project of wooden structure has become more and more important. There are various kinds of destructions, which pose a hidden danger to the overall safety of the ancient buildings, caused not only by time and nature, but also by improper repairs in history or nowadays. Today, the use of digital technology is a basic requirement in the conservation of cultural heritage. Detection technology, especially non-destructive testing technology, could provide more accurate records in capturing detailed physical characteristics of structures such as geometric deformation and invisible damage, as well as prevent a man-made destruction in the process of repair project. This paper aims to interpret with a typical example, Ancestral Temple in Mukden Palace, along with a discussion of how to use the non-destructive testing technology with ground penetrating radar, stress wave, resistograph and so on, in addition to find an appropriate protection method in repair project of traditional Chinese wooden architecture.

  18. La aportación estructural del Crystal Palace de la Exposición Universal de Londres 1851

    Directory of Open Access Journals (Sweden)

    Isaac López César

    2014-10-01

    Full Text Available El objetivo del presente artículo es el de establecer la línea histórica que conduce desde la aplicación arquitectónica de los primeros elementos estructurales de hierro industrializado en edificios de varias plantas y cubiertas hasta la aplicación primigenia del pórtico rígido autoportante en un edificio de varias plantas. En este recorrido, el Crystal Palace de la Exposición Universal de Londres 1851 se revela como un elemento clave que articula la transición desde la tipología de entra­mado metálico estabilizado por muros perimetrales de fábrica hasta la moderna formalización del pórtico rígido autoestable aplicado al edificio en altura. Asimismo se detectan las conexiones históricas existentes en dicho proceso, poniendo en valor edificios que han permanecido al margen de la historiografía arquitectónica convencional. Ampliamos, por tanto, el foco histórico centrado tradicionalmente en los logros de la Escuela de Chicago destacando y conectando históricamente los acontecimientos anteriores.

  19. Romantic versus scientific perspective: the ruins of Radlin palace in Wielkopolska region in the light of remote sensing techniques

    Science.gov (United States)

    Wilgocka, Aleksandra; Ruciński, Dominik; RÄ czkowski, Włodzimierz

    2015-06-01

    Although ruins of palace in Radlin, localized in Wielkopolska Region (Poland), could have been a great inspiration for romantic landscape painters, they were hardly considered as the subject of artistic interest. Nevertheless they stand as a marker in a landscape as a romantic background for the village on one hand and a memento for the neighbouring graveyard on another. Small scale excavations carried out in late 1950s with historical maps and analysis of still standing remains gave a general idea about wings order, localisation of main entrance and communication routs inside courtyard. Those early research thereby were the first step to change the meaning of this place from romantic to more scientific. New remote sensing technology allows move even further into scientific direction. The ruins in Radlin have been included into project ArchEO - archaeological applications of Earth Observation techniques. The main aim of the project in case of Radlin is an attempt to answer the question to what extent very high resolution optical satellite imagery might allow better understanding the spatial structure of the place. The various processing techniques were applied to facilitate the detection of archaeological features' impact on the vegetation condition. It enabled to assess the usefulness of satellite based data in recognizing specific archaeological remains. Thus, potential and limitations of satellite imagery versus other sources of spatial information like historic maps, excavation results, aerial photographs and Lidar will be discussed.

  20. Use of the LIBS method in oil paintings examination based on examples of analyses conducted at the Wilanow Palace Museum

    Science.gov (United States)

    Modzelewska, ElŻbieta; Pawlak, Agnieszka; Selerowicz, Anna; Skrzeczanowski, Wojciech; Marczak, Jan

    2013-05-01

    This paper describes the preliminary results of a study of the paint layers in 17th-century paintings belonging to the collection of the Wilanow Palace Museum. The works chosen for examination are of great importance to the Museum, as they might have been painted by court artists of King John III Sobieski. The aim of the study was therefore to determine the technological structure of the paintings, to determine the scope of conservation interventions and, above all, to gather comparative material that would serve to conduct further multidisciplinary attributive research. The presentation relates to studies in which laser-induced breakdown spectroscopy (LIBS) and optical microscopy were used as diagnostic tools. LIBS is based on the evaporation of a small amount of the material under investigation, and the generation of plasma which emits continuum and line radiation. The analysis of line radiation allows us to identify the elements appearing in the sample being investigated. The microscope pictures were taken using a Bresser Digital Hand Micro 1.3Mpx and the Hirox 8700 microscopes. The results obtained have confirmed the utility of the LIBS method in the study of artworks. They have also proven that it can be used as a method to complement microchemical analysis, as well as an method to identify and examine artworks from which samples cannot be taken, as it is micro-destructive and the analysis can be conducted directly on the object, without the need to take samples.

  1. The Monitoring and Analysis of the Chinese Traditional Architecture Painting Decay - the Case of Jilan Pavilion in the Summer Palace

    Science.gov (United States)

    Zhan, L.; Wang, Z.; Zhao, X.; Liu, Z.; Liu, G.

    2017-08-01

    The painting is one of the most decorative elements of ancient Chinese architecture and it is sensitive to the natural environment. The outdoor painting is very easily to be affected by the natural environment and its color is easily to decay. In order to study the relationship between the painting decay and the physical environment, the two paintings on both east and west inner eaves of Jilan Pavilion beside the Kunming Lake in Summer Palace are taken as the research objects, because these two paintings are painted at the same period but their decay degrees are greatly different. Since 2013, the research group regularly monitors the color decay of these two paintings. Meanwhile, the physical environment around these two paintings has been monitored. Based on the analysis of the monitor data, it can be seen that the illumination is the major factor that causes the decay of the painting. Meanwhile, by using the ECOTECT software to stimulate the light environment around the Jilan Pavilion, it can be seen that it is the mirror reflection of the lake that causes the result that the illumination of the west eave (face east) is stronger than that of the east eave (face west).

  2. A Phase III, Randomized, Controlled Trial of Apremilast in Patients with Psoriatic Arthritis: Results of the PALACE 2 Trial.

    Science.gov (United States)

    Cutolo, Maurizio; Myerson, Gary E; Fleischmann, Roy M; Lioté, Frédéric; Díaz-González, Federico; Van den Bosch, Filip; Marzo-Ortega, Helena; Feist, Eugen; Shah, Kamal; Hu, ChiaChi; Stevens, Randall M; Poder, Airi

    2016-09-01

    Apremilast, an oral phosphodiesterase 4 inhibitor, downregulates intracellular inflammatory mediator synthesis by elevating cyclic adenosine monophosphate levels. The PALACE 2 trial evaluated apremilast efficacy and safety in patients with active psoriatic arthritis (PsA) despite prior conventional disease-modifying antirheumatic drugs and/or biologic therapy. Eligible patients were randomized (1:1:1) to placebo, apremilast 20 mg BID, or apremilast 30 mg BID. At Week 16, patients with swollen and tender joint count improvement 20% improvement in American College of Rheumatology response criteria (ACR20) at Week 16. In the intent-to-treat population (N = 484), ACR20 at Week 16 was achieved by more patients receiving apremilast 20 mg BID [37.4% (p = 0.0002)] and 30 mg BID [32.1% (p = 0.0060)] versus placebo (18.9%). Clinically meaningful improvements in signs and symptoms of PsA, physical function, and psoriasis were observed with apremilast through Week 52. The most common adverse events were diarrhea, nausea, headache, and upper respiratory tract infection. Diarrhea and nausea generally occurred early and usually resolved spontaneously with continued treatment. Laboratory abnormalities were infrequent and transient. Apremilast demonstrated clinical improvements in PsA for up to 52 weeks, including signs and symptoms, physical function, and psoriasis. No new safety signals were observed. ClinicalTrials.gov identifier: NCT01212757.

  3. Frogs Communicate by Means of Ultrasonic Sounds

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ People are always fascinated by ways that some members of mammalian species (such as dolphins, bats and some rodents) communicate using sounds that we cannot hear. But think twice if you say the capacity of producing and detecting ultrasounds (frequencies greater than 20kHz) is limited to mammalians. A study implemented by Prof. SHEN Junxian from the CAS Institute of Biophysics (IBP) and colleagues in CAS and abroad showed that a rare frog species in China should also be added to that list. It is the first documented case of a non-mammalian species being able to use ultrasonic communication. Their work was reported in the March 16 issue of the journal Nature.

  4. Cutaneous acariasis in the African clawed frog (Xenopus laevis).

    Science.gov (United States)

    Ford, Timothy R; Dillehay, Dirck L; Mook, Deborah M

    2004-12-01

    Increased mortality was observed in a single colony of 50 Xenopus laevis. The frogs were used as oocyte donors in developmental biology studies. Necropsy findings included dermal erythema and petechiation consistent with red leg syndrome; dermal ulcerations and white, filamentous growths on the skin were consistent with Saprolegnia sp. Microscopic evaluation of the skin and fungus revealed an astigmatid mite similar to those of the genus Rhizoglyphus. The mite was also found in the water and the biological filter of the tanks housing the frogs. This mite is considered not to be a parasite of X. laevis; instead, it feeds off moss, fungi, and detritus. Subsequent evaluation of the sphagnum moss used for shipping the frogs from the supplier revealed the same mite in the moss. Our hypothesis is that the mite was introduced into the tank with the shipment of new frogs in sphagnum moss. The mites lived within the biological filter, and were only found after the growth of Saprolegnia sp. attracted the mites to the frogs. Laboratory animal care and veterinary personnel should consider non-pathogenic species of mites in the differential diagnosis of acariasis in Xenopus frogs.

  5. Distribution, structure and projections of the frog intracardiac neurons.

    Science.gov (United States)

    Batulevicius, Darius; Skripkiene, Gertruda; Batuleviciene, Vaida; Skripka, Valdas; Dabuzinskiene, Anita; Pauza, Dainius H

    2012-05-21

    Histochemistry for acetylcholinesterase was used to determine the distribution of intracardiac neurons in the frog Rana temporaria. Seventy-nine intracardiac neurons from 13 frogs were labelled iontophoretically by the intracellular markers Alexa Fluor 568 and Lucifer Yellow CH to determine their structure and projections. Total neuronal number per frog heart was (Mean ± SE) 1374 ± 56. Largest collections of neurons were found in the interatrial septum (46%), atrioventricular junction (25%) and venal sinus (12%). Among the intracellularly labelled neurons, we found the cells of unipolar (71%), multipolar (20%) and bipolar (9%) types. Multiple processes originated from the neuron soma, hillock and proximal axon. These processes projected onto adjacent neuron somata and cardiac muscle fibers within the interatrial septum. Average total length of the processes from proximal axon was 348 ± 50 μm. Average total length of processes from soma and hillock was less, 118 ± 27 μm and 109 ± 24 μm, respectively. The somata of 59% of neurons had bubble- or flake-shaped extensions. Most neurons from the major nerves in the interatrial septum sent their axons towards the ventricle. In contrast, most neurons from the ventral part of the interatrial septum sent their axons towards the atria. Our findings contradict to a view that the frog intracardiac ganglia contain only non-dendritic neurons of the unipolar type. We conclude that the frog intracardiac neurons are structurally complex and diverse. This diversity may account for the complicated integrative functions of the frog intrinsic cardiac ganglia.

  6. Is chytridiomycosis driving Darwin's frogs to extinction?

    Directory of Open Access Journals (Sweden)

    Claudio Soto-Azat

    Full Text Available Darwin's frogs (Rhinoderma darwinii and R. rufum are two species of mouth brooding frogs from Chile and Argentina that have experienced marked population declines. Rhinoderma rufum has not been found in the wild since 1980. We investigated historical and current evidence of Batrachochytrium dendrobatidis (Bd infection in Rhinoderma spp. to determine whether chytridiomycosis is implicated in the population declines of these species. Archived and live specimens of Rhinoderma spp., sympatric amphibians and amphibians at sites where Rhinoderma sp. had recently gone extinct were examined for Bd infection using quantitative real-time PCR. Six (0.9% of 662 archived anurans tested positive for Bd (4/289 R. darwinii; 1/266 R. rufum and 1/107 other anurans, all of which had been collected between 1970 and 1978. An overall Bd-infection prevalence of 12.5% was obtained from 797 swabs taken from 369 extant individuals of R. darwinii and 428 individuals representing 18 other species of anurans found at sites with current and recent presence of the two Rhinoderma species. In extant R. darwinii, Bd-infection prevalence (1.9% was significantly lower than that found in other anurans (7.3%. The prevalence of infection (30% in other amphibian species was significantly higher in sites where either Rhinoderma spp. had become extinct or was experiencing severe population declines than in sites where there had been no apparent decline (3.0%; x(2 = 106.407, P<0.001. This is the first report of widespread Bd presence in Chile and our results are consistent with Rhinoderma spp. declines being due to Bd infection, although additional field and laboratory investigations are required to investigate this further.

  7. Frog Foam Nest Protein Diversity and Synthesis.

    Science.gov (United States)

    Hissa, Denise Cavalcante; Bezerra, Walderly Melgaço; Freitas, Cléverson Diniz Teixeira De; Ramos, Márcio Viana; Lopes, José Luiz De Souza; Beltramini, Leila Maria; Roberto, Igor Joventino; Cascon, Paulo; Melo, Vânia Maria Maciel

    2016-08-01

    Some amphibian species have developed a breeding strategy in which they deposit their eggs in stable foam nests to protect their eggs and larvae. The frog foam nests are rich in proteins (ranaspumin), especially surfactant proteins, involved in the production of the foam nest. Despite the ecological importance of the foam nests for evolution and species conservation, the biochemical composition, the long-term stability and even the origin of the components are still not completely understood. Recently we showed that Lv-RSN-1, a 23.5-kDa surfactant protein isolated from the nest of the frog Leptodacylus vastus, presents a structural conformation distinct from any protein structures yet reported. So, in the current study we aimed to reveal the protein composition of the foam nest of L. vastus and further characterize the Lv-RSN-1. Proteomic analysis showed the foam nest contains more than 100 of proteins, and that Lv-RSN-1 comprises 45% of the total proteins, suggesting a key role in the nest construction and stability. We demonstrated by Western blotting that Lv-RSN-1 is mainly produced only by the female in the pars convoluta dilata, which highlights the importance of the female preservation for conservation of species that depend on the production of foam nests in the early stages of development. Overall, our results showed the foam nest of L. vastus is composed of a great diversity of proteins and that besides Lv-RSN-1, the main protein in the foam, other proteins must have a coadjuvant role in building and stability of the nest.

  8. Frogs on the beach: Ecology of California Red-legged Frogs (Rana draytonii) in coastal dune drainages

    Science.gov (United States)

    Halstead, Brian J.; Kleeman, Patrick M.

    2017-01-01

    California Red-legged Frogs (Rana draytonii) are typically regarded as inhabitants of permanent ponds, marshes, and slow-moving streams, but their ecology in other habitats, such as drainages among coastal dunes, remains obscure. Because coastal dune ecosystems have been degraded by development, off-highway vehicle use, stabilization, and invasive species, these unique ecosystems are the focus of restoration efforts. To better understand the ecology of California Red-legged Frogs in coastal dune ecosystems and to avoid and minimize potential negative effects of dune restoration activities on these rare frogs, we studied their spatial ecology, habitat selection, and survival in coastal dune drainages at Point Reyes National Seashore, California, USA. All 22 radio-marked frogs remained in their home drainages throughout the spring and summer of 2015 and, with some notable exceptions, most remained close to water. Local convex hull home ranges of four out of five California Red-legged Frogs with > 20 observations in dunes were < 1,600 m2 . At the population level, frogs were 1.7 (95% credible interval, 1.2‒4.4) times more likely to select sites 1 m closer to water, and were 83 (2.0‒17,000) times more likely to select sites with 10% greater percentage cover of logs that served as refuges from environmental extremes and predators. On average, California Red-legged Frogs avoided the invasive plants Iceplant (Carpobrotus edulis) and European Beachgrass (Ammophila arenaria). Frogs were 0.68 (0.32‒0.89) and 0.55 (0.24‒0.75) times as likely to select areas that had 10% greater cover of these plants, respectively. Assuming constant risk of mortality, California Redlegged Frogs had an annual survival rate of 0.70 (0.27‒0.96) in coastal dune drainages. Our results indicate that coastal dune drainages provide a locally important habitat for California Red-legged Frogs. Restoration practices that maintain wetted drainages with logjams are likely to benefit California

  9. Experiment for Development of Simple Escape Countermeasures for Frogs Falling into Concrete Canals

    Science.gov (United States)

    Watabe, Keiji; Mori, Atsushi; Koizumi, Noriyuki; Takemura, Takeshi; Park, Myeong Soo

    Three prototype escape countermeasures for frogs that can be easily installed in U-shaped canals with widths of 30-50 cm and depths of 30-50 cm were experimentally produced because frogs cannot escape from agricultural canals with deep concrete walls after falling into the canal. The differences of effectiveness of the 3 prototypes in places for the countermeasures (1 and 2) and flow conditions (dry and water running) were investigated for 2 frog species (Tokyo Daruma Pond Frog and Japanese Brown Frog). The brown frogs escaped from the canals more easily than the pond frogs. The brown frogs escaped regardless of their body size, but the small pond frogs escaped more easily than the large pond frogs. The prototype with slopes beside both canal walls and a net spread across the center line of the canal enabled frogs to escape from the canal more easily than the prototypes with only slopes or nets beside both canal walls. Increasing the number of places for the countermeasures enhanced frog escape. The differences in frog escape between dry canals and canals with water running were not significant. Therefore, the prototypes were confirmed sufficient as escape countermeasures that is inexpensive and can be easily placed in and removed from agricultural canals.

  10. Resurrecting an Extinct Species: Archival DNA, Taxonomy, and Conservation of the Vegas Valley Leopard Frog

    Science.gov (United States)

    Suggestions that the extinct Vegas Valley leopard frog (Rana fisheri = Lithobates fisheri) may have been synonymous with one of several declining species has complicated recovery planning for imperiled leopard frogs in southwestern North America. To address this concern, we recon...

  11. Prostaglandin E2 release from dermis regulates sodium permeability of frog skin epithelium

    DEFF Research Database (Denmark)

    Rytved, Klaus A.; Brodin, Birger; Nielsen, Robert

    1995-01-01

    Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium.......Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium....

  12. Cystic urolithiasis in captive waxy monkey frogs (Phyllomedusa sauvagii).

    Science.gov (United States)

    Archibald, Kate E; Minter, Larry J; Dombrowski, Daniel S; O'Brien, Jodi L; Lewbart, Gregory A

    2015-03-01

    The waxy monkey frog (Phyllomedusa sauvagii) is an arboreal amphibian native to arid regions of South America, and it has developed behavioral and physiologic adaptations to permit survival in dry environments. These adaptations include a uricotelic nitrogen metabolism and unique cutaneous lipid excretions to prevent evaporative water loss. Uroliths are a rare finding in amphibians. Six adult, presumed wild-caught waxy monkey frogs housed in a museum animal collection were diagnosed with cystic urolithiasis over a 7-yr period, and a single animal was diagnosed with four recurrent cases. Six cases were identified incidentally at routine physical or postmortem examination and four cases were identified during veterinary evaluation for coelomic distension, lethargy, anorexia, and increased soaking behavior. Calculi were surgically removed from three frogs via cystotomy, and a single frog underwent three cystotomies and two cloacotomies for recurrent urolithiasis. Two frogs died within the 24-hr postoperative period. Two representative calculi from a single frog were submitted for component analysis and found to consist of 100% ammonium urate. In the present report, cystic calculi are proposed to be the result of a high-protein diet based on a single invertebrate source, coupled with uricotelism, dehydration, increased cutaneous water loss, body temperature fluctuations facilitating supersaturation of urine, and subsequent accumulation and precipitation of urogenous wastes within the urinary bladder. Surgical cystotomy represents a short-term treatment strategy for this condition. Preventative measures, such as supplying a diversified and balanced diet in addition to environmental manipulation aimed at promoting adequate hydration, are anticipated to be more-rewarding management tools for cystic urolithiasis in the waxy monkey frog.

  13. Panamanian frog species host unique skin bacterial communities

    Directory of Open Access Journals (Sweden)

    Lisa K. Belden

    2015-10-01

    Full Text Available Vertebrates, including amphibians, host diverse symbiotic microbes that contribute to host disease resistance. Globally, and especially in montane tropical systems, many amphibian species are threatened by a chytrid fungus, Batrachochytrium dendrobatidis (Bd, that causes a lethal skin disease. Bd therefore may be a strong selective agent on the diversity and function of the microbial communities inhabiting amphibian skin. In Panamá, amphibian population declines and the spread of Bd have been tracked. In 2012, we completed a field survey in Panamá to examine frog skin microbiota in the context of Bd infection. We focused on three frog species and collected two skin swabs per frog from a total of 136 frogs across four sites that varied from west to east in the time since Bd arrival. One swab was used to assess bacterial community structure using 16S rRNA amplicon sequencing and to determine Bd infection status, and one was used to assess metabolite diversity, as the bacterial production of anti-fungal metabolites is an important disease resistance function. The skin microbiota of the three Panamanian frog species differed in OTU (operational taxonomic unit, ~bacterial species community composition and metabolite profiles, although the pattern was less strong for the metabolites. Comparisons between frog skin bacterial communities from Panamá and the US suggest broad similarities at the phylum level, but key differences at lower taxonomic levels. In our field survey in Panamá, across all four sites, only 35 individuals (~26% were Bd infected. There was no clustering of OTUs or metabolite profiles based on Bd infection status and no clear pattern of west-east changes in OTUs or metabolite profiles across the four sites. Overall, our field survey data suggest that different bacterial communities might be producing broadly similar sets of metabolites across frog hosts and sites. Community structure and function may not be as tightly coupled in

  14. Frog community responses to recent American bullfrog invasions

    Directory of Open Access Journals (Sweden)

    Yiming LI, Zhunwei KE, Yihua WANG, Tim M. BLACKBURN

    2011-02-01

    Full Text Available Native species may decline quickly when confronted with an exotic species to which they are not adapted. The extent of decline may depend on the abundance of an invader and the length of time since it first arrived in the community (residence time, and the interaction between these two variables. We tested these effects using data on the effects of American bullfrog Lithobates catesbeianus invasion on native frog communities in 65 permanent lentic waters on islands in the Zhoushan Archipelago, China. We examined variation in native frog abundance and species richness in relation to features of the American bullfrog invasion, habitat disturbance, characteristics of the water body and fish communities and the presence of red swamp crayfish. Bullfrog invaded sites had lower native frog density and species richness, higher submerged vegetation cover and greater frequency of repairs to the water body than did non-invaded sites. The minimum adequate general linear mixed models showed that both native frog density and species richness were negatively related to post-metamorphosis bullfrog density, and that native frog species richness was also positively related to the vegetation cover. There was no effect on either native frog density or species richness of residence time or its interaction with bullfrog density, or of the abundance of bullfrog tadpoles. The results suggested that post-metamorphosis bullfrogs had impacts on native frog communities in the islands, and that the extents of these impacts are proportional to post-metamorphosis bullfrog density [Current Zoology 57 (1: 83–92, 2011].

  15. Phylogeny and biogeography of South Chinese brown frogs (Ranidae, Anura).

    Science.gov (United States)

    Zhou, Yu; Wang, Sirui; Zhu, Hedan; Li, Pipeng; Yang, Baotian; Ma, Jianzhang

    2017-01-01

    Few studies have explored the role of Cenozoic tectonic evolution in shaping the patterns and processes of extant animal distributions in and around East Asia. In this study, we selected South Chinese brown frogs as a model to examine the phylogenetic and biogeographical consequences of Miocene tectonic events within South China and its margins. We used mitochondrial and nuclear molecular data to reconstruct phylogenetic interrelationships among Chinese brown frogs using Bayesian and maximum likelihood analyses. The phylogeny results show that there are four main clades of Chinese brown frogs. Excepting the three commonly known Chinese brown frog species groups, R. maoershanensis forms an independent clade nearest to the R. japonica group. Phylogeny and P-distance analyses confirmed R. maoershanensis as a valid species. Among South Chinese brown frogs, there are four subclades associated with four geographical areas: (I) R. maoershanensis; (II) R. japonica; (III) R. chaochiaoensis; and (IV) other species of the R. longicrus species group. Divergence times, estimated using mitochondrial sequences, place the vicariance events among the four subclades in the middle to late Miocene epoch. Our results suggest that (1) South Chinese brown frogs originated due to a vicariance event separating them from the R. chensinensis species group at the time of the Geological movement (~18 million years ago, Ma) in southern Tibet and the Himalayan region; (2) the separation and speciation of R. maoershanensis from the R. japonica group occurred due to the dry climate at approximately 16 Ma; (3) South Chinese brown frogs migrated from South China to Japan at the time (~10.8 Ma) that the global sea-level fell and the East China Sea Shelf Basin was swamp facies, when a land gallery may have formed across the sea to connect the two areas; and (4) R. chaochiaoensis separated from other species of the R. longicrus species group during the uplift of the Tibetan Plateau at approximately 9

  16. Complete mitochondrial genome of the Greek marsh frog Pelophylax cretensis (Anura, Ranidae).

    Science.gov (United States)

    Hofman, Sebastian; Pabijan, Maciej; Osikowski, Artur; Szymura, Jacek M

    2016-05-01

    We sequenced the complete mitochondrial genome of the Greek marsh frog Pelophylax cretensis, a water frog species endemic to the island of Crete. The genome sequence was 17,829 bp in size, and the gene order and contents were identical to those of previously reported mitochondrial genomes of other water frog species. This is the first complete mitogenome (i.e. including control region) described for western Palaearctic water frogs.

  17. 75 FR 8733 - Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With Assurances; Receipt of...

    Science.gov (United States)

    2010-02-25

    ... Fish and Wildlife Service Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With... (CCAA) for the least chub (Iotichthys phlegethontis) and Columbia spotted frog (Rana lutreiventris..., least chub and Columbia spotted frog inhabited a variety of aquatic habitat types throughout...

  18. 49 CFR 236.327 - Switch, movable-point frog or split-point derail.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch, movable-point frog or split-point derail..., AND APPLIANCES Interlocking Rules and Instructions § 236.327 Switch, movable-point frog or split-point derail. Switch, movable-point frog, or split-point derail equipped with lock rod shall be maintained...

  19. 49 CFR 213.143 - Frog guard rails and guard faces; gage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.143... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.143 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs shall be within the...

  20. La couleur des palais royaux espagnols du xvie au xviiie siècle The colour of Spanish royal palaces from the sixteenth to eighteenth centuries

    Directory of Open Access Journals (Sweden)

    Juan Hernández Ferrero

    2008-05-01

    Full Text Available En Espagne, l’architecture des châteaux royaux, monochrome, n’accorde aucune véritable importance esthétique à la couleur. Ainsi, le monastère de l’Escurial, également palais royal, utilise le gris (teinte quelque peu modifiée de nos jours comme élément conférant une uniformité architecturale. Mais, au cours du xviie siècle, les façades du nouveau palais du Buen Retiro reçoivent une coloration discrète qui vise à les mettre en valeur. La couleur intègre alors le vocabulaire des architectes pour finalement s’affirmer dans l’usage au xviiie siècle, comme nous le verrons avec les palais royaux de Madrid, du Pardo, de Riofrío et de La Granja de San Ildefonso. Ainsi se trouve contredite la théorie initiale d’absence de couleur dans les résidences royales d’Espagne. Cette évolution est le fruit de l’influence européenne sur l’art espagnol.In Spain, the monochromatic architecture of royal chateaux placed no real aesthetic importance on colour. The El Escurial monastery, also a royal palace, used the colour grey (a tone somewhat modified today to provide an architectural uniformity. But during the seventeenth century the facades of the new Buen Retiro palace were given a discreet colouring that aimed to enhance them. Colour began to be used by architects, and widely so in the eighteenth century, as we will see with the royal palaces of Madrid, El Pardo, Riofrío and La Granja de San Ildefonso – contradicting the initial theory that colour was absent from the royal residences of Spain. This development was a result of the European influence on Spanish art.

  1. 可持续发展的颐和园夜间开放策略%Sustainable Development Strategies about Opening the Summer Palace at Night

    Institute of Scientific and Technical Information of China (English)

    刘刚; 荣华; 高大伟

    2011-01-01

    作为世界文化遗产的颐和园是旅游参观的高密度园林景区,随着国内外参观需求的提升.颐和园面临着激增的参观需求与有限的游览承受力之间的矛盾.为了保证世界文化遗产的可持续利用,同时最大化地满足参观要求,颐和园在充分考虑夜晚展示特点、园区与游人安全、运营经济指标等方面的基础上,采用局部开放、定量开放、团体接待为主的独具特色的夜间开园参观的方法来解决这一矛盾.通过介绍这种可持续发展的参观策略,以期对类似的文化遗产提供一种科学的保护与利用途径.%As the world cultural heritage, the Summer Palace is high-densely attractive. Along with the increase of visiting requirement at home and abroad, the Summer Palace is facing the contradiction between the sharp increase of visiting demands and limited tourism resources For the purpose of sustainable utilization of world cultural heritage and meeting the visiting demands, taking full account of the night show features of the park, visitor safety, operation economic indicators and other aspects, the Summer Palace adopts unique visiting method which partially open, quantitative open and group visits at night as the solution to solve this problem. This article introduces the sustainable development visiting strategy to supply a scientific protection and utilization approach for analogous cultural legacy.

  2. THE TOTALITARIAN ACHIEVEMENT AND MAINTENANCE OF ABSOLUTE CONTROL OVER MAN IN GEORGE ORWELL`S 1984 AND ISMAIL KADARE`S THE PALACE OF DREAMS

    Directory of Open Access Journals (Sweden)

    Ervin XHINAKU

    2015-05-01

    Full Text Available In this study we have subjected Orwell‘s classic dystopia 1984 and Kadare‘s most important anti-totalitarian allegory The Palace of Dreams to a comparative analysis focused on their representation of the essential characteristic of totalitarianism – its urge to achieve and maintain absolute control over all aspects of the individual‘s life. By juxtaposing and comparatively analysing the key features of totalitarian control in Orwell‘s fictional Oceania and in Kadare‘s allegorical rendition of the Ottoman Empire, we hope to throw a more discriminating light on the fundamental conception of totalitarianism that is found in the two novels.

  3. Tourism and the Conservation of Critically Endangered Frogs

    Science.gov (United States)

    Morrison, Clare; Simpkins, Clay; Castley, J. Guy; Buckley, Ralf C.

    2012-01-01

    Protected areas are critical for the conservation of many threatened species. Despite this, many protected areas are acutely underfunded, which reduces their effectiveness significantly. Tourism is one mechanism to promote and fund conservation in protected areas, but there are few studies analyzing its tangible conservation outcomes for threatened species. This study uses the 415 IUCN critically endangered frog species to evaluate the contribution of protected area tourism revenue to conservation. Contributions were calculated for each species as the proportion of geographic range inside protected areas multiplied by the proportion of protected area revenues derived from tourism. Geographic ranges were determined from IUCN Extent of Occurrence maps. Almost 60% (239) of critically endangered frog species occur in protected areas. Higher proportions of total range are protected in Nearctic, Australasian and Afrotopical regions. Tourism contributions to protected area budgets ranged from 5–100%. These financial contributions are highest for developing countries in the Afrotropical, Indomalayan and Neotropical regions. Data for both geographic range and budget are available for 201 critically endangered frog species with proportional contributions from tourism to species protection ranging from 0.8–99%. Tourism's financial contributions to critically endangered frog species protection are highest in the Afrotropical region. This study uses a coarse measure but at the global scale it demonstrates that tourism has significant potential to contribute to global frog conservation efforts. PMID:22984440

  4. Efficacy of frog skin lipids in wound healing

    Directory of Open Access Journals (Sweden)

    Rajaram Rama

    2010-07-01

    Full Text Available Abstract Background Frog skin has been sequentially and scientifically evaluated by our group for its wound healing efficiency. Owing to the complex structure of skin, attempts were being made to analyse the role of individual constituents in different phases of healing. Our earlier papers have shown the significance of frog skin not only in wound healing but also enhancing the proliferating activity of the epidermal and dermal cells which are instrumental for normal healing process. We also have identified for the first time novel antimicrobial peptides from the skin of Rana tigerina and thereby reduce the complications involved in the sepsis. Purpose of the study and Results The current study envisages the role of frog skin lipids in the inflammatory phase of wound healing. The lipid moiety of the frog skin dominated by phospholipids exhibited a dose dependent acceleration of healing irrespective of the mode of application. The efficiency of the extract is attributed partially to the anti-inflammatory activity as observed by the histochemical and immunostimulatory together with plethysmographic studies. Conclusions Thus, frog skin for the first time has been demonstrated to possess lipid components with pharmaceutical and therapeutic potential. The identification and characterization of such natural healing molecules and evaluating their mechanism of action would therefore provide basis for understanding the cues of Nature and hence can be used for application in medicine.

  5. Drainage ditches facilitate frog movements in a hostile landscape

    Science.gov (United States)

    Mazerolle, M.J.

    2005-01-01

    Ditches are common in landscapes influenced by agricultural, forestry, and peat mining activities, and their value as corridors remains unassessed. Pond-breeding amphibians can encounter hostile environments when moving between breeding, summering, or hibernation sites, and are likely to benefit from the presence of ditches in the landscape. Within a system consisting of ditch networks in bogs mined for peat in eastern New Brunswick, Canada, I quantified the breeding, survival, and movements of green frogs (Rana clamitans melanota) in drainage ditches and also surveyed peat fields. Frogs rarely ventured on peat fields and most individuals frequented drainage ditches containing water, particularly in late summer. Though frogs did not breed in ditches, their survival rate in ditches was high (88%). Ditches did not hinder frog movements, as frogs moved independently of the current. Results indicate that drainage ditches containing water enable some movements between habitats isolated by peat mining, in contrast to peat surfaces, and suggest they function as amphibian movement corridors. Thus, such drainage ditches may mitigate the effects of peat extraction on amphibian populations. At the very least, these structures provide an alternative to hostile peat surfaces. This study highlights that small-scale corridors are potentially valuable in population dynamics. ?? Springer 2005.

  6. Frog sound identification using extended k-nearest neighbor classifier

    Science.gov (United States)

    Mukahar, Nordiana; Affendi Rosdi, Bakhtiar; Athiar Ramli, Dzati; Jaafar, Haryati

    2017-09-01

    Frog sound identification based on the vocalization becomes important for biological research and environmental monitoring. As a result, different types of feature extractions and classifiers have been employed to evaluate the accuracy of frog sound identification. This paper presents a frog sound identification with Extended k-Nearest Neighbor (EKNN) classifier. The EKNN classifier integrates the nearest neighbors and mutual sharing of neighborhood concepts, with the aims of improving the classification performance. It makes a prediction based on who are the nearest neighbors of the testing sample and who consider the testing sample as their nearest neighbors. In order to evaluate the classification performance in frog sound identification, the EKNN classifier is compared with competing classifier, k -Nearest Neighbor (KNN), Fuzzy k -Nearest Neighbor (FKNN) k - General Nearest Neighbor (KGNN)and Mutual k -Nearest Neighbor (MKNN) on the recorded sounds of 15 frog species obtained in Malaysia forest. The recorded sounds have been segmented using Short Time Energy and Short Time Average Zero Crossing Rate (STE+STAZCR), sinusoidal modeling (SM), manual and the combination of Energy (E) and Zero Crossing Rate (ZCR) (E+ZCR) while the features are extracted by Mel Frequency Cepstrum Coefficient (MFCC). The experimental results have shown that the EKNCN classifier exhibits the best performance in terms of accuracy compared to the competing classifiers, KNN, FKNN, GKNN and MKNN for all cases.

  7. Occurrence and Distribution of Cave Dwelling Frogs of Peninsular India

    Directory of Open Access Journals (Sweden)

    Jayant Biswas

    2014-10-01

    Full Text Available The life in subterranean caves always needs a high degree of biological adaptability, due to its unusual ecosystem. The cave dwelling species usually get selected from preadapted biological traits for cave life. The cave dwelling tendencies in frog are very uncommon. Majority of reported cave frogs usually prefer cave for temporary shelter. In India, the biospeleological inventory is still in its primary stage. Till date no serious attempt has been taken to understand the cave dwelling habitat for any frog in India. Inspite of it, in India time to time various reports on natural histories of anurans reveal its cave dwelling tendencies. On the basis of personal observations and available literature in this report I have documented the occurrences and distributions of five cave dwelling frogs of India. Common biological traits from all the established cave frogs, which could be referred as preadapted for cave life, have been discussed. Further, the possible threats and IUCN status of each discussed species has been highlighted.

  8. Isoflurane anesthesia in the African clawed frog (Xenopus laevis).

    Science.gov (United States)

    Smith, J M; Stump, K C

    2000-11-01

    Isoflurane is one of the safest and most accepted anesthetic agents for reptiles, birds, and mammals. It has also been used in terrestrial amphibians. The use of inhalation agents in an entirely aquatic frog presents a new dilemma for delivery in contrast to terrestrial species. The African Clawed Frog respires by using both transcutaneous gas exchange and air breathing. These frogs remain submerged for long periods of time, thus making standard inhalation techniques impractical. We tested five methods for delivering isoflurane: 1) bubbling isoflurane and oxygen in the water, 2) intracoelomic injection, 3) subcutaneous injection, 4) intramuscular injection, and 5) topical application. For the topical application, we developed a simple technique by using an absorptive pad with a vapor-barrier backing, saturating the pad with the liquid isoflurane, and placing the pad on the back of the frog while it was confined in a plastic bowl. Although two of the three injectable routes induced anesthesia, only the topical route produced rapid induction with consistent, safe recovery. Bubbling isoflurane with oxygen into water was unsuccessful. Topical application of isoflurane was most successful and appears to be a safe and practical method that can be used as an alternative to tricaine methylsulphonate, hypothermia, or other methods for anesthetizing African Clawed Frogs.

  9. Biological Jumping Mechanism Analysis and Modeling for Frog Robot

    Institute of Scientific and Technical Information of China (English)

    Meng Wang; Xi-zhe Zang; Ji-zhuang Fan; Jie Zhao

    2008-01-01

    This paper presents a mechanical model of jumping robot based on the biological mechanism analysis of frog. By biological observation and kinematic analysis the frog jump is divided into take-off phase, aerial phase and landing phase. We find the similar trajectories of hindlimb joints during jump, the important effect of foot during take-off and the role of forelimb in supporting the body. Based on the observation, the frog jump is simplified and a mechanical model is put forward. The robot leg is represented by a 4-bar spring/linkage mechanism model, which has three Degrees of Freedom (DOF) at hip joint and one DOF (passive) at tarsometatarsal joint on the foot. The shoulder and elbow joints each has one DOF for the balancing function of arm.The ground reaction force of the model is analyzed and compared with that of frog during take-off. The results show that the model has the same advantages of low likelihood of premature lift-off and high efficiency as the frog. Analysis results and the model can be employed to develop and control a robot capable of mimicking the jumping behavior of flog.

  10. A potential wound healing-promoting peptide from frog skin.

    Science.gov (United States)

    Liu, Han; Mu, Lixian; Tang, Jing; Shen, Chuanbin; Gao, Chen; Rong, Mingqiang; Zhang, Zhiye; Liu, Jie; Wu, Xiaoyang; Yu, Haining; Lai, Ren

    2014-04-01

    Cutaneous wound healing is a dynamic, complex, and well-organized process that requires the orchestration of many different cell types and cellular processes. Transforming growth factor β1 is an important factor that plays a key role during wound healing. Amphibian skin has been proven to possess excellent wound healing ability, whilst no bioactive substrate related to it has ever been identified. Here, a potential wound healing-promoting peptide (AH90, ATAWDFGPHGLLPIRPIRIRPLCG) was identified from the frog skin of Odorrana grahami. It showed potential wound healing-promoting activity in a murine model with full thickness dermal wound. AH90 promoted release of transforming growth factor β1 through activation of nuclear factor-κB and c-Jun NH2-terminal kinase mitogen-activated protein kinases signaling pathways, while inhibitors of nuclear factor-κB and c-Jun NH2-terminal kinase inhibited the process. In addition, the effects of AH90 on Smads family proteins, key regulators in transforming growth factor β1 signaling pathways, could also be inhibited by transforming growth factor β1 antibody. Altogether, this indicated that AH90 promoted wound healing by inducing the release of transforming growth factor β1. This current study may facilitate the understanding of effective factors involved in the wound repair of amphibians and the underlying mechanisms as well. Considering its favorable traits as a small peptide that greatly promoting generation of endogenous wound healing agents (transforming growth factor β1) without mitogenic effects, AH90 might be an excellent template for the future development of novel wound-healing agents.

  11. A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity.

    Science.gov (United States)

    Wang, Yu-Wei; Tan, Ji-Min; Du, Can-Wei; Luan, Ning; Yan, Xiu-Wen; Lai, Ren; Lu, Qiu-Min

    2015-08-01

    Various bio-active substances in amphibian skins play important roles in survival of the amphibians. Many protease inhibitor peptides have been identified from amphibian skins, which are supposed to negatively modulate the activity of proteases to avoid premature degradation or release of skin peptides, or to inhibit extracellular proteases produced by invading bacteria. However, there is no information on the proteinase inhibitors from the frog Lepidobatrachus laevis which is unique in South America. In this work, a cDNA encoding a novel trypsin inhibitor-like (TIL) cysteine-rich peptide was identified from the skin cDNA library of L. laevis. The 240-bp coding region encodes an 80-amino acid residue precursor protein containing 10 half-cysteines. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 55-amino acid mature peptide with amino acid sequence, IRCPKDKIYKFCGSPCPPSCKDLTPNCIAVCKKGCFCRDGTVDNNHGKCVKKENC. The mature peptide was named LL-TIL. LL-TIL shares significant domain similarity with the peptides from the TIL supper family. Antimicrobial and trypsin-inhibitory abilities of recombinant LL-TIL were tested. Recombinant LL-TIL showed no antimicrobial activity, while it had trypsin-inhibiting activity with a Ki of 16.5178 μM. These results suggested there was TIL peptide with proteinase-inhibiting activity in the skin of frog L. laevis. To the best of our knowledge, this is the first report of TIL peptide from frog skin.

  12. A perchlorate sensitive iodide transporter in frogs.

    Science.gov (United States)

    Carr, Deborah L; Carr, James A; Willis, Ray E; Pressley, Thomas A

    2008-03-01

    Nucleotide sequence comparisons have identified a gene product in the genome database of African clawed frogs (Xenopus laevis) as a probable member of the solute carrier family of membrane transporters. To confirm its identity as a putative iodide transporter, we examined the function of this sequence after heterologous expression in mammalian cells. A green monkey kidney cell line transfected with the Xenopus nucleotide sequence had significantly greater (125)I uptake than sham-transfected control cells. The uptake in carrier-transfected cells was significantly inhibited in the presence of perchlorate, a competitive inhibitor of mammalian Na(+)/iodide symporter. Tissue distributions of the sequence were also consistent with a role in iodide uptake. The mRNA encoding the carrier was found to be expressed in the thyroid gland, stomach, and kidney of tadpoles from X. laevis, as well as the bullfrog Rana catesbeiana. The ovaries of adult X. laevis also were found to express the carrier. Phylogenetic analysis suggested that the putative X. laevis iodide transporter is orthologous to vertebrate Na(+)-dependent iodide symporters. We conclude that the amphibian sequence encodes a protein that is indeed a functional Na(+)/iodide symporter in X. laevis, as well as R. catesbeiana.

  13. Prevalence of Batrachochytrium dendrobatidis in three species of wild frogs on Prince Edward Island, Canada.

    Science.gov (United States)

    Forzán, M J; Vanderstichel, R; Hogan, N S; Teather, K; Wood, J

    2010-09-02

    Chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd), has resulted in the decline or extinction of approximately 200 frog species worldwide. It has been reported throughout much of North America, but its presence on Prince Edward Island (PEI), on the eastern coast of Canada, was unknown. To determine the presence and prevalence of Bd on PEI, skin swabs were collected from 115 frogs from 18 separate sites across the province during the summer of 2009. The swabs were tested through single round end-point PCR for the presence of Bd DNA. Thirty-one frogs were positive, including 25/93 (27%) green frogs Lithobates (Rana) clamitans, 5/20 (25%) northern leopard frogs L. (R.) pipiens, and 1/2 (50%) wood frogs L. sylvaticus (formerly R. sylvatica); 12 of the 18 (67%) sites had at least 1 positive frog. The overall prevalence of Bd infection was estimated at 26.9% (7.2-46.7%, 95% CI). Prevalence amongst green frogs and leopard frogs was similar, but green frogs had a stronger PCR signal when compared to leopard frogs, regardless of age (p frogs, juveniles were more frequently positive than adults (p = 0.001). Green frogs may be the most reliable species to sample when looking for Bd in eastern North America. The 1 wood frog positive for Bd was found dead from chytridiomycosis; none of the other frogs that were positive for Bd by PCR showed any obvious signs of illness. Further monitoring will be required to determine what effect Bd infection has on amphibian population health on PEI.

  14. Sticking under wet conditions: the remarkable attachment abilities of the torrent frog, Staurois guttatus.

    Directory of Open Access Journals (Sweden)

    Thomas Endlein

    Full Text Available Tree frogs climb smooth surfaces utilising capillary forces arising from an air-fluid interface around their toe pads, whereas torrent frogs are able to climb in wet environments near waterfalls where the integrity of the meniscus is at risk. This study compares the adhesive capabilities of a torrent frog to a tree frog, investigating possible adaptations for adhesion under wet conditions. We challenged both frog species to cling to a platform which could be tilted from the horizontal to an upside-down orientation, testing the frogs on different levels of roughness and water flow. On dry, smooth surfaces, both frog species stayed attached to overhanging slopes equally well. In contrast, under both low and high flow rate conditions, the torrent frogs performed significantly better, even adhering under conditions where their toe pads were submerged in water, abolishing the meniscus that underlies capillarity. Using a transparent platform where areas of contact are illuminated, we measured the contact area of frogs during platform rotation under dry conditions. Both frog species not only used the contact area of their pads to adhere, but also large parts of their belly and thigh skin. In the tree frogs, the belly and thighs often detached on steeper slopes, whereas the torrent frogs increased the use of these areas as the slope angle increased. Probing small areas of the different skin parts with a force transducer revealed that forces declined significantly in wet conditions, with only minor differences between the frog species. The superior abilities of the torrent frogs were thus due to the large contact area they used on steep, overhanging surfaces. SEM images revealed slightly elongated cells in the periphery of the toe pads in the torrent frogs, with straightened channels in between them which could facilitate drainage of excess fluid underneath the pad.

  15. Prevalence and intensity of Alaria alata (Goeze, 1792) in water frogs and brown frogs in natural conditions.

    Science.gov (United States)

    Patrelle, Cécile; Portier, Julien; Jouet, Damien; Delorme, Daniel; Ferté, Hubert

    2015-12-01

    In the last 15 years, the mesocercariae of Alaria alata have frequently been reported in the wild boar during routine Trichinella inspections made compulsory for the trade of venison meat in Europe. If these studies have focused primarily on mesocercariae isolated from meat, few works have been done so far to understand the circulation of the parasite in natural conditions especially in the intermediate hosts. This study focuses on the second intermediate hosts of this parasite assessing the suitability of two amphibian groups-brown frogs and water frogs sensu lato-for mesocercarial infection on an area where A. alata has already been identified in water snails and wild boars. During this study, both groups showed to be suitable for mesocercarial infection, with high prevalence and parasite burdens. Prevalence was higher in the brown frog group (56.9 versus 11.54 % for water frogs) which would indicate that it is a preferential group for infection on the study area, though reasons for this remain to be investigated. No significant difference among prevalences was observed between tadpoles and frogs. This study, the first focusing on A. alata in these amphibians in Europe, provides further information on circulation of this parasite in natura.

  16. Altitudinal Variation in Digestive Tract Length in Yunnan Pond Frog (Pelophylax pleuraden)

    Institute of Scientific and Technical Information of China (English)

    Shangling LOU; Yanhong LI; Long JIN; Zhiping MI; Wenchao LIU; Wenbo LIAO

    2013-01-01

    The digestive tract plays an important role in digestion and the acquisition of food energy. Understanding the impact of abiotic environments on digestive tract morphology is especially important for evolution of digestive tract across different environments. Here, we investigated altitudinal variation in digestive tract length in the Yunnan Pond Frog (Pelophylax pleuraden) across ifve populations ranging from 1413 m to 1935 m a.s.l. in Ningnan County, Sichuan province in western China. Frogs were collected during the breeding season, from 1-5 June 2012. Our results revealed that females had longer digestive tract and relative digestive tract (i.e. digestive tract length/body size) lengths in com-parison to males, on average, but the differences between them decreased with increasing altitude. Digestive tract and relative digestive tract lengths increased with increasing altitude suggesting that a higher proportion of indigestible ma-terials may be consumed at high-altitude sites and result in a relative increase in digestive tract dimensions.

  17. Evidence for a Na+/Ca2+ exchange mechanism in frog skin epithelium

    DEFF Research Database (Denmark)

    Madsen, K H; Brodin, Birger; Nielsen, R

    1999-01-01

    In the present study we investigated the possible existence of a Na+/Ca2+ exchange mechanism in the basolateral membrane of the frog skin epithelium and whether such a mechanism plays a role in the regulation of transepithelial Na+ transport. Cytosolic calcium ([Ca2+]i) was measured with the probe...... fura-2 in a set-up in which pieces of tissue were mounted on the stage of an epifluorescence microscope. Na+ transport was measured as the amiloride-sensitive short-circuit current (Isc) using a conventional voltage clamp. Basal [Ca2+]i was 65+/-6 nM (n=15). Removal of Na+ from the mucosal solution had...... in serosal Na+ were followed by stepwise changes in [Ca2+]i. These observations indicate the existence of a Na+/Ca2+ exchange mechanism in the basolateral membrane of the frog skin epithelium. The transepithelial Na+ transport decreased from 13.2+/-1.8 to 9.2+/-1.5 microA cm-2 (n=8, P=0.049) when Na...

  18. Frog: The Fast & Realistic OpenGL Event Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG [1] is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable for any particular physics experiment or detector design. The code is light ($<3~\\textrm{MB}$) and fast (browsing time $\\sim20$ events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OpenGL[2] and GLUT [3] libraries. Moreover, \\textsc{Frog} does not require installation of third party libraries for the visualisation. This documents describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  19. Control of rod shedding in the frog retina.

    Science.gov (United States)

    Basinger, S F; Hollyfield, J G

    1980-01-01

    In all vertebrate species examined thus far, rod outer segment shedding follows a cyclic pattern in which the outer segment tips are shed shortly after the onset of light. Work in the rat retina suggests that rod shedding may follow a circadian rhythm which is controlled by one or more circadian oscillators. Our results in the frog retina are significantly different in that: rod shedding can be driven by the onset of light or other environmental cues; shedding does not persist in constant darkness; shedding is unaffected in frogs with chronic unilateral or bilateral optic nerve section; and shedding will rapidly phase shift to the time of light onset on a wide variety of diurnal cycles. Thus, rod shedding in the frog retina does not appear to be a classical circadian rhythm.

  20. Host Defense Peptides from Asian Frogs as Potential Clinical Therapies

    Directory of Open Access Journals (Sweden)

    Vineeth T.V. Kumar

    2015-03-01

    Full Text Available Host defense peptides (HDPs are currently major focal points of medical research as infectious microbes are gaining resistance to existing drugs. They are effective against multi-drug resistant pathogens due to their unique primary target, biological membranes, and their peculiar mode of action. Even though HDPs from 60 Asian frog species belonging to 15 genera have been characterized, research into these peptides is at a very early stage. The purpose of this review is to showcase the status of peptide research in Asia. Here we provide a summary of HDPs from Asian frogs.

  1. Host Defense Peptides from Asian Frogs as Potential Clinical Therapies

    Science.gov (United States)

    Kumar, Vineeth T.V.; Holthausen, David; Jacob, Joshy; George, Sanil

    2015-01-01

    Host defense peptides (HDPs) are currently major focal points of medical research as infectious microbes are gaining resistance to existing drugs. They are effective against multi-drug resistant pathogens due to their unique primary target, biological membranes, and their peculiar mode of action. Even though HDPs from 60 Asian frog species belonging to 15 genera have been characterized, research into these peptides is at a very early stage. The purpose of this review is to showcase the status of peptide research in Asia. Here we provide a summary of HDPs from Asian frogs. PMID:27025618

  2. Determination of age, longevity and age at reproduction of the frog Microhyla ornata by skeletochronology

    Indian Academy of Sciences (India)

    Suresh M Kumbar; Katti Pancharatna

    2001-06-01

    Skeletochronological estimation of age, longevity, age at sexual maturity and breeding of Microhyla ornata was done. Frogs ( = 62) were collected locally in August (rainy season) 1997 and brought to the laboratory. Body mass and snout-vent-length (SVL) of each frog was recorded; the 4th toe of both the hind limbs was clipped under anaesthesia, fixed in 10% formalin, demineralized in 5% nitric acid and processed for histology. Limb bones (femur, humerus, tibiofibula and radioulna) of 6 large sized frogs were also processed for skeletochronology in order to study the rate of resorption. Gonads of 25 frogs (belonging to different body size ranges) were processed for histology in order to ascertain the gametogenic status of individual frogs. One to four growth rings consisting of growth zones and lines of arrested growth (LAGs) were noticed in frogs of different body sizes; the number of LAGs remained identical in all the limb bones and phalanges in 5 out of 6 frogs. Back calculation indicated that the resorption rate is very low in this frog. Male frogs possessed sperm bundles in seminiferous tubules in the 1st year, while females showed yolky follicles in the ovary in the 2nd year. Frogs found in amplexus were 3–5 years old. The results suggest that this frog may live for a maximum of 5 years in the natural population.

  3. Ant and Mite Diversity Drives Toxin Variation in the Little Devil Poison Frog.

    Science.gov (United States)

    McGugan, Jenna R; Byrd, Gary D; Roland, Alexandre B; Caty, Stephanie N; Kabir, Nisha; Tapia, Elicio E; Trauger, Sunia A; Coloma, Luis A; O'Connell, Lauren A

    2016-06-01

    Poison frogs sequester chemical defenses from arthropod prey, although the details of how arthropod diversity contributes to variation in poison frog toxins remains unclear. We characterized skin alkaloid profiles in the Little Devil poison frog, Oophaga sylvatica (Dendrobatidae), across three populations in northwestern Ecuador. Using gas chromatography/mass spectrometry, we identified histrionicotoxins, 3,5- and 5,8-disubstituted indolizidines, decahydroquinolines, and lehmizidines as the primary alkaloid toxins in these O. sylvatica populations. Frog skin alkaloid composition varied along a geographical gradient following population distribution in a principal component analysis. We also characterized diversity in arthropods isolated from frog stomach contents and confirmed that O. sylvatica specialize on ants and mites. To test the hypothesis that poison frog toxin variability reflects species and chemical diversity in arthropod prey, we (1) used sequencing of cytochrome oxidase 1 to identify individual prey specimens, and (2) used liquid chromatography/mass spectrometry to chemically profile consumed ants and mites. We identified 45 ants and 9 mites in frog stomachs, including several undescribed species. We also showed that chemical profiles of consumed ants and mites cluster by frog population, suggesting different frog populations have access to chemically distinct prey. Finally, by comparing chemical profiles of frog skin and isolated prey items, we traced the arthropod source of four poison frog alkaloids, including 3,5- and 5,8-disubstituted indolizidines and a lehmizidine alkaloid. Together, the data show that toxin variability in O. sylvatica reflects chemical diversity in arthropod prey.

  4. The Maluti Mystery revisited: Taxonomy of African River Frogs (Pyxicephalidae, Amietia) on the Drakensberg Mountains in southern Africa.

    Science.gov (United States)

    Channing, Alan

    2015-02-27

    The taxonomy of two similar frogs from the top of the Drakensberg escarpment, the Maluti River Frog and the Phofung River Frog is not settled. I examine the relevant types and type descriptions, and discover a number of errors in the literature. Some of the recent taxonomic changes were found to be unsupported. The Maluti River Frog is assigned to Amietia vertebralis (Hewitt, 1927), and the Phofung River Frog to Amietia hymenopus (Boulenger, 1920).

  5. A Primary Study on the Recording Method of Interior Decoration in Qing Dynasty – A Case Study of Interior Decoration of Jingfu Palace

    Directory of Open Access Journals (Sweden)

    X. Rong

    2017-08-01

    Full Text Available The existing interior decoration of Qing Dynasty is the master of that of each dynasty, with its diversified forms and complicated functions. As early as 1920s, the Rehabilitation Committee of Qing court recorded the interior furnishing in the Forbidden City by using Chinese traditional documentary method. Today, along with the constantly updated techniques, the recording method for the current situation of interior decoration has gradually developed from two-dimensional drawings into digital and comprehensive record. However, the current research results are mostly limited to a single field. This paper takes the digital record and reproduction about the current situation of interior decoration in Jingfu Palace in the Forbidden City as an example. Through the use of photogrammetry, 3D laser scanning, virtual display and other technology and equipment at the forefront of architectural field, it makes qualitative and quantitative record about the interior decoration inside Jingfu Palace. By combing with the interpretation of historical documents, it restores the original design ideas hidden behind the current situation of interior decoration, so as to summarize the best recording and reproducing method of interior decoration of Qing Dynasty.

  6. Gaetano Moretti y el aporte italiano al Palacio Legislativo de Montevideo / Gaetano Moretti and the Italian contribution to the Legislative Palace of Montevideo

    Directory of Open Access Journals (Sweden)

    Luis Eduardo Tosoni

    2014-12-01

    The project and construction of the Legislative Palace of Montevideo was significantly marked by the participation of Italian professionals. The international bid held in 1904 was awarded to the Piedmontese architect Vittorio Meano who, at the time, was directing the construction of the Colón Theater and the National Congress building in Buenos Aires. Meano’s death determined, on the one hand, a change in the location of the building and, on the other, an enlargement of the original plans by the Uruguayan architects Jacobo Vázquez Varela and Antonio Banchini. In order to satisfy the wish of the then President of Uruguay José Batlle y Ordóñez in terms of monumentalizing the building and facing it with marble, the Palace Committee engaged the services of architect Gaetano Moretti of Lombardy who carried on with the works up until the inauguration of the building in 1925. Moretti not only directed the construction work but also proposed a regulatory plan for the plaza and the surrounding streets.

  7. Effects of elevated CO2 concentration on growth, photosynthetic characteristics and biomass of wheat (Triticum aestivum L.) in Lunar Palace 1

    Science.gov (United States)

    Dong, Chen; Liu, Hui; Liu, Hong; Wang, Minjuan; Fu, Yuming; Shao, Lingzhi; Liu, Guanghui; Yu, Juan

    Short- and long-term effects of elevated CO2 concentration on growth, photosynthetic characteristics and biomass of wheat (Triticum aestivum L.) are examined during 90 days in Lunar Palace 1. While a short-term exposure to elevated CO2 induces a large increase in photosynthesis in wheat plants, long-term growth in elevated CO2 often results in a smaller increase due to reduced photosynthetic capacity. In this study, it was also shown that, net photosynthesis per unit leaf area was raised at an increased CO2 concentration partly due to a decrease in photorespiration, partly due to an increased substrate supply. Transpiration was reduced due to a lower stomatal conductance. The growth response of whole plants to a high CO2 concentration will be the main subject of this paper. Firstly, an estimation is made to what extent a doubling in CO2 concentration affects wheat plant growth in Lunar Palace 1. Secondly, the mechanisms behind this growth stimulation will be assessed. Finally, in those cases where wheat plants are grown over a range of environmental conditions, we select that condition where control plants are growing fastest. Thus, this study may be a matter of interest for researchers in both space and unban agriculture fields.

  8. A Primary Study on the Recording Method of Interior Decoration in Qing Dynasty - A Case Study of Interior Decoration of Jingfu Palace

    Science.gov (United States)

    Rong, X.; He, B.; Zhuang, L.

    2017-08-01

    The existing interior decoration of Qing Dynasty is the master of that of each dynasty, with its diversified forms and complicated functions. As early as 1920s, the Rehabilitation Committee of Qing court recorded the interior furnishing in the Forbidden City by using Chinese traditional documentary method. Today, along with the constantly updated techniques, the recording method for the current situation of interior decoration has gradually developed from two-dimensional drawings into digital and comprehensive record. However, the current research results are mostly limited to a single field. This paper takes the digital record and reproduction about the current situation of interior decoration in Jingfu Palace in the Forbidden City as an example. Through the use of photogrammetry, 3D laser scanning, virtual display and other technology and equipment at the forefront of architectural field, it makes qualitative and quantitative record about the interior decoration inside Jingfu Palace. By combing with the interpretation of historical documents, it restores the original design ideas hidden behind the current situation of interior decoration, so as to summarize the best recording and reproducing method of interior decoration of Qing Dynasty.

  9. Morphometric discrimination of wild from farmed Dybowski's frog (Rana dybowskii) based on hindlimb length

    Institute of Scientific and Technical Information of China (English)

    XIA Rui; HUANG Xiao-ming; YANG Shu-hui; XU Yan-chun; Ying Lu; Thomas D.Dahmer

    2011-01-01

    Commercial farming of anuran species that arc declining in the wild raises a need to discriminate wild from farmed frogs. We hypothesized wild frogs might have extended hindlimbs due to greater frequency or intensity of jumping relative to farmed frogs, highlighting a morphometric approach to discrimination of wild from farmed frogs using hindiimb length. In the present study, Dybowski's frog (Rana dybowskii) was used to test this hypothesis. We measured body mass (Mb)and hindlimb length (Lh) of 2-year old farmed frogs and wild frogs aged 2 to 5 years. Dybowski's frog demonstrated significant dimorphism in Mb and Lh. Mb was significantly greater among farmed 2-year old frogs in both sexes (p=0.000), while only among females w as Lh significantly greater for wild frogs (p=0.000). Lh/Mb was used as an index for origin discrimination to eliminate the influence of Mb due to variation of husbandry conditions among farms. Mean Lh/Mb for fanned frogs was significantly lower than for wild frogs (p=0.000) in the 2-year old age class.Discrimination correctly classified 84.4% of fanned and 96.3% of wild male frogs. Among females, 92.9% of farmed frogs and 90.1% wild frogs were correctly classified. The ovcrall correctness of classification was 92.1% and 90.8% for males and females, respectively. However, Lh/Mb revealed variation with age, resulting in reduced discriminative power for frogs ≥3 years old. We introduced a coefficient Ce to adjust the Lh/Mb of frogs ≥3 years to the level equivalent to 2-year frogs. Thc adjustment achieved 89.5% for overall correctness of origin for wild males and 92.4% for wild females ≥3 years old. These results show that Lh/Mb is an effective index to discriminate wild from fanned Dybowski's frog. Since the physical demands ofjumping are common among anurans, this index is also potentially applicable to other anuran species.

  10. Helminths of the two mountain frogs, banded frog, Rana camerani Boulenger, 1886 and Uludağ frog Rana macrocnemis Boulenger, 1885 (Anura: Ranidae), collected from the Antalya province.

    Science.gov (United States)

    Düşen, Serdar

    2007-01-01

    In this study, two mountain frogs (Rana camerani and Rana macrocnemis) were collected in the Antalya Province in south-western Turkey during 2001 and 2002 and were examined for helminths. Out of 15 Rana camerani, 10 (66.7%) were infected with 1 or more helminths and out of 20 Rana macrocnemis, 17 (85%) were infected with 1 or more helminths. The helminth fauna of Rana camerani included 4 species of which were 3 trematode species (Haplometra cylindracea, Pleurogenoides medians, Opisthioglyphe rastellus), and 1 nematode species (Cosmocerca ornata). The helminth fauna of Rana macrocnemis included 3 species with 1 trematode species (H. cylindracea), 1 nematode species (C. ornata), and 1 acanthocephalan species (Acanthocephalus ranae). H. cylindracea and C. ornata were observed in both of the mountain frogs.

  11. Choosing the safest route: frog orientation in an agricultural landscape

    NARCIS (Netherlands)

    Mazerolle, M.J.; Vos, C.C.

    2006-01-01

    Orientation is a key component to successful movements between habitats. We hypothesized that barren agricultural landscapes hinder the ability of frogs to orient and move between habitats. Specifically, we predicted that when presented with a choice between a short route through a hostile environme

  12. Archaeobatrachian paraphyly and pangaean diversification of crown-group frogs.

    Science.gov (United States)

    Roelants, Kim; Bossuyt, Franky

    2005-02-01

    Current models for the early diversification of living frogs inferred from morphological, ontogenetic, or DNA sequence data invoke very different scenarios of character evolution and biogeography. To explore central controversies on the phylogeny of Anura, we analyzed nearly 4000 base pairs of mitochondrial and nuclear DNA for the major frog lineages. Likelihood-based analyses of this data set are congruent with morphological evidence in supporting a paraphyletic arrangement of archaeobatrachian frogs, with an (Ascaphus + Leiopelma) clade as the sister-group of all other living anurans. The stability of this outcome is reinforced by screening for phylogenetic bias resulting from site-specific rate variation, homoplasy, or the obligatory use of distantly related outgroups. Twenty-one alternative branching and rooting hypotheses were evaluated using a nonparametric multicomparison test and parametric bootstrapping. Relaxed molecular clock estimates situate the emergence of crown-group anurans in the Triassic, approximately 55 million years prior to their first appearance in the fossil record. The existence of at least four extant frog lineages on the supercontinent Pangaea before its breakup gains support from the estimation that three early splits between Laurasia- and Gondwana-associated families coincide with the initial rifting of these landmasses. This observation outlines the potential significance of this breakup event in the formation of separate Mesozoic faunal assemblages in both hemispheres.

  13. How Can We Tell if Frogs Jump Further?

    Science.gov (United States)

    Drummond, Gordon B.; Tom, Brian D. M.

    2011-01-01

    How effective is training frogs to jump? This is perhaps the most frequent question in biology that is subjected to statistical analysis: does a treatment make a difference? One can examine whether there is indeed a training effect, by first assuming the opposite. That is, the authors assume that training has no effect on the mean distance jumped.…

  14. Antimicrobial peptides from the skins of North American frogs.

    Science.gov (United States)

    Conlon, J Michael; Kolodziejek, Jolanta; Nowotny, Norbert

    2009-08-01

    North America is home to anuran species belonging to the families Bufonidae, Eleutherodactylidae, Hylidae, Leiopelmatidae, Ranidae, and Scaphiopodidae but antimicrobial peptides have been identified only in skin secretions and/or skin extracts of frogs belonging to the Leiopelmatidae ("tailed frogs") and Ranidae ("true frogs"). Eight structurally-related cationic alpha-helical peptides with broad-spectrum antibacterial activity, termed ascaphins, have been isolated from specimens of Ascaphus truei (Leiopelmatidae) occupying a coastal range. Characterization of orthologous antimicrobial peptides from Ascaphus specimens occupying an inland range supports the proposal that this population should be regarded as a separate species A. montanus. Ascaphin-8 shows potential for development into a therapeutically valuable anti-infective agent. Peptides belonging to the brevinin-1, esculentin-1, esculentin-2, palustrin-1, palustrin-2, ranacyclin, ranatuerin-1, ranatuerin-2, and temporin families have been isolated from North American ranids. It is proposed that "ranalexins" represent brevinin-1 peptides that have undergone a four amino acid residue internal deletion. Current taxonomic recommendations divide North American frogs from the family Ranidae into two genera: Lithobates and Rana. Cladistic analysis based upon the amino acid sequences of the brevinin-1 peptides provides strong support for this assignment.

  15. Natural disturbance reduces disease risk in endangered rainforest frog populations.

    Science.gov (United States)

    Roznik, Elizabeth A; Sapsford, Sarah J; Pike, David A; Schwarzkopf, Lin; Alford, Ross A

    2015-08-21

    Natural disturbances can drive disease dynamics in animal populations by altering the microclimates experienced by hosts and their pathogens. Many pathogens are highly sensitive to temperature and moisture, and therefore small changes in habitat structure can alter the microclimate in ways that increase or decrease infection prevalence and intensity in host populations. Here we show that a reduction of rainforest canopy cover caused by a severe tropical cyclone decreased the risk of endangered rainforest frogs (Litoria rheocola) becoming infected by a fungal pathogen (Batrachochytrium dendrobatidis). Reductions in canopy cover increased the temperatures and rates of evaporative water loss in frog microhabitats, which reduced B. dendrobatidis infection risk in frogs by an average of 11-28% in cyclone-damaged areas, relative to unaffected areas. Natural disturbances to the rainforest canopy can therefore provide an immediate benefit to frogs by altering the microclimate in ways that reduce infection risk. This could increase host survival and reduce the probability of epidemic disease outbreaks. For amphibian populations under immediate threat from this pathogen, targeted manipulation of canopy cover could increase the availability of warmer, drier microclimates and therefore tip the balance from host extinction to coexistence.

  16. Ranavirus in wild edible frogs Pelophylax kl. esculentus in Denmark

    DEFF Research Database (Denmark)

    Ariel, Ellen; Kielgast, Jos; Svart, Hans Erik

    2009-01-01

    interviewed by phone and 10 cases were examined on suspicion of diseaseinduced mortality. All samples were negative for Bd. Ranavirus was isolated from 2 samples of recently dead frogs collected during a mass mortality event in an artificial pond near Slagelse, Denmark. The identity of the virus was confirmed...

  17. Choosing the safest route: frog orientation in an agricultural landscape

    NARCIS (Netherlands)

    Mazerolle, M.J.; Vos, C.C.

    2006-01-01

    Orientation is a key component to successful movements between habitats. We hypothesized that barren agricultural landscapes hinder the ability of frogs to orient and move between habitats. Specifically, we predicted that when presented with a choice between a short route through a hostile environme

  18. BIFURCATION ANALYSIS OF A MITOTIC MODEL OF FROG EGGS

    Institute of Scientific and Technical Information of China (English)

    吕金虎; 张子范; 张锁春

    2003-01-01

    The mitotic model of frog eggs established by Borisuk and Tyson is qualitatively analyzed. The existence and stability of its steady states are further discussed. Furthermore, the bifurcation of above model is further investigated by using theoretical analysis and numerical simulations. At the same time, the numerical results of Tyson are verified by theoretical analysis.

  19. Pesticides and Population Declines of California Alpine Frogs

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured ...

  20. How Can We Tell if Frogs Jump Further?

    Science.gov (United States)

    Drummond, Gordon B.; Tom, Brian D. M.

    2011-01-01

    How effective is training frogs to jump? This is perhaps the most frequent question in biology that is subjected to statistical analysis: does a treatment make a difference? One can examine whether there is indeed a training effect, by first assuming the opposite. That is, the authors assume that training has no effect on the mean distance jumped.…

  1. Evidence of auditory insensitivity to vocalization frequencies in two frogs

    DEFF Research Database (Denmark)

    Goutte, Sandra; Mason, Matthew J; Christensen-Dalsgaard, Jakob

    2017-01-01

    The emergence and maintenance of animal communication systems requires the co-evolution of signal and receiver. Frogs and toads rely heavily on acoustic communication for coordinating reproduction and typically have ears tuned to the dominant frequency of their vocalizations, allowing discriminat...

  2. Role of cutaneous surface fluid in frog osmoregulation

    DEFF Research Database (Denmark)

    Larsen, Erik Hviid; Ramløv, Hans

    2013-01-01

    The study investigated whether evaporative water loss (EWL) in frogs stems from water diffusing through the skin or fluid secreted by mucous glands. Osmolality of cutaneous surface fluid (CSF) of Rana esculenta (Pelophylax kl. esculentus) subjected to isoproterenol or 30 °C–34 °C was 191 ± 9...

  3. AIRBORNE PESTICIDES AND POPULATION DECLINES OF A CALIFORNIA ALPINE FROG

    Science.gov (United States)

    The mountain yellow-legged frog (Rana muscosa) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distribution and temporal variation of ...

  4. Pesticides and Population Declines of California Alpine Frogs

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured ...

  5. Biophysics of directional hearing in the frog Eleutherodactylus coqui

    DEFF Research Database (Denmark)

    Jørgensen, Morten Buhl; Schmitz, Barbara; Christensen-Dalsgaard, Jakob

    1991-01-01

    ) or closed (GC response) during the measurement. 3. The lateral body wall vibrated with a maximum amplitude close to that of the eardrum and in the same frequency range. 4. Covering the frog's body wall with vaseline reduced the vibration amplitude of the GC response by up to 15 dB. 5. When a closed sound...

  6. A suspected parasite spill-back of two novel Myxidium spp. (Myxosporea causing disease in Australian endemic frogs found in the invasive Cane toad.

    Directory of Open Access Journals (Sweden)

    Ashlie Hartigan

    Full Text Available Infectious diseases are contributing to the decline of endangered amphibians. We identified myxosporean parasites, Myxidium spp. (Myxosporea: Myxozoa, in the brain and liver of declining native frogs, the Green and Golden Bell frog (Litoria aurea and the Southern Bell frog (Litoria raniformis. We unequivocally identified two Myxidium spp. (both generalist affecting Australian native frogs and the invasive Cane toad (Bufo marinus, syn. Rhinella marina and demonstrated their association with disease. Our study tested the identity of Myxidium spp. within native frogs and the invasive Cane toad (brought to Australia in 1935, via Hawaii to resolve the question whether the Cane toad introduced them to Australia. We showed that the Australian brain and liver Myxidium spp. differed 9%, 7%, 34% and 37% at the small subunit rDNA, large subunit rDNA, internal transcribed spacers 1 and 2, but were distinct from Myxidium cf. immersum from Cane toads in Brazil. Plotting minimum within-group distance against maximum intra-group distance confirmed their independent evolutionary trajectory. Transmission electron microscopy revealed that the brain stages localize inside axons. Myxospores were morphologically indistinguishable, therefore genetic characterisation was necessary to recognise these cryptic species. It is unlikely that the Cane toad brought the myxosporean parasites to Australia, because the parasites were not found in 261 Hawaiian Cane toads. Instead, these data support the enemy-release hypothesis predicting that not all parasites are translocated with their hosts and suggest that the Cane toad may have played an important spill-back role in their emergence and facilitated their dissemination. This work emphasizes the importance of accurate species identification of pathogens relevant to wildlife management and disease control. In our case it is paving the road for the spill-back role of the Cane toad and the parasite emergence.

  7. Los conjuntos palaciegos reales de las Tierras Bajas Mayas del sur: una evaluación de los datos arqueológicos e iconográficos Royal palace complexes in Southern Maya Lowlands: evaluating archaeological and iconographical data

    Directory of Open Access Journals (Sweden)

    Kai Delvendahl

    2010-01-01

    Full Text Available Este artículo va a trazar algunas conclusiones de una evaluación de los aspectos físicos, espaciales, funcionales y sociales de los conjuntos palaciegos reales tomando en cuenta evidencia arqueológica e iconográfica. Para el componente iconográfico se analizaron representaciones de escenas palaciegas pintadas sobre 87 vasijas cilíndricas de cerámica, mientras que para el componente arqueológico se evaluó información de conjuntos palaciegos bien documentados como el Grupo Palaciego M7 de Aguateca, el Palacio de Palenque, Los 27 Escalones de Kohunlich, el Grupo 10L-2 de Copán, la Acrópolis Central de Tikal y el Grupo Gran Acrópolis de Calakmul. Uno de los objetivos generales de este trabajo es proporcionar un ejemplo de cómo se puede capitalizar la información que las escenas palaciegas proveen (al comparar el corpus iconográfico con el dato arqueológico. Esto permitiría plantear ideas más ajustadas sobre los aspectos físicos, espaciales, funcionales y sociales de los conjuntos palaciegos del Clásico Tardío en el área maya.This paper will present some conclusions of an evaluation of the physical, spatial, functional, and social aspects of Classic Maya royal palaces taking into account archaeological and iconographic evidence. For the iconographic evaluation, the analysis examined representations of palace-like ambience on 87 cylindrical ceramic vases, while the archaeological information includes data from the better documented palace groups of the Southern Maya Lowlands, including the Palace Group M7 of Aguateca, the Palace of Palenque, Los 27 Escalones of Kohunlich, Group 10L-2 of Copan, the Central Acropolis of Tikal and the Grand Acropolis Group of Calakmul. In comparing the iconographic corpus with the archaeological evidence, one of the general objectives of this presentation is to provide an example of how the information inherent in the palace scenes can be capitalized to propose more adjusted ideas about the

  8. Children's Empowerment in Play

    Science.gov (United States)

    Canning, Natalie

    2007-01-01

    This article examines the level of empowerment and autonomy children can create in their play experiences. It examines the play discourses that children build and maintain and considers the importance of play contexts in supporting children's emotional and social development. These aspects of play are often unseen or misunderstood by the adult…

  9. The Play of Psychotherapy

    Science.gov (United States)

    Marks-Tarlow, Terry

    2012-01-01

    The author reviews the role of play within psychotherapy. She does not discuss the formal play therapy especially popular for young children, nor play from the Jungian perspective that encourages the use of the sand tray with adults. Instead, she focuses on the informal use of play during psychotherapy as it is orchestrated intuitively. Because…

  10. Two people playing together: some thoughts on play, playing, and playfulness in psychoanalytic work.

    Science.gov (United States)

    Vliegen, Nicole

    2009-01-01

    Children's play and the playfulness of adolescents and adults are important indicators of personal growth and development. When a child is not able to play, or an adolescent/adult is not able to be playful with thoughts and ideas, psychotherapy can help to find a more playful and creative stance. Elaborating Winnicott's (1968, p. 591) statement that "psychotherapy has to do with two people playing together," three perspectives on play in psychotherapy are discussed. In the first point of view, the child gets in touch with and can work through aspects of his or her inner world, while playing in the presence of the therapist. The power of play is then rooted in the playful communication with the self In a second perspective, in play the child is communicating aspects of his or her inner world to the therapist as a significant other. In a third view, in "playing together" child and therapist are coconstructing new meanings. These three perspectives on play are valid at different moments of a therapy process or for different children, depending on the complex vicissitudes of the child's constitution, life experiences, development, and psychic structure. Concerning these three perspectives, a parallel can be drawn between the therapist's attitude toward the child's play and the way the therapist responds to the verbal play of an adolescent or adult. We illustrate this with the case of Jacob, a late adolescent hardly able to play with ideas.

  11. Applying Play to Therapy.

    Science.gov (United States)

    Ritter, Patricia S.; Fokes, Joann

    The objectives of this paper are (1) to present the relationship of play to language and cognition, (2) to describe the stages of play and discuss recent literature about the characteristics of play, and (3) to describe the use of play with the multifaceted goals of cognition, pragmatics, semantics, syntax, and morphology as an intervention…

  12. Fundamental Experiment to Determine Escape Countermeasures for Frogs Falling into Agricultural Canals

    Science.gov (United States)

    Watabe, Keiji; Mori, Atsushi; Koizumi, Noriyuki; Takemura, Takeshi

    Frogs often drown in agricultural canals with deep concrete walls, which are installed commonly in paddy fields after land improvement projects in Japan, because they cannot escape after falling into the canal. Therefore, countermeasures that enable frogs to escape from canals are required in some rural areas. An experimental canal with partially sloped walls was used as an escape countermeasure to investigate the preferable angle of slope for the walls, water depth and flow velocity that enables Tokyo Daruma Pond Frogs (Rana porosa porosa), which have no adhesive discs, to easily escape. Walls with slopes of 30-45 degrees allowed 50-60% of frogs to escape from the experimental canals, frogs especially easily climbed the 30 degree sloped walls. When the water depth was 5 cm or flow velocity was greater than 20 cm/s, approximately 80% of the frogs moved downstream and reached the sloped walls because the frogs' toes did not reach the bottom of the canal. However, if the depth was 2 cm and the flow velocity was 5 cm/s, only 4% of the frogs climbed the sloped walls because they could move freely. The frogs appeared to not be good at long-distance swimming and could not remain a long-time under running water. Therefore, walls sloped less than 30 degrees and control of both water depth and flow velocity appears important for enabling frogs to easily escape from canals.

  13. Building a crystal palace

    CERN Multimedia

    2007-01-01

    The end-caps of the CMS electromagnetic calorimeter (ECAL) take shape as the first quadrant was completed on Wednesday 3 October. 1831 crystals, organised into five by five blocks named ‘supercrystals’, make up the first quadrant of Dee 1.With the 61,200-crystal barrel of its electromagnetic calorimeter (ECAL) complete, CMS is now building the endcaps, on the tenth anniversary of their initial design. Crystals for the endcaps were the last to be made, so the race is now on to have them all in place and ready for the turn-on of the LHC next year. Assembly of the first of eight quadrants began in June and crystal mounting was completed on Wednesday 3 October. Each crystal is transparent, has a volume just larger than a CERN coffee cup yet weighs a huge 1.5kg. 1831 of these lead tungstate crystals went into the first quadrant from a total 14,648 in the endcaps. The lead and tungsten account for 86% of each crystal’s weight, but as project leader Dave Cockerill expl...

  14. Palaces in Heaven

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    China plans to launch its own space stations on February 27, audience of China Central Television was treated to a glimpse of their country’s next space-age leap with a preview of the notyet-complete Tiangong I space station. China’s first space station is expected to be launched in late 2010.

  15. COMPARATIVE TOXICITY OF DIURON ON SURVIVAL AND GROWTH OF PACIFIC TREEFROG, BULLFROG, RED-LEGGED FROG, AND AFRICAN CLAWED FROG EMBRYOS AND TADPOLES

    Science.gov (United States)

    The effects of the herbicide diuron on survival and growth of Pacific treefrog (Pseudacris regilla),bullfrog(Rana catesbeiana), red-legged frog(Rana aurora),and African clawed frog(Xenopus laevis)embryos and tadpoles were determined in static-renewal tests. P.regilla and X.laevis...

  16. The play grid

    DEFF Research Database (Denmark)

    Fogh, Rune; Johansen, Asger

    2013-01-01

    In this paper we propose The Play Grid, a model for systemizing different play types. The approach is psychological by nature and the actual Play Grid is based, therefore, on two pairs of fundamental and widely acknowledged distinguishing characteristics of the ego, namely: extraversion vs...... at the Play Grid. Thus, the model has four quadrants, each of them describing one of four play types: the Assembler, the Director, the Explorer, and the Improviser. It is our hope that the Play Grid can be a useful design tool for making entertainment products for children....

  17. Glycation of wood frog (Rana sylvatica) hemoglobin and blood proteins: in vivo and in vitro studies

    Science.gov (United States)

    MacDonald, Justin A.; Degenhardt, Thorsten; Baynes, John W.; Storey, Kenneth B.

    2010-01-01

    The effects of in vivo freezing and glucose cryoprotectant on protein glycation were investigated in the wood frog, Rana sylvatica. Our studies revealed no difference in the fructoselysine content of blood plasma sampled from control, 27 h frozen and 18 h thawed wood frogs. Glycated hemoglobin (GHb) decreased slightly with 48 h freezing exposure and was below control levels after 7 d recovery, while glycated serum albumin was unchanged by 48 h freezing but did increase after 7 d of recovery. In vitro exposure of blood lysates to glucose revealed that the GHb production in wood frogs was similar to that of the rat but was lower than in leopard frogs. We conclude that wood frog hemoglobin was glycated in vitro; however, GHb production was not apparent during freezing and recovery when in vivo glucose is highly elevated. It is possible that wood frog blood proteins have different in vivo susceptibilities to glycation. PMID:19540217

  18. Assessment of radiocesium contamination in frogs 18 months after the Fukushima Daiichi nuclear disaster

    Science.gov (United States)

    Matsushima, Noe; Ihara, Sadao; Takase, Minoru; Horiguchi, Toshihiro

    2015-04-01

    We investigated the accumulation of radionuclides in frogs inhabiting radioactively contaminated areas around Fukushima Daiichi Nuclear Power Plant (FDNPP) to search for possible adverse effects due to radionuclides. We collected 5 frog species and soil samples in areas within and outside a 20-km radius from FDNPP in August and September 2012 and determined their radiocesium concentrations (134Cs and 137Cs). There was a positive correlation between radiocesium concentrations in the soil samples and frogs, and the highest concentration in frogs was 47,278.53 Bq/kg-wet. Although we conducted a histological examination of frog ovaries and testes by light microscopy to detect possible effects of radionuclides on the morphology of germ cells, there were no clear abnormalities in the gonadal tissues of frogs collected from sites with different contamination levels.

  19. Adaptive response in frogs chronically exposed to low doses of ionizing radiation in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Audette-Stuart, M., E-mail: stuartm@aecl.ca [Environmental Technologies Branch, Atomic Energy of Canada Limited, Chalk River Laboratories, Chalk River, Ontario, K0J 1P0 (Canada); Kim, S.B.; McMullin, D.; Festarini, A.; Yankovich, T.L.; Carr, J.; Mulpuru, S. [Environmental Technologies Branch, Atomic Energy of Canada Limited, Chalk River Laboratories, Chalk River, Ontario, K0J 1P0 (Canada)

    2011-06-15

    Using the micronucleus assay, decreased levels of DNA damage were found after high dose ionizing radiation exposure of liver cells taken from frogs inhabiting a natural environment with above-background levels of ionizing radiation, compared to cells taken from frogs inhabiting background areas. The data obtained from a small number of animals suggest that stress present in the above-background environment could induce an adaptive response to ionizing radiation. This study did not reveal harmful effects of exposure to low levels of radioactivity. On the contrary, stress present in the above-background area may serve to enhance cellular defense mechanisms. - Highlights: > Frogs were collected from background and higher tritium level habitats. > The micronucleus assay was conducted on liver cells obtained from the frogs. > No detrimental effects were noted in frogs exposed to elevated tritium. > Adaptive responses were observed in frogs exposed to elevated tritium.

  20. Pathogenicity of Aeromonas hydrophila, Klebsiella pneumoniae, and Proteus mirabilis to brown tree frogs (Litoria ewingii).

    Science.gov (United States)

    Schadich, Ermin; Cole, Anthony L J

    2010-04-01

    Bacterial dermatosepticemia, a systemic infectious bacterial disease of frogs, can be caused by several opportunistic gram-negative bacterial species including Aeromonas hydrophila, Chryseobacterium indologenes, Chryseobacterium meningosepticum, Citrobacter freundii, Klebsiella pneumoniae, Proteus mirabilis, Pseudomonas aeruginosa, and Serratia liquifaciens. Here we determined the pathogenicity of 3 bacterial species (Aeromonas hydrophila, Klebsiella pneumoniae, and Proteus mirabilis) associated with an outbreak of fatal dermatosepticemia in New Zealand Litoria ewingii frogs. A bath challenge method was used to expose test frogs to individual bacterial species (2 x 10(7) cfu/mL in pond water); control frogs were exposed to uninfected pond water. None of the control frogs or those exposed to A. hydrophila or P. mirabilis showed any morbidity or mortality. Morbidity and mortality was 40% among frogs exposed to K. pneumonia, and the organism was reisolated from the hearts, spleens, and livers of affected animals.

  1. Glycation of wood frog (Rana sylvatica) hemoglobin and blood proteins: in vivo and in vitro studies.

    Science.gov (United States)

    MacDonald, Justin A; Degenhardt, Thorsten; Baynes, John W; Storey, Kenneth B

    2009-10-01

    The effects of in vivo freezing and glucose cryoprotectant on protein glycation were investigated in the wood frog, Rana sylvatica. Our studies revealed no difference in the fructoselysine content of blood plasma sampled from control, 27 h frozen and 18 h thawed wood frogs. Glycated hemoglobin (GHb) decreased slightly with 48 h freezing exposure and was below control levels after 7d recovery, while glycated serum albumin was unchanged by 48 h freezing but did increase after 7d of recovery. In vitro exposure of blood lysates to glucose revealed that the GHb production in wood frogs was similar to that of the rat but was lower than in leopard frogs. We conclude that wood frog hemoglobin was glycated in vitro; however, GHb production was not apparent during freezing and recovery when in vivo glucose is highly elevated. It is possible that wood frog blood proteins have different in vivo susceptibilities to glycation.

  2. The José de Figueiredo Institute role on the recovery of paintings from the Gulbenkian collection after the 1967 flood at the Pombal Palace, in Oeiras

    Directory of Open Access Journals (Sweden)

    Mercês Lorena

    2017-01-01

    Full Text Available Before the opening of the Calouste Gulbenkian Museum in 1969, much of the Gulbenkian collection was displayed and stored at the Pombal Palace, in Oeiras. The 1967 flood was one of the greatest calamities that hit this collection. Of the 70 paintings that were kept in the safety deposit, and which were damaged by water and mud, two-thirds required special care, including two paintings that were considered irrecoverable: Virgin with the child and Donors, by Vittore Carpaccio, and the Island of S. Pietro di Castello, by Francesco Guardi. The José de Figueiredo Institute immediately began the salvage intervention that certain paintings required, using techniques and products internationally recognized and proven by the long years of their experience. An individual file process was prepared for each work, including a photographic and radiographic documentation plus a detailed description of the intervention procedure.

  3. Role-Playing Mitosis.

    Science.gov (United States)

    Wyn, Mark A.; Stegink, Steven J.

    2000-01-01

    Introduces a role playing activity that actively engages students in the learning process of mitosis. Students play either chromosomes carrying information, or cells in the cell membrane. (Contains 11 references.) (Author/YDS)

  4. Play the Tuberculosis Game

    Science.gov (United States)

    ... Questionnaire Tuberculosis Play Tuberculosis Experiments & Discoveries About the game Discover and experience some of the classic methods ... last will in Paris. Play the Blood Typing Game Try to save some patients and learn about ...

  5. Play the MRI Game

    Science.gov (United States)

    ... Teachers' Questionnaire MRI Play MRI the Magnetic Miracle Game About the game In the MRI imaging technique, strong magnets and ... last will in Paris. Play the Blood Typing Game Try to save some patients and learn about ...

  6. Play the Electrocardiogram Game

    Science.gov (United States)

    ... and Work Teachers' Questionnaire Electrocardiogram Play the ECG Game About the game ECG is used for diagnosing heart conditions by ... last will in Paris. Play the Blood Typing Game Try to save some patients and learn about ...

  7. Learning Through Play

    Science.gov (United States)

    ... play, such as using play dough, LEGOs, and board games. Toys such as puzzles, pegboards, beads, and lacing ... Building sets, books, bicycles, roller skates, ice skates, board games, checkers, beginning sports • Middle Schoolers and Adolescents: Athletics, ...

  8. Children, Time, and Play

    DEFF Research Database (Denmark)

    Elkind, David; Rinaldi, Carla; Flemmert Jensen, Anne;

    Proceedings from the conference "Children, Time, and Play". Danish University of Education, January 30th 2003.......Proceedings from the conference "Children, Time, and Play". Danish University of Education, January 30th 2003....

  9. Role-Playing Mitosis.

    Science.gov (United States)

    Wyn, Mark A.; Stegink, Steven J.

    2000-01-01

    Introduces a role playing activity that actively engages students in the learning process of mitosis. Students play either chromosomes carrying information, or cells in the cell membrane. (Contains 11 references.) (Author/YDS)

  10. Play at Work

    DEFF Research Database (Denmark)

    Meier Sørensen, Bent; Spoelstra, Sverre

    2012-01-01

    for business and the other insists that work and play are largely indistinguishable in the postindustrial organization. Our field study of a design and communications company in Denmark shows that organizational play can be much more than just functional to the organization. We identify three ways in which......The interest in organizational play is growing, both in popular business discourse and organization studies. As the presumption that play is dysfunctional for organizations is increasingly discarded, the existing positions may be divided into two camps; one proposes ‘serious play’ as an engine...... workplaces engage in play: play as a (serious) continuation of work, play as a (critical) intervention into work and play as an (uninvited) usurpation of work....

  11. «Lope de Vega’s La hermosa Ester», a Tentative Reconstruction of Space in the Play

    Directory of Open Access Journals (Sweden)

    Marc Vitse

    2017-05-01

    Full Text Available This article aims to describe and characterize space in Lope de Vega’s biblical play La hermosa Ester (1610. With the exception of two comic interludes found respectively in cuadros E and H and set in a hamlet near to the Persian capital, the remaining 11 cuadros are set in the city of Susa. The city is represented by a palace with a garden, a throne room and the king’s chambers as well as an urban space (Jewish quarter, the favorite minister’s residence, and streets, both of which are linked by a square that is situated in front of the palace, a square that is of prime importance in the dramatic action. In contrast to Danielle Crivellari’s recent study on space in the work, this new proposed reconstruction, fashioned according to implicit stage directions, brings to light the dubious fragility of spacial elements when considering the play’s system of segmentation, that can find firmer bases in the metrics

  12. Playing with social identities

    DEFF Research Database (Denmark)

    Winther-Lindqvist, Ditte Alexandra

    2013-01-01

    This chapter offers support for Vygotsky’s claim that all play involves both an imagined situation as well as rules. Synthesising Schousboe’s comprehensive model of spheres of realities in playing (see Chapter 1, this volume) with Lev Vygotskys insight that all playing involve rules as well...

  13. Toddlers: Learning by Playing

    Science.gov (United States)

    ... Feeding Your 1- to 2-Year-Old Toddlers: Learning by Playing KidsHealth > For Parents > Toddlers: Learning by Playing Print A A A What's in ... child's play, but toddlers are hard at work learning important physical skills as they gain muscle control, ...

  14. Playing against the Game

    Science.gov (United States)

    Remmele, Bernd

    2017-01-01

    The paper first outlines a differentiation of play/game-motivations that include "negative" attitudes against the play/game itself like cheating or spoilsporting. This problem is of particular importance in concern of learning games because they are not "played" for themselves--at least in the first place--but due to an…

  15. Play the Mosquito Game

    Science.gov (United States)

    ... and Work Teachers' Questionnaire Malaria Play the Mosquito Game Play the Parasite Game About the games Malaria is one of the world's most common ... last will in Paris. Play the Blood Typing Game Try to save some patients and learn about ...

  16. (Steering) interactive play behavior

    NARCIS (Netherlands)

    Delden, van Robertus Wilhelmus

    2017-01-01

    Play is a powerful means to have an impact on the cognitive, social-emotional, and/or motor skills development. The introduction of technology brings new possibilities to provide engaging and entertaining whole-body play activities. Technology mediates the play activities and in this way changes how

  17. (Steering) interactive play behavior

    NARCIS (Netherlands)

    van Delden, Robertus Wilhelmus

    2017-01-01

    Play is a powerful means to have an impact on the cognitive, social-emotional, and/or motor skills development. The introduction of technology brings new possibilities to provide engaging and entertaining whole-body play activities. Technology mediates the play activities and in this way changes how

  18. Itraconazole treatment reduces Batrachochytrium dendrobatidis prevalence and increases overwinter field survival in juvenile Cascades frogs.

    Science.gov (United States)

    Hardy, Bennett M; Pope, Karen L; Piovia-Scott, Jonah; Brown, Richard N; Foley, Janet E

    2015-01-15

    The global spread of the fungal pathogen Batrachochytrium dendrobatidis (Bd) has led to widespread extirpation of amphibian populations. During an intervention aimed at stabilizing at-risk populations, we treated wild-caught Cascades frogs Rana cascadae with the antifungal drug itraconazole. In fall 2012, we collected 60 recently metamorphosed R. cascadae from 1 of the 11 remnant populations in the Cascades Mountains (CA, USA). Of these, 30 randomly selected frogs were treated with itraconazole and the other 30 frogs served as experimental controls; all were released at the capture site. Bd prevalence was low at the time of treatment and did not differ between treated frogs and controls immediately following treatment. Following release, Bd prevalence gradually increased in controls but not in treated frogs, with noticeable (but still non-significant) differences 3 wk after treatment (27% [4/15] vs. 0% [0/13]) and strong differences 5 wk after treatment (67% [8/12] vs. 13% [1/8]). We did not detect any differences in Bd prevalence and load between experimental controls and untreated wild frogs during this time period. In spring 2013, we recaptured 7 treated frogs but none of the experimental control frogs, suggesting that over-winter survival was higher for treated frogs. The itraconazole treatment did appear to reduce growth rates: treated frogs weighed 22% less than control frogs 3 wk after treatment (0.7 vs. 0.9 g) and were 9% shorter than control frogs 5 wk after treatment (18.4 vs. 20.2 mm). However, for critically small populations, increased survival of the most at-risk life stage could prevent or delay extinction. Our results show that itraconazole treatment can be effective against Bd infection in wild amphibians, and therefore the beneficial effects on survivorship may outweigh the detrimental effects on growth.

  19. Epidermal Laser Stimulation of Action Potentials in the Frog Sciatic Nerve

    Science.gov (United States)

    2008-10-01

    Laser Stimulation of Action Potentials in the Frog Sciatic Nerve Nichole M. Jindra Robert J. Thomas Human Effectiveness Directorate Directed...in the Frog Sciatic Nerve 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62202F 6. AUTHOR(S) .Nichole M. Jindra, Robert J. Thomas, Douglas N...Alan Rice 14. ABSTRACT Measurements of laser stimulated action potentials in the sciatic nerve of leopard frogs (Rana pipiens) were made using

  20. Use of multimedia technology to provide solutions to existing curriculum problems: Virtual frog dissection

    Science.gov (United States)

    Youngblut, Christine

    The objective of this research was to determine whether currently available multimedia technology can resolve existing problems in the K--12 science curriculum. There are several practical and ethical problems relating to the classroom use of animal dissection and this led to the selection of hands-on frog dissection as the curriculum activity where the use of multimedia was investigated. The major finding was that multimedia-based virtual dissection was more effective than hands-on dissection in helping students learn about frog anatomy. Moreover, this result was achieved when the time available for the virtual dissection was approximately 44% less than that available for hands-on dissection. Examination of possible relationships between student characteristics and achievement revealed that students' attitudes to educational uses of animal dissection and their computer experience were positively correlated with their achievement scores. No relationships were found between either student gender or dissection experience and achievement test outcomes. Students rated virtual dissection as the easier of the two types of dissection, though they gave equivalent ratings for their enjoyment of virtual and hands-on dissection. Despite favorable feedback on the virtual dissection, a significant majority of students stated that they felt they would be "missing-out" on a valuable experience if they were not given the opportunity to perform a hands-on frog dissection. Comparing how students spent their time during each type of dissection showed that students spent a significantly larger proportion of their time On-Task when using the multimedia-based virtual dissection. In particular, the average increase in the proportion of time spent on activities directly related to the subject matter was over 36%. Time spent On-Task had a significant positive relationship with achievement for hands-on dissection. It may play a similar role for achievement with virtual dissection, but the

  1. Emerging myxosporean parasites of Australian frogs take a ride with fresh fruit transport

    National Research Council Canada - National Science Library

    Hartigan, Ashlie; Peacock, Lee; Rosenwax, Alex; Phalen, David N; Slapeta, Jan

    2012-01-01

    .... Cystodiscus australis and Cystodiscus axonis are two species of myxosporean parasites infecting Australian frogs and tadpoles that have been recently recognised as important disease agents impacting...

  2. THE DISTRIBUTION OF ICE IN FROZEN TISSUES OF FROGS AND MICE,

    Science.gov (United States)

    and digit free of ice at all temperatures are the stratum corneum in both the frog and the mouse, the stratum compactum in the frog and the fibrous...sheath of the mouse tendon. (4) The epidermis is almost entirely free of ice in frog skin at -1C and in mouse skin at -2C. (5) When ice is formed, the...horizontal connective tissue of the dermis. (6) Ice is present in the tendon of the frog at -5C and -3C, and in that of the mouse at -5C. With excised

  3. Abundance of Green Tree Frogs and Insects in Artificial Canopy Gaps in a Bottomland Hardwood Forest.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.; Ulyshen, Michael D.; Kilgo, John, C.

    2005-04-01

    ABSTRACT - We found more green tree frogs ( Hyla cinerea) n canopv gaps than in closed canopy forest. Of the 331 green tree frogs observed, 88% were in canopv gaps. Likewise, higher numbers and biomasses of insects were captured in the open gap habitat Flies were the most commonlv collected insect group accounting for 54% of the total capture. These data suggest that one reason green tree frogs were more abundant in canopy gaps was the increased availability of prey and that small canopy gaps provide early successional habitats that are beneficial to green tree frog populations.

  4. Playing with social identities

    DEFF Research Database (Denmark)

    Winther-Lindqvist, Ditte Alexandra

    2013-01-01

    This chapter offers support for Vygotsky’s claim that all play involves both an imagined situation as well as rules. Synthesising Schousboe’s comprehensive model of spheres of realities in playing (see Chapter 1, this volume) with Lev Vygotskys insight that all playing involve rules as well...... as pretence, children’s play is understood as an activity involving rules of the social order (roles and positions) as well as identification processes (imagined situations). The theoretical argumentation builds on empirical examples obtained in two different Danish day-care centres. The chapter is informed...... by ethnographic observations and draws on illustrative examples with symbolic group play as well as game-play with rules (soccer) among 5 year old boys. Findings suggest that day-care children’s play, involves negotiation of roles, positioning and identification, and rules – and that these negotiations...

  5. Characterization of the Skin Microbiota in Italian Stream Frogs (Rana italica) Infected and Uninfected by a Cutaneous Parasitic Disease.

    Science.gov (United States)

    Federici, Ermanno; Rossi, Roberta; Fidati, Laura; Paracucchi, Romina; Scargetta, Silvia; Montalbani, Elena; Franzetti, Andrea; La Porta, Gianandrea; Fagotti, Anna; Simonceli, Francesca; Cenci, Giovanni; Di Rosa, Ines

    2015-01-01

    In human and wildlife populations, the natural microbiota plays an important role in health maintenance and the prevention of emerging infectious diseases. In amphibians, infectious diseases have been closely associated with population decline and extinction worldwide. Skin symbiont communities have been suggested as one of the factors driving the different susceptibilities of amphibians to diseases. The activity of the skin microbiota of amphibians against fungal pathogens, such as Batrachochytrium dendrobatidis, has been examined extensively, whereas its protective role towards the cutaneous infectious diseases caused by Amphibiocystidium parasites has not yet been elucidated in detail. In the present study, we investigated, for the first time, the cutaneous microbiota of the Italian stream frog (Rana italica) and characterized the microbial assemblages of frogs uninfected and infected by Amphibiocystidium using the Illumina next-generation sequencing of 16S rRNA gene fragments. A total of 629 different OTUs belonging to 16 different phyla were detected. Bacterial populations shared by all individuals represented only one fifth of all OTUs and were dominated by a small number of OTUs. Statistical analyses based on Bray-Curtis distances showed that uninfected and infected specimens had distinct cutaneous bacterial community structures. Phylotypes belonging to the genera Janthinobacterium, Pseudomonas, and Flavobacterium were more abundant, and sometimes almost exclusively present, in uninfected than in infected specimens. These bacterial populations, known to exhibit antifungal activity in amphibians, may also play a role in protection against cutaneous infectious diseases caused by Amphibiocystidium parasites.

  6. The Genome of the Western Clawed Frog Xenopus tropicalis

    Energy Technology Data Exchange (ETDEWEB)

    Hellsten, Uffe; Harland, Richard M.; Gilchrist, Michael J.; Hendrix, David; Jurka, Jerzy; Kapitonov, Vladimir; Ovcharenko, Ivan; Putnam, Nicholas H.; Shu, Shengqiang; Taher, Leila; Blitz, Ira L.; Blumberg, Bruce; Dichmann, Darwin S.; Dubchak, Inna; Amaya, Enrique; Detter, John C.; Fletcher, Russell; Gerhard, Daniela S.; Goodstein, David; Graves, Tina; Grigoriev, Igor V.; Grimwood, Jane; Kawashima, Takeshi; Lindquist, Erika; Lucas, Susan M.; Mead, Paul E.; Mitros, Therese; Ogino, Hajime; Ohta, Yuko; Poliakov, Alexander V.; Pollet, Nicolas; Robert, Jacques; Salamov, Asaf; Sater, Amy K.; Schmutz, Jeremy; Terry, Astrid; Vize, Peter D.; Warren, Wesley C.; Wells, Dan; Wills, Andrea; Wilson, Richard K.; Zimmerman, Lyle B.; Zorn, Aaron M.; Grainger, Robert; Grammer, Timothy; Khokha, Mustafa K.; Richardson, Paul M.; Rokhsar, Daniel S.

    2009-10-01

    The western clawed frog Xenopus tropicalis is an important model for vertebrate development that combines experimental advantages of the African clawed frog Xenopus laevis with more tractable genetics. Here we present a draft genome sequence assembly of X. tropicalis. This genome encodes over 20,000 protein-coding genes, including orthologs of at least 1,700 human disease genes. Over a million expressed sequence tags validated the annotation. More than one-third of the genome consists of transposable elements, with unusually prevalent DNA transposons. Like other tetrapods, the genome contains gene deserts enriched for conserved non-coding elements. The genome exhibits remarkable shared synteny with human and chicken over major parts of large chromosomes, broken by lineage-specific chromosome fusions and fissions, mainly in the mammalian lineage.

  7. Vocal acrobatics in a Chinese frog, Amolops tormotus

    Science.gov (United States)

    Feng, Albert; Narins, Peter; Xu, Chun-He

    2002-06-01

    Although amphibians are highly vocal, they generally emit only a limited number of acoustic communication signals. We report here the extraordinarily rich vocal repertoire of Amolops tormotus, a ranid species in China. These frogs produce countless vocalizations, some of which share features of birdsong or primate calls, e.g., ultrasonic frequency components, multiple upward and downward FM sweeps, and sudden onset and offset of selective harmonic components within a call note. Frame-by-frame video analysis of the frog's calling behavior suggests the presence of two pairs of vocal sacs that may contribute to the remarkable call-note complexity in this species. Electronic supplementary material to this paper can be obtained by using the Springer LINK server located at http://dx.doi.org/10.1007/s00114-002-0335-x.

  8. The rediscovered Hula painted frog is a living fossil.

    Science.gov (United States)

    Biton, Rebecca; Geffen, Eli; Vences, Miguel; Cohen, Orly; Bailon, Salvador; Rabinovich, Rivka; Malka, Yoram; Oron, Talya; Boistel, Renaud; Brumfeld, Vlad; Gafny, Sarig

    2013-01-01

    Amphibian declines are seen as an indicator of the onset of a sixth mass extinction of life on earth. Because of a combination of factors such as habitat destruction, emerging pathogens and pollutants, over 156 amphibian species have not been seen for several decades, and 34 of these were listed as extinct by 2004. Here we report the rediscovery of the Hula painted frog, the first amphibian to have been declared extinct. We provide evidence that not only has this species survived undetected in its type locality for almost 60 years but also that it is a surviving member of an otherwise extinct genus of alytid frogs, Latonia, known only as fossils from Oligocene to Pleistocene in Europe. The survival of this living fossil is a striking example of resilience to severe habitat degradation during the past century by an amphibian.

  9. Contractile reaction of isolated frog aorta after X-irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Michailov, M.C.; Prechter, I.; Greimel, H.; Welscher, U.E.

    1983-07-01

    The action of X-rays (50 kV, filtered by 0.3 mm Al) on helical strip of frog aorta (rana esculenta) has been investigated. The isolated preparations have a stable basal tone and are radio-sensitive to X-rays which induce reversible, dose-dependent, contractile responses. After repeated irradiational tachyphylaxis appears. The threshold doses are about 250 R at 3 to 6 kR/min, antiadrenergic (phentolamine, propranolol), anticholinergic (atropin), antihistaminic (Neo-Bridal) and serotoninergic (Deseril) drugs have no visible influence on the X-ray induced reaction, i.e. these action mechanisms of the irradiation-induced contraction do not seem probable. Theophylline and cAMP inhibit the X-ray contraction probably non-specifically. Indometacin also inhibits the X-ray contraction: this suggests participation of prostaglandin-mechanism on the contraction of frog aorta after irradiation.

  10. The genome of the Western clawed frog Xenopus tropicalis.

    Science.gov (United States)

    Hellsten, Uffe; Harland, Richard M; Gilchrist, Michael J; Hendrix, David; Jurka, Jerzy; Kapitonov, Vladimir; Ovcharenko, Ivan; Putnam, Nicholas H; Shu, Shengqiang; Taher, Leila; Blitz, Ira L; Blumberg, Bruce; Dichmann, Darwin S; Dubchak, Inna; Amaya, Enrique; Detter, John C; Fletcher, Russell; Gerhard, Daniela S; Goodstein, David; Graves, Tina; Grigoriev, Igor V; Grimwood, Jane; Kawashima, Takeshi; Lindquist, Erika; Lucas, Susan M; Mead, Paul E; Mitros, Therese; Ogino, Hajime; Ohta, Yuko; Poliakov, Alexander V; Pollet, Nicolas; Robert, Jacques; Salamov, Asaf; Sater, Amy K; Schmutz, Jeremy; Terry, Astrid; Vize, Peter D; Warren, Wesley C; Wells, Dan; Wills, Andrea; Wilson, Richard K; Zimmerman, Lyle B; Zorn, Aaron M; Grainger, Robert; Grammer, Timothy; Khokha, Mustafa K; Richardson, Paul M; Rokhsar, Daniel S

    2010-04-30

    The western clawed frog Xenopus tropicalis is an important model for vertebrate development that combines experimental advantages of the African clawed frog Xenopus laevis with more tractable genetics. Here we present a draft genome sequence assembly of X. tropicalis. This genome encodes more than 20,000 protein-coding genes, including orthologs of at least 1700 human disease genes. Over 1 million expressed sequence tags validated the annotation. More than one-third of the genome consists of transposable elements, with unusually prevalent DNA transposons. Like that of other tetrapods, the genome of X. tropicalis contains gene deserts enriched for conserved noncoding elements. The genome exhibits substantial shared synteny with human and chicken over major parts of large chromosomes, broken by lineage-specific chromosome fusions and fissions, mainly in the mammalian lineage.

  11. An Electromyographic Study of Jaw and Tongue Reflexes in Frogs

    OpenAIRE

    熊井, 敏文; 野村, 浩道

    1983-01-01

    Electromyographic activities of jaw and tongue muscles produced reflexly by mechanical and chemical stimulation of various loci of orofacial region were studied in the frog, Rana nigromaculata. Temporal muscle activity occurred when mechanical stimuli were applied to the palatal ridge, lower lip, root of tongue and pharynx. Electromyograms of the masseter muscle were similar to that of the temporal muscle, but the masseter muscle activity was occurred ipsilaterally and was not occurred by the...

  12. Effects of Dimethoate on Tree Frog (Hyla arborea) Larvae

    OpenAIRE

    Ferah SAYIM; Kaya, Uğur

    2006-01-01

    Considering the global decline of amphibian populations, the present study aimed to investigate the sensitivity of tree frogs to a common pesticide, dimethoate. Our study reports the effects of dimethoate on 21st- and 25th-stage Hyla arborea larvae under standardized laboratory conditions in an acute toxicity test using the static system. Specimens used for testing were obtained from the eggs of mating pairs collected at a local natural pond. Each experimental group contained 10 healthy larva...

  13. Effect of Krebs cycle metabolites on frog heart.

    Science.gov (United States)

    Chopde, C T; Dorle, A K; Brahmankar, D M

    1975-01-01

    All the Krebs metabolites except pyruvate, lactate, acetate and succinate reduced the force and rate of myocardial contractions and also decreased cardiac output in frog. Succinate on the contrary was found to augment the rate and force of heart. The cardiac stimulation produced by epinephrine was reduced by fumarate, malate, oxaloacetate and alpha-oxoglutarate, whereas transaconitate and citrate produced only a slight inhibition. Pyruvate, lactate, acetate and succinate did not alter cardiac response to epinephrine.

  14. Regulation of SMAD transcription factors during freezing in the freeze tolerant wood frog, Rana sylvatica.

    Science.gov (United States)

    Aguilar, Oscar A; Hadj-Moussa, Hanane; Storey, Kenneth B

    2016-11-01

    The wood frog, Rana sylvatica, survives sub-zero winter temperatures by undergoing full body freezing for weeks at a time, during which it displays no measurable brain activity, no breathing, and a flat-lined heart. Freezing is a hypometabolic state characterized by a global suppression of gene expression that is elicited in part by transcription factors that coordinate the activation of vital pro-survival pathways. Smad transcription factors respond to TGF-β signalling and are involved in numerous cellular functions from development to stress. Given the identity of genes they regulate, we hypothesized that they may be involved in coordinating gene expression during freezing. Protein expression of Smad1/2/3/4/5 in response to freezing was examined in 24h frozen and 8h thawed wood frog tissues using western immunoblotting, with the determination of subcellular localization in muscle and liver tissues. Transcript levels of smad2, smad4 and downstream genes (serpine1, myostatin, and tsc22d3) were measured by RT-PCR. Tissue-specific responses were observed during freezing where brain, heart, and liver had elevated levels of pSmad3, and skeletal muscle and kidneys had increased levels of pSmad1/5 and pSmad2 during freeze/thaw cycle, while protein and transcript levels remained constant. There were increases in nuclear levels of pSmad2 in muscle and pSmad3 in liver. Transcript levels of serpine1 were induced in heart, muscle, and liver, myostatin in muscle, and tsc22d3 in heart, and liver during freezing. These results suggest a novel freeze-responsive activation of Smad proteins that may play an important role in coordinating pro-survival gene networks necessary for freeze tolerance.

  15. Develop Inventory Protocols for frogs within the Region 1 Great Northern and Great Basin LCC, Protocol Development & Remote Audial Inventory

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Many refuges lack basic information on distribution of frogs, but conducting inventory surveys for frogs can be problematic. Different species breed at different...

  16. Correlation between chloride flux via the mitochondria-rich cells and transepithelial water movement in isolated frog skin (Rana esculenta)

    DEFF Research Database (Denmark)

    Nielsen, Robert

    1995-01-01

    Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells.......Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells....

  17. Electrophysiological evidence for an ATP-gated ion channel in the principal cells of the frog skin epithelium

    DEFF Research Database (Denmark)

    Brodin, Birger; Nielsen, Robert

    2000-01-01

    P2X receptor, Na+ absorption, Short circuit current, Cell potential, Microelectrodes, Frog skin, Cytosolic Ca2+......P2X receptor, Na+ absorption, Short circuit current, Cell potential, Microelectrodes, Frog skin, Cytosolic Ca2+...

  18. Effects of the herbicide imazapyr on juvenile Oregon spotted frogs.

    Science.gov (United States)

    Yahnke, Amy E; Grue, Christian E; Hayes, Marc P; Troiano, Alexandra T

    2013-01-01

    Conflict between native amphibians and aquatic weed management in the Pacific Northwest is rarely recognized because most native stillwater-breeding amphibian species move upland during summer, when herbicide application to control weeds in aquatic habitats typically occurs. However, aquatic weed management may pose a risk for aquatic species present in wetlands through the summer, such as the Oregon spotted frog (OSF, Rana pretiosa), a state endangered species in Washington. Acute toxicity of herbicides used to control aquatic weeds tends to be low, but the direct effects of herbicide tank mixes on OSFs have remained unexamined. We exposed juvenile OSFs to tank mixes of the herbicide imazapyr, a surfactant, and a marker dye in a 96-h static-renewal test. The tank mix was chosen because of its low toxicity to fish and its effectiveness in aquatic weed control. Concentrations were those associated with low-volume (3.5 L/ha) and high-volume (7.0 L/ha) applications of imazapyr and a clean-water control. Following exposure, frogs were reared for two months in clean water to identify potential latent effects on growth. Endpoints evaluated included feeding behavior, growth, and body and liver condition indices. We recorded no mortalities and found no significant differences for any end point between the herbicide-exposed and clean-water control frogs. The results suggest that imazapyr use in wetland restoration poses a low risk of direct toxic effects on juvenile OSFs. Copyright © 2012 SETAC.

  19. Effects of the herbicide imazapyr on juvenile Oregon spotted frogs

    Science.gov (United States)

    Yahnke, Amy E.; Grue, Christian E.; Hayes, Marc P.; Troiano, Alexandra T.

    2013-01-01

    Conflict between native amphibians and aquatic weed management in the Pacific Northwest is rarely recognized because most native stillwater-breeding amphibian species move upland during summer, when herbicide application to control weeds in aquatic habitats typically occurs. However, aquatic weed management may pose a risk for aquatic species present in wetlands through the summer, such as the Oregon spotted frog (OSF, Rana pretiosa), a state endangered species in Washington. Acute toxicity of herbicides used to control aquatic weeds tends to be low, but the direct effects of herbicide tank mixes on OSFs have remained unexamined. We exposed juvenile OSFs to tank mixes of the herbicide imazapyr, a surfactant, and a marker dye in a 96-h static-renewal test. The tank mix was chosen because of its low toxicity to fish and its effectiveness in aquatic weed control. Concentrations were those associated with low-volume (3.5 L/ha) and high-volume (7.0 L/ha) applications of imazapyr and a clean-water control. Following exposure, frogs were reared for two months in clean water to identify potential latent effects on growth. Endpoints evaluated included feeding behavior, growth, and body and liver condition indices. We recorded no mortalities and found no significant differences for any end point between the herbicide-exposed and clean-water control frogs. The results suggest that imazapyr use in wetland restoration poses a low risk of direct toxic effects on juvenile OSFs.

  20. Chronic exposures to monomethyl phthalate in Western clawed frogs.

    Science.gov (United States)

    Mathieu-Denoncourt, Justine; de Solla, Shane R; Langlois, Valerie S

    2015-08-01

    Polymer flexibility and elasticity is enhanced by plasticizers. However, plasticizers are often not covalently bound to plastics and thus can leach from products into the environment. Much research effort has focused on their effects in mammalian species, but data on aquatic species are scarce. In this study, Western clawed frog (Silurana tropicalis) embryos were exposed to 1.3, 12.3, and 128.7mg/L monomethyl phthalate (MMP) until the juvenile stage (11weeks) and to 1.3mg/L MMP until the adult stage (51weeks). MMP decreased survival, hastened metamorphosis, and biased the sex ratio toward males (2M:1F) at the juvenile stage without altering the expression of a subset of thyroid hormone-, sex steroid-, cellular stress- or transcription regulation-related genes in the juvenile frog livers. At the adult stage, exposure to MMP did not have significant adverse health effects, except that females had larger interocular distance and the expression of the heat shock protein 70 was decreased by 60% in the adult liver. In conclusion, this study shows that MMP is unlikely to threaten amphibian populations as only concentrations four orders of magnitude higher than the reported environmental concentrations altered the animal physiology. This is the first complete investigation of the effects of phthalates in a frog species, encompassing the entire life cycle of the organisms. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  1. Structural study of the frog Rana temporaria larval stomach.

    Science.gov (United States)

    Rovira, J; Villaro, A C; Bodegas, M E; Valverde, E; Sesma, P

    1993-10-01

    The gastric wall of Rana temporaria tadpoles consists of a well-developed mucosa and thin muscular and serosa layers. Three cellular types--mucous, ciliated and endocrine cells--make up the lining epithelium. Different types of endocrine cells exist. Argyrophylic endocrine cells can be recognized in semithin sections of plastic-embedded material while non-argyrophylic endocrine cells can only be identified under the electron microscope. Glands are composed mainly of well-differentiated oxyntic cells and, occasionally, scarce endocrine cells. Oxyntic cells show abundant mitochondria and smooth endoplasmic reticulum, but do not contain zymogen granules as do those present in adults. Secretory canaliculi with microvilli are also well-developed. The lamina propria contains numerous vascular sinuses and nerve bundles which innervate the endothelium and some endocrine cells. The neuroendocrine regulation of frog gastric functions seems therefore to have developed in young tadpoles. Nerve fibers also innervate the muscular propria, which is composed of a single layer of smooth muscle cells. Underlying the muscle, connective fibers and a flattened layer of mesothelial cells make up the serosa. In summary, the structure of the frog larval stomach shows a well-differentiated histological pattern, especially referring to surface epithelium and glands. Some of the histological traits will also be present in adult frogs while others are characteristic of the tadpole's stage.

  2. Polyandry, Predation, and the Evolution of Frog Reproductive Modes.

    Science.gov (United States)

    Zamudio, Kelly R; Bell, Rayna C; Nali, Renato C; Haddad, Célio F B; Prado, Cynthia P A

    2016-09-01

    Frog reproductive modes are complex phenotypes that include egg/clutch characteristics, oviposition site, larval development, and sometimes, parental care. Two evident patterns in the evolution of these traits are the higher diversity of reproductive modes in the tropics and the apparent progression from aquatic to terrestrial reproduction, often attributed to higher fitness resulting from decreased predation on terrestrial eggs and tadpoles. Here, we propose that sexual selection-and not only natural selection due to predation-favors terrestrial breeding by reducing the loss of fitness due to polyandry. To examine this novel selective mechanism, we reconstructed the evolution of reproductive diversity in two frog families (Hylidae and Leptodactylidae) and tested for concerted evolution of egg and tadpole development sites with specific mating behaviors. We found that oviposition and tadpole development sites are evolving independently, do not show the same diversity and/or directionality in terms of terrestriality, and thus may be diversifying due to different selective mechanisms. In both families, terrestrial egg deposition is correlated with amplexus that is hidden from competing males, and in hylids, testes mass was significantly larger and more variable in males with exposed amplexus that are vulnerable to polyandry. Our results indicate that intrasexual selection has been an underappreciated mechanism promoting diversification of frog reproductive modes.

  3. Eugenol for anesthesia of African clawed frogs (Xenopus laevis).

    Science.gov (United States)

    Guénette, Sarah A; Hélie, Pierre; Beaudry, Francis; Vachon, Pascal

    2007-05-01

    To determine the level of anesthesia attained in Xenopus laevis frogs with eugenol at different doses and by different routes of administration. Prospective experimental trial. Sixty X. laevis nonbreeding female frogs weighing between 90 and 140 g. Three different routes of administration were tested - subcutaneous injections into the dorsal lymph sacs, topical administration using a gauze patch, and immersion in a bath containing eugenol. Following the determination of the best route of administration, the acetic acid test, the withdrawal reflex, righting reflex, heart rate, and respiratory frequency were used to evaluate central nervous system depression following eugenol bath administration. In an additional group, the response to a surgical incision of the abdominal wall was evaluated. The pharmacokinetics of eugenol were determined following bath immersion administration, and pharmacokinetic parameters were calculated following blood concentration determination by tandem liquid chromatography/mass spectrometry analyses. It was not possible to induce anethesia with subcutaneous and patch administration, independent of the eugenol dose administered. The immersion bath was the only efficacious route for anesthesia inducing surgical anesthesia for at least 30 minutes with postoperative analgesia. Histopathology of selected tissues (heart, lung, liver, kidneys, eyes) showed no evidence of lesions 24 hours following bath immersion. The elimination half-life (T(1/2)) was 4 hours. When administered as a single-bath immersion (dose 350 mg L(-1)) for 15 minutes, eugenol may serve as an effective anesthetic in X. laevis frogs for short surgical procedures.

  4. Frog meat microbiota (Lithobates catesbeianus used in infant food

    Directory of Open Access Journals (Sweden)

    Eliane Rodrigues

    2014-03-01

    Full Text Available Captive breeding of bullfrog (Lithobates catesbeianus is of great economic potential, mainly for its thighs and leather. The nutritional quality of frog meat includes properly balanced amino acids with a protein profile of high biological value, low fat and low cholesterol, and high digestibility due to its short chain molecule structure. It is recommended by doctors and nutritionists, especially for protein restricted children or malnourished children. Aiming to aggregate value to the segment and offer a product with nutritional properties that meet the need of children aged six months and above, a meat product based on the composition of frog meat was developed experimentally. To ensure raw material quality after bleaching and deboning, the microbiota present in the frog meat was determined. The analyses were performed according to Brazilian laws. It was observed that the resident and transient microbiota met the standards set by regulations. The results found were: mesophyll 4.5 x 10(4 CFU/g; Staphylococcus coagulase positive 2.0 x 10² CFU/g; negative for Salmonella sp. and Aeromonas spp. The findings indicate that the raw material showed satisfactory sanitation even in terms of family industry.

  5. Developmental aspects of the direct-developing frog Adelophryne maranguapensis.

    Science.gov (United States)

    de Lima, Ana V P; Reis, Alice H; Amado, Nathália G; Cassiano-Lima, Daniel; Borges-Nojosa, Diva M; Oriá, Reinaldo B; Abreu, José G

    2016-05-01

    Direct development in amphibians is characterized by the loss of aquatic breeding. The anuran Adelophryne maranguapensis is one example of a species with direct development, and it is endemic to the state of Ceará, Brazil. Detailed morphological features of A. maranguapensis embryos and the stages of sequential development have not been described before. Here, we analyzed all available genetic sequence tags in A. maranguapensis (tyr exon 1, pomc and rag1) and compared them with sequences from other species of Adelophryne frogs. We describe the A. maranguapensis reproductive tract and embryonic body development, with a focus on the limbs, tail, ciliated cells of the skin, and the egg tooth, which were analyzed using scanning electron microscopy. Histological analyses revealed ovaries containing oocytes surrounded by follicular cells, displaying large nuclei with nucleoli inside. Early in development, the body is unpigmented, and the neural tube forms dorsally to the yolk vesicle, typical of a direct-developing frog embryo. The hindlimbs develop earlier than the forelimbs. Ciliated cells are abundant during the early stages of skin development and are less common during later stages. The egg tooth appears in the later stages and develops as a keratinized microridge structure. The developmental profile of A. maranguapensis presented here will contribute to our understanding of the direct-development model and may help preserve this endangered native Brazilian frog. genesis 54:257-271, 2016. © 2016 Wiley Periodicals, Inc.

  6. Late Modern Play Culture

    DEFF Research Database (Denmark)

    Skovbjerg-Karoff, Helle

    2008-01-01

    Children's play and culture have changed over the recent years, and it is possible to understand the changes as a result of a more general change in society. We witness a large degree of changes connected to demographical aspects of children's lives. First of all it is a fact that large groups....... They are changing play arenas in order to find the identity, which suits them. In order to play children must know and be conscious of the cultural heritage, which contains knowledge of the way to organize in the playing session, the aesthetics, the techniques of playing, and this is something that is handed down...... from one generation to the next. Because older children are no longer present as younger children grow up, the traditional "cultural leaders" are gone. They have taken with them much of the inspiration for play as well as important knowledge about how to organise a game. In that sense we can say...

  7. Play, dreams, and creativity.

    Science.gov (United States)

    Oremland, J D

    1998-01-01

    Viewed ontogenetically, creating, dreaming, and playing are a variant of object relatedness. It is suggested that in recapitulating the ontogenetic sequence, creating, dreaming, and playing each as a process initiates by de-differentiation to primal union, evolves into transitional functioning, and consummates in tertiary cognitive discourse. The products of the triad--the created object, the dream, and play--are viewed as synergistic psychodynamic composites of topical, personal, and arche-typical imperatives. Creating, dreaming, and playing are easily overburdened by events, becoming stereotypical and repetitious. Nowhere is this more clearly seen than in the play of chronically ill, hospitalized children. It is suggested that with development generally, playing is replaced by formalized games; only dreaming continues as the vestige of early creative abilities.

  8. Play and virtuality

    Directory of Open Access Journals (Sweden)

    Svein Sando

    2010-07-01

    Full Text Available The similarities between virtuality and play are obvious, beginning with, for instance, the ubiquitous character of both. This paper deals with how insights from research on play can be used to enlighten our understanding of the ethical dimensions of activities in cyberspace, and vice versa. In particular, a central claim that play is beyond vice and virtue is debated and contested.http://dx.doi.org/10.5324/eip.v4i2.1762

  9. Why do Dolphins Play?

    Directory of Open Access Journals (Sweden)

    Stan A. Kuczaj

    2014-05-01

    Full Text Available Play is an important aspect of dolphin life, perhaps even an essential one. Play provides opportunities for dolphin calves to practice and perfect locomotor skills, including those involved in foraging and mating strategies and behaviors. Play also allows dolphin calves to learn important social skills and acquire information about the characteristics and predispositions of members of their social group, particularly their peers. In addition to helping dolphin calves learn how to behave, play also provides valuable opportunities for them to learn how to think. The ability to create and control play contexts enables dolphins to create novel experiences for themselves and their playmates under relatively safe conditions. The behavioral variability and individual creativity that characterize dolphin play yield ample opportunities for individual cognitive development as well as social learning, and sometimes result in innovations that are reproduced by other members of the group. Although adults sometimes produce innovative play, calves are the primary source of such innovations. Calves are also more likely to imitate novel play behaviors than are adults, and so calves contribute significantly to both the creation and transmission of novel play behaviors within a group. Not unexpectedly, then, the complexity of dolphin play increases with the involvement of peers. As a result, the opportunity to observe and/or interact with other dolphin calves enhances the effects of play on the acquisition and maintenance of flexible problem solving skills, the emergence and strengthening of social and communicative competencies, and the establishment of social relationships. It seems that play may have evolved to help young dolphins learn to adapt to novel situations in both their physical and social worlds, the beneficial result being a set of abilities that increases the likelihood that an individual survives and reproduces.

  10. PlayBook三人行

    Institute of Scientific and Technical Information of China (English)

    黑莓时光

    2011-01-01

    PlayBook,来自非苹果的另外一个水果——黑莓,它不是iPad,却也是平板。PBer,这个并不完美的平板——PlayBook的用户,他们开朗、认真、执着。热爱PlayBook的三人,拥有各自的人生轨迹,却挂着同样的嘴角上扬。

  11. An Effective Hybrid Cuckoo Search Algorithm with Improved Shuffled Frog Leaping Algorithm for 0-1 Knapsack Problems

    OpenAIRE

    2014-01-01

    An effective hybrid cuckoo search algorithm (CS) with improved shuffled frog-leaping algorithm (ISFLA) is put forward for solving 0-1 knapsack problem. First of all, with the framework of SFLA, an improved frog-leap operator is designed with the effect of the global optimal information on the frog leaping and information exchange between frog individuals combined with genetic mutation with a small probability. Subsequently, in order to improve the ...

  12. An addition to the diversity of dendrobatid frogs in Venezuela: description of three new collared frogs (Anura: Dendrobatidae: Mannophryne

    Directory of Open Access Journals (Sweden)

    César Luis Barrio-Amorós

    2010-07-01

    Full Text Available Three new species of collared frogs of the genus Mannophryne are described from Venezuela. Two are newly discovered taxa from the Venezuelan Andes, whereas the third species, previously confused with M. trinitatis, is from the Caracas area in the Cordillera de la Costa. The call of the three new species and that of Mannophryne collaris are described. Taxonomic, zoogeographic, and conservation issues are discussed.

  13. Amphibian (Xenopus laevis) tadpoles and adult frogs mount distinct interferon responses to the Frog Virus 3 ranavirus.

    Science.gov (United States)

    Wendel, Emily S; Yaparla, Amulya; Koubourli, Daphne V; Grayfer, Leon

    2017-03-01

    Infections of amphibians by Frog Virus 3 (FV3) and other ranavirus genus members are significantly contributing to the amphibian declines, yet much remains unknown regarding amphibian antiviral immunity. Notably, amphibians represent an important step in the evolution of antiviral interferon (IFN) cytokines as they are amongst the first vertebrates to possess both type I and type III IFNs. Accordingly, we examined the roles of type I and III IFNs in the skin of FV3-challenged amphibian Xenopus laevis) tadpoles and adult frogs. Interestingly, FV3-infected tadpoles mounted type III IFN responses, whereas adult frogs relied on type I IFN immunity. Subcutaneous administration of type I or type III IFNs offered short-term protection of tadpoles against FV3 and these type I and type III IFNs induced the expression of distinct antiviral genes in the tadpole skin. Moreover, subcutaneous injection of tadpoles with type III IFN significantly extended their survival and reduced FV3 dissemination. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. 76 FR 45602 - Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow Creek Ranch, San Luis...

    Science.gov (United States)

    2011-07-29

    ... Fish and Wildlife Service Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow... the Federally threatened California red-legged frog (Rana draytonii), under the Endangered Species Act... California red-legged frog on the property subject to the Agreement (Enrolled Property), which is owned...

  15. Play your part

    CERN Document Server

    Ramsey, Gaynor

    1978-01-01

    Play your part is a collection of then situations in which students have to take on the roles of particular people and express their opinions, feelings or arguments about the situation. Play your part is intended for use with advanced students of English.

  16. Role Playing and Skits

    Science.gov (United States)

    Letwin, Robert, Ed.

    1975-01-01

    Explores non-scripted role playing, dialogue role playing, sociodrama, and skits as variations of simulation techniques. Provides step-by-step guidelines for conducting such sessions. Successful Meetings, Bill Communications, Inc., 1422 Chestnut Street, Philadelphia, Pa. 19102. Subscription Rates: yearly (US, Canada, Mexico) $14.00; elsewhere,…

  17. The Play's the Thing

    Science.gov (United States)

    Bateman, Barbara

    2005-01-01

    The modern special education theater in the United States has hosted many plays, none with a larger or more diverse cast than the learning disabilities (LD) play. During the prologue, the children with LD were waiting in the wings, not yet identified as LD but there, nonetheless. With the advent of compulsory education in this country, awareness…

  18. Playfulness and Openness

    DEFF Research Database (Denmark)

    Marchetti, Emanuela; Petersson, Eva

    2011-01-01

    What does it mean to design a playful learning tool? What is needed for a learning tool to be perceived by potential users as playful? These questions emerged reflecting on a Participatory Design process aimed at enhancing museum-learning practice from the perspective of primary school children. ...

  19. Play as Experience

    Science.gov (United States)

    Henricks, Thomas S.

    2015-01-01

    The author investigates what he believes one of the more important aspects of play--the experience it generates in its participants. He considers the quality of this experience in relation to five ways of viewing play--as action, interaction, activity, disposition, and within a context. He treats broadly the different forms of affect, including…

  20. Art of Play

    DEFF Research Database (Denmark)

    Froes, Isabel Cristina G.; Walker, Kevin

    2011-01-01

    Play is a key element in cultural development, according to the Dutch historian Johan Huizinga. Nowadays many of us interact with other people in online games and social networks, through multiple digital devices. But harnessing playful activities for museum learning is mostly undeveloped. In thi...

  1. Family Play Therapy.

    Science.gov (United States)

    Ariel, Shlomo

    This paper examines a case study of family play therapy in Israel. The unique contributions of play therapy are evaluated including the therapy's accessibility to young children, its richness and flexibility, its exposure of covert patterns, its wealth of therapeutic means, and its therapeutic economy. The systematization of the therapy attempts…

  2. Return to Play

    Science.gov (United States)

    Mangan, Marianne

    2013-01-01

    Call it physical activity, call it games, or call it play. Whatever its name, it's a place we all need to return to. In the physical education, recreation, and dance professions, we need to redesign programs to address the need for and want of play that is inherent in all of us.

  3. Playful Collaboration (Or Not)

    DEFF Research Database (Denmark)

    Bogers, Marcel; Sproedt, Henrik

    2012-01-01

    This article explores how playing games can be used to teach intangible social interaction across boundaries, in particular within open collaborative innovation. We present an exploratory case study of how students learned from playing a board game in a graduate course of the international...... imply several opportunities and challenges within education and beyond....

  4. Art of Play

    DEFF Research Database (Denmark)

    Froes, Isabel Cristina G.; Walker, Kevin

    2011-01-01

    Play is a key element in cultural development, according to the Dutch historian Johan Huizinga. Nowadays many of us interact with other people in online games and social networks, through multiple digital devices. But harnessing playful activities for museum learning is mostly undeveloped. In thi...

  5. Play framework cookbook

    CERN Document Server

    Reelsen, Alexander

    2015-01-01

    This book is aimed at advanced developers who are looking to harness the power of Play 2.x. This book will also be useful for professionals looking to dive deeper into web development. Play 2 .x is an excellent framework to accelerate your learning of advanced topics.

  6. Let's Just Play

    Science.gov (United States)

    Schmidt, Janet

    2003-01-01

    Children have a right to play. The idea is so simple it seems self-evident. But a stroll through any toy superstore, or any half-hour of so-called "children's" programming on commercial TV, makes it clear that violence, not play, dominates what's being sold. In this article, the author discusses how teachers and parents share the responsibility in…

  7. 西安市阿房宫遗址的考古新发现%New Discoveries in the Archaeology of the Epanggong Palace-site, Xi'an

    Institute of Scientific and Technical Information of China (English)

    中国社会科学院考古研究所阿房宫考古工作队; 西安市文物保护考古所阿房宫考古工作队

    2004-01-01

    The Epanggong Palace-site lies west of Xi'an City,opposite to the Qin capital Xianyang with the Weihe River running between them. Exploration revealed the rammed-earth foundation-platform of the anterior hall with a contracted terrace at the northern edge and vestiges of a rammed-earth wall on the southern side. To the south are mixed earth without traces of ramming and road deposits extending northward to the platform. Beyond the southern edge of the platform, remains of a tile-covered building were found to belong to the turn from the Qin to the Han period. It is an important discovery in the exploration of the Epanggong Palace and the archaeology of the Qin period.

  8. Phylogeography of Declining Relict and Lowland Leopard Frogs in the Desert Southwest of North America

    Science.gov (United States)

    We investigated the phylogeography of the closely related relict leopard frog (Rana onca) and lowland leopard frog (R. yavapaiensis) – two declining anurans from the warm-desert regions of southwestern North America. We used sequence data from two mitochondrial DNA genes to asses...

  9. Complex and transitive synchronization in a frustrated system of calling frogs

    Science.gov (United States)

    Aihara, Ikkyu; Takeda, Ryu; Mizumoto, Takeshi; Otsuka, Takuma; Takahashi, Toru; Okuno, Hiroshi G.; Aihara, Kazuyuki

    2011-03-01

    This letter reports synchronization phenomena and mathematical modeling on a frustrated system of living beings, or Japanese tree frogs (Hyla japonica). While an isolated male Japanese tree frog calls nearly periodically, he can hear sounds including calls of other males. Therefore, the spontaneous calling behavior of interacting males can be understood as a system of coupled oscillators. We construct a simple but biologically reasonable model based on the experimental results of two frogs, extend the model to a system of three frogs, and theoretically predict the occurrence of rich synchronization phenomena, such as triphase synchronization and 1:2 antiphase synchronization. In addition, we experimentally verify the theoretical prediction by ethological experiments on the calling behavior of three frogs and time series analysis on recorded sound data. Note that the calling behavior of three male Japanese tree frogs is frustrated because almost perfect antiphase synchronization is robustly observed in a system of two male frogs. Thus, nonlinear dynamics of the three-frogs system should be far from trivial.

  10. The toxicity of Poison Dart Frog alkaloids against the Fire Ant (Solenopsis invicta)

    Science.gov (United States)

    Hundreds of alkaloids, representing over 20 structural classes, have been identified from the skin of neotropical poison frogs (Dendrobatidae). These alkaloids are derived from arthropod prey of the frogs, and are generally are believed to deter vertebrate predators. We developed a method to put ind...

  11. Population estimates for the Toiyabe population of the Columbia spotted frog (Rana luteiventris), 2004–10

    Science.gov (United States)

    Adams, Michael J.; Mellison, Chad; Galvan, Stephanie K.

    2013-01-01

    The Toiyabe population of Columbia spotted frogs (Rana luteiventris, hereafter "Toiyabe frogs") is a geographically isolated population located in central Nevada (fig. 1). The Toiyabe population is part of the Great Basin Distinct Population Segment of Columbia spotted frogs, and is a candidate for listing under the Endangered Species Act (U.S. Fish and Wildlife Service, 2011). The cluster of breeding sites in central Nevada represents the southernmost extremity of the Columbia spotted frogs' known range (Funk and others, 2008). Toiyabe frogs are known to occur in seven drainages in Nye County, Nevada: Reese River, Cow Canyon Creek, Ledbetter Canyon Creek, Cloverdale Creek, Stewart Creek, Illinois Creek, and Indian Valley Creek. Most of the Toiyabe frog population resides in the Reese River, Indian Valley Creek, and Cloverdale Creek drainages (fig. 1; Nevada Department of Wildlife, 2003). Approximately 90 percent of the Toiyabe frogs' habitat is on public land. Most of the public land habitat (95 percent) is managed by the U.S. Forest Service (USFS), while the Bureau of Land Management (BLM) manages the remainder. Additional Toiyabe frog habitat is under Yomba Shoshone Tribal management and in private ownership (Nevada Department of Wildlife, 2003). The BLM, USFS, Nevada Department of Wildlife (NDOW), Nevada Natural Heritage Program (NNHP), Nye County, and U.S Fish and Wildlife Service (USFWS) have monitored the Toiyabe population since 2004 using mark and recapture surveys (Nevada Department of Wildlife, 2004). The USFWS contracted with the U.S. Geological Survey (USGS) to produce population estimates using these data.

  12. Propulsive force calculations in swimming frogs II. Application of a vortex ring model to DPIV data

    NARCIS (Netherlands)

    Stamhuis, EJ; Nauwelaerts, S

    2005-01-01

    Frogs propel themselves by kicking water backwards using a synchronised extension of their hind limbs and webbed feet. To understand this propulsion process, we quantified the water movements and displacements resulting from swimming in the green frog Rana esculenta, applying digital particle image

  13. Rate of protein synthesis and polyribosome formation in the frog pancreas after fasting and feeding

    NARCIS (Netherlands)

    Venrooij, W.J. van; Poort, C.

    1972-01-01

    1. 1. The rate of incorporation of [14C]leucine into the proteins of the frog pancreas was measured after the animals had been fasted or fed. The incorporation rate increased after feeding, being maximal at about 4 h after the meal. 2. 2. In homogenates of pancreases from fasted frogs only monoribo

  14. Comparison of RABITT and FROG measurements in the temporal characterization of attosecond pulse trains

    CERN Document Server

    Kim, Kyung Taec; Park, Mi Na; Imran, Tayyab; Umesh, G; Nam, Chang Hee

    2007-01-01

    The attosecond high harmonic pulses obtained from a long Ar-filled gas cell were characterized by two techniques - the reconstruction of attosecond beating by interference of two-photon transition (RABITT) and frequency-resolved optical gating (FROG) methods. The pulse durations obtained by RABITT and FROG methods agreed within 10 %.

  15. Bacterial flora on Cascades frogs in the Klamath Mountains of California

    Science.gov (United States)

    Karen Pope

    2013-01-01

    Amphibians are experiencing global declines due in part to the infectious disease chytridiomycosis. Some symbiotic bacteria residents on frog skin have been shown to inhibit the growth of Batrachochytrium dendrobatitis (Bd) but few studies have attempted to fully describe the resident bacterial flora of frog skin. We cultured and sequenced 130...

  16. Oregon spotted frog (Rana pretiosa) monitoring at Jack Creek 2015-2016

    Science.gov (United States)

    Adams, Michael J.; Pearl, Christopher A.; Mccreary, Brome; Galvan, Stephanie; Rowe, Jennifer

    2017-01-01

    This dataset contains information from mark-recapture and egg mass surveys conducted 2015-2016 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa) monitoring effort at Jack Creek, Klamath County, Oregon. Data consist of spotted frog counts aggregated by date, location, life stage, and sex, as well as data on environmental conditions at the time each survey.

  17. Multistate outbreak of human Salmonella typhimurium infections associated with aquatic frogs - United States, 2009.

    Science.gov (United States)

    2010-01-08

    During April-July 2009, the Utah Department of Health identified five cases of Salmonella Typhimurium infection with indistinguishable pulsed-field gel electrophoresis (PFGE) patterns, predominantly among children. In August, CDC began a multistate outbreak investigation to determine the source of the infections. This report summarizes the results of this ongoing investigation, which, as of December 30, had identified 85 S. Typhimurium human isolates with the outbreak strain from 31 states. In a multistate case-control study, exposure to frogs was found to be significantly associated with illness (63% of cases versus 3% of controls; matched odds ratio [mOR] = 24.4). Among 14 case-patients who knew the type of frog, all had exposure to an exclusively aquatic frog species, the African dwarf frog. Environmental samples from aquariums containing aquatic frogs in four homes of case-patients yielded S. Typhimurium isolates matching the outbreak strain. Preliminary traceback information has indicated these frogs likely came from the same breeder in California. Reptiles (e.g., turtles) and amphibians (e.g., frogs) have long been recognized as Salmonella carriers, and three multistate outbreaks of human Salmonella infections associated with turtle contact have occurred since 2006. However, this is the first reported multistate outbreak of Salmonella infections associated with amphibians. Educational materials aimed at preventing salmonellosis from contact with reptiles should be expanded to include amphibians, such as aquatic frogs.

  18. BIOSENSING TECHNICS FOR HUMAN DETECTION. 1. THE FROG SKIN TRANSDUCER: PRELIMINARY EXPERIMENT

    Science.gov (United States)

    Isolated frog skin used as a transducer whose bioelectrical potential is measured as a function of chemical species and concentration, is shown to...log units. A high degree of variability of response between frog skins, and a lack of data on ultimate sensitivities at usefully low levels for selected substances, are major problems that remain to be examined.

  19. SOME PROPERTIES OF THE AFFERENT PATHWAY IN THE FROG CORNEAL REFLEX,

    Science.gov (United States)

    evidence on the neurological basis of stimulus specificity. The frog corneal reflex is particularly well suited for this type of study, since the stimulus...conducted on normal adult frogs . The results provide a new basis for study of animals with transplanted sensory tissue. (Author)

  20. Phylogeography of Declining Relict and Lowland Leopard Frogs in the Desert Southwest of North America

    Science.gov (United States)

    We investigated the phylogeography of the closely related relict leopard frog (Rana onca) and lowland leopard frog (R. yavapaiensis) – two declining anurans from the warm-desert regions of southwestern North America. We used sequence data from two mitochondrial DNA genes to asses...

  1. Flesh fly myiasis (Diptera, Sarcophagidae in Peruvian poison frogs genus Epipedobates (Anura, Dendrobatidae

    Directory of Open Access Journals (Sweden)

    Mattias Hagman

    2005-10-01

    Full Text Available In this note we review records of myiasis in poison frogs collected in various locations in Peru during 1982-2005 and present evidence that larger and medium-sized poison frogs (Epipedobates are infected with sarcophagid fly larvae.

  2. Propulsive force calculations in swimming frogs I. A momentum-impulse approach

    NARCIS (Netherlands)

    Nauwelaerts, S; Stamhuis, EJ; Aerts, P

    Frogs are animals that are capable of locomotion in two physically different media, aquatic and terrestrial. A comparison of the kinematics of swimming frogs in a previous study revealed a difference in propulsive impulse between jumping and swimming. To explore this difference further, we

  3. Hematological, Biochemical and Histopathological Studies on Marsh Frog, Rana ridibunda, Naturally Infected with Waltonella duboisi

    Directory of Open Access Journals (Sweden)

    A.M. Al-Attar

    2010-01-01

    Full Text Available The present study was aimed to evaluate the impact of Waltonella duboisi naturally infection in the marsh frog, Rana ridibunda. Healthy and infected frogs of both sexes were collected from Al-Qatif and Al-Hassa farms, Eastern Province, Saudi Arabia. The hematological, biochemical and histopathological changes were estimated in infected male and female frogs compared with healthy frogs. The values of red blood cell count, hemoglobin concentration, hematocrit, mean cell volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration and white blood cell count were statistically decreased in infected frogs. Infection with Waltonella duboisi induced significant reduction in the levels of serum glucose and total proteins, while the values of triglycerides cholesterol, creatinine, glutamic pyruvic acid transaminase and glutamic oxaloacetic acid transaminase were significantly elevated. Histopathological examination of stomach, small intestine, liver showed the larval developmental stages of Waltonella duboisi. A partially abnormal of testis and ovary structures with pronounced disturbance in quantity and quality of spermatogenesis and oogenesis processes were noted in infected of both sexes of frogs. From the present study, it is obviously that Waltonella duboisi caused many severe physiological and histopathological alterations in both sexes of the marsh frogs. Thus, more sincere ecological and scientific efforts are required to rescue the marsh frog population from parasitic infection, pathogenic factors and increases of mortality rate.

  4. Turning Cultural Heritage into Cultural and Creative Products: A Case Study of Value Creation Out of Cultural Artifacts Collaborated between the National Palace Museum and the Bright Ideas Design, Co. Ltd.

    OpenAIRE

    Hui-Fen Chen; Yann-Jy Yang

    2016-01-01

    This paper analysed the value creation activities of cultural and creative products developed from cultural heritage. It employed the case study methodology to examine two collaboration projects between the Bright Ideas Design, Co. Ltd. and National Palace Museum. A framework was developed based on the review of the relevant literature on cultural products, value creation and digital content. Research data included information obtained from semi-structured interviews and secondary sources. Th...

  5. Play vs. Procedures

    DEFF Research Database (Denmark)

    Hammar, Emil

    Through the theories of play by Gadamer (2004) and Henricks (2006), I will show how the relationship between play and game can be understood as dialectic and disruptive, thus challenging understandings of how the procedures of games determine player activity and vice versa. As such, I posit some...... analytical consequences for understandings of digital games as procedurally fixed (Boghost, 2006; Flannagan, 2009; Bathwaite & Sharp, 2010). That is, if digital games are argued to be procedurally fixed and if play is an appropriative and dialectic activity, then it could be argued that the latter affects...

  6. 北京圆明园含经堂遗址2001~2002年度发掘简报%Excavation on the Hanjingtang Hall Site in the Yuanmingyuan Palace, Beijing, in 2001-2002

    Institute of Scientific and Technical Information of China (English)

    北京市文物研究所圆明园考古队

    2004-01-01

    The Hanjingtang Hall site is a ruined building complex on a water-surrounded island in the Yuanmingyuan Palace. It covers an area of over 60,000 sq m, of which above 30,000 sq m are occupied by building vestiges. There were more than 30 building units, which formed a residential palace of Qianlong, an emperor in the prosperous reigns of the Qing Dynasty. Excavation clarified that the south of the site was a square; the middle, the main pavilion and its yard; and the north, the rear living place.They were laid out in west - east rows with the central axis pointing to the north and south. Nearly 1,000 cultural relics have been unearthed from the site. The excavation brought to light firsthand data on the architectural pattern, size, structural features and evolution of the Hall. These constitute a batch of reliable material evidence for the preservation and utilization of the site. Meanwhile, the work provided seeking experience for protecting the sites of other sights in the Yuanminyuan Palace.

  7. The Pharmacodynamic Impact of Apremilast, an Oral Phosphodiesterase 4 Inhibitor, on Circulating Levels of Inflammatory Biomarkers in Patients with Psoriatic Arthritis: Substudy Results from a Phase III, Randomized, Placebo-Controlled Trial (PALACE 1

    Directory of Open Access Journals (Sweden)

    Peter H. Schafer

    2015-01-01

    Full Text Available Apremilast, an oral phosphodiesterase 4 inhibitor, demonstrated effectiveness (versus placebo for treatment of active psoriatic arthritis in the psoriatic arthritis long-term assessment of clinical efficacy (PALACE phase III clinical trial program. Pharmacodynamic effects of apremilast on plasma biomarkers associated with inflammation were evaluated in a PALACE 1 substudy. Of 504 patients randomized in PALACE 1, 150 (placebo: n=51; apremilast 20 mg BID: n=51; apremilast 30 mg BID: n=48 provided peripheral blood plasma samples for analysis in a multiplexed cytometric bead array assay measuring 47 proteins associated with systemic inflammatory immune responses. Association between biomarker levels and achievement of 20% improvement from baseline in modified American College of Rheumatology (ACR20 response criteria was assessed by logistic regression. At Week 24, IL-8, TNF-α, IL-6, MIP-1β, MCP-1, and ferritin were significantly reduced from baseline with apremilast 20 mg BID or 30 mg BID versus placebo. ACR20 response correlated with change in TNF-α level with both apremilast doses. At Week 40, IL-17, IL-23, IL-6, and ferritin were significantly decreased and IL-10 and IL-1 receptor antagonists significantly increased with apremilast 30 mg BID versus placebo. In patients with active psoriatic arthritis, apremilast reduced circulating levels of Th1 and Th17 proinflammatory mediators and increased anti-inflammatory mediators.

  8. Embryogenesis and laboratory maintenance of the foam-nesting túngara frogs, genus Engystomops (= Physalaemus).

    Science.gov (United States)

    Romero-Carvajal, Andrés; Sáenz-Ponce, Natalia; Venegas-Ferrín, Michael; Almeida-Reinoso, Diego; Lee, Chanjae; Bond, Jennifer; Ryan, Michael J; Wallingford, John B; Del Pino, Eugenia M

    2009-06-01

    The vast majority of embryological research on amphibians focuses on just a single genus of frogs, Xenopus. To attain a more comprehensive understanding of amphibian development, experimentation on non-model frogs will be essential. Here, we report on the early development, rearing, and embryological analysis of túngara frogs (genus Engystomops, also called Physalaemus). The frogs Engystomops pustulosus, Engystomops coloradorum, and Engystomops randi construct floating foam-nests with small eggs. We define a table of 23 stages for the developmental period in the foam-nest. Embryos were immunostained against Lim1, neural, and somite-specific proteins and the expression pattern of RetinoBlastoma Binding Protein 6 (RBBP6) was analyzed by in situ hybridization. Due to their brief life-cycle, frogs belonging to the genus Engystomops are attractive for comparative and genetic studies of development. Developmental Dynamics 238:1444-1454, 2009. (c) 2009 Wiley-Liss, Inc.

  9. Frankixalus, a New Rhacophorid Genus of Tree Hole Breeding Frogs with Oophagous Tadpoles.

    Directory of Open Access Journals (Sweden)

    S D Biju

    Full Text Available Despite renewed interest in the biogeography and evolutionary history of Old World tree frogs (Rhacophoridae, this family still includes enigmatic frogs with ambiguous phylogenetic placement. During fieldwork in four northeastern states of India, we discovered several populations of tree hole breeding frogs with oophagous tadpoles. We used molecular data, consisting of two nuclear and three mitochondrial gene fragments for all known rhacophorid genera, to investigate the phylogenetic position of these new frogs. Our analyses identify a previously overlooked, yet distinct evolutionary lineage of frogs that warrants recognition as a new genus and is here described as Frankixalus gen. nov. This genus, which contains the enigmatic 'Polypedates' jerdonii described by Günther in 1876, forms the sister group of a clade containing Kurixalus, Pseudophilautus, Raorchestes, Mercurana and Beddomixalus. The distinctiveness of this evolutionary lineage is also corroborated by the external morphology of adults and tadpoles, adult osteology, breeding ecology, and life history features.

  10. Frankixalus, a New Rhacophorid Genus of Tree Hole Breeding Frogs with Oophagous Tadpoles

    Science.gov (United States)

    Biju, S. D.; Mahony, Stephen; Kamei, Rachunliu G.; Thomas, Ashish; Shouche, Yogesh; Raxworthy, Christopher J.; Meegaskumbura, Madhava; Bocxlaer, Ines Van

    2016-01-01

    Despite renewed interest in the biogeography and evolutionary history of Old World tree frogs (Rhacophoridae), this family still includes enigmatic frogs with ambiguous phylogenetic placement. During fieldwork in four northeastern states of India, we discovered several populations of tree hole breeding frogs with oophagous tadpoles. We used molecular data, consisting of two nuclear and three mitochondrial gene fragments for all known rhacophorid genera, to investigate the phylogenetic position of these new frogs. Our analyses identify a previously overlooked, yet distinct evolutionary lineage of frogs that warrants recognition as a new genus and is here described as Frankixalus gen. nov. This genus, which contains the enigmatic ‘Polypedates’ jerdonii described by Günther in 1876, forms the sister group of a clade containing Kurixalus, Pseudophilautus, Raorchestes, Mercurana and Beddomixalus. The distinctiveness of this evolutionary lineage is also corroborated by the external morphology of adults and tadpoles, adult osteology, breeding ecology, and life history features. PMID:26790105

  11. Isolation of Brucella inopinata-Like Bacteria from White's and Denny's Tree Frogs.

    Science.gov (United States)

    Kimura, Masanobu; Une, Yumi; Suzuki, Michio; Park, Eun-Sil; Imaoka, Koichi; Morikawa, Shigeru

    2017-05-01

    Brucella inopinata strain BO1 and B. sp. strain BO2 isolated from human patients, respectively, are genetically different from classical Brucella species. We isolated bacteria of the genus Brucella from two species of wild-caught tropical frogs kept in the facilities in Japan: White's tree frog, which inhabits Oceania, and Denny's tree frog, which inhabits Southeast Asia. Phylogenetic analyses based on 16S rRNA and recA gene sequences and multilocus sequence analysis showed that two isolates of Brucella spp. showed significant similarity to BO1, BO2, and the isolates from other wild-caught frogs. These results suggest that a variety of frog species are susceptible to a novel clade of Brucella bacteria, including B. inopinata.

  12. Parasites of the mink frog (rana septentrionalis) from minnesota, U.S.A.

    Science.gov (United States)

    Schotthoefer, A.M.; Bolek, M.G.; Cole, R.A.; Beasley, V.R.

    2009-01-01

    Twenty-two mink frogs, Rana septentrionalis, collected from two locations in Minnesota, United States, were examined for helminth and protozoan blood parasites in July 1999. A total of 16 parasite taxa were recovered including 5 larval digenean trematodes, 7 adult digenean trematodes, 3 nematodes, and I Trypanosorna species. Infracommunities were dominated by the digeneans in terms of richness and abundance. In particular, echinostomatid metacercariae in the kidneys of frogs were the most common parasites found, infecting 100% of the frogs and consisting of about 90% of all helminth individuals recovered. Gorgodera amplicava, Gorgoderina multilohata, Haernaroloechus pan'iplexus, Haernatoloechus breviplexus, Cosnwcercoides dukae, and Oswaldocruzia pipiens represent new host records. The survey presented here represents the second known helminth survey of mink frogs conducted in North America. A summary of metazoan parasites reported from mink frogs is included.

  13. Abundance of green tree frogs and insects in artificial canopy gaps in a bottomland hardwood forest.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James L.; Ulyshen, Michael D.; Kilgo, John C.

    2005-01-01

    Horn, Scott, James L. Hanula, Michael D. Ulyshen, and John C. Kilgo. 2005. Abundance of green tree frogs and insects in artificial canopy gaps in a bottomland hardwood forest. Am. Midl. Nat. 153:321-326. Abstract: We found more green tree frogs (Hyla cinerea) in canopy gaps than in closed canopy forest. Of the 331 green tree frogs observed, 88% were in canopy gaps. Likewise, higher numbers and biomasses of insects were captured in the open gap habitat. Flies were the most commonly collected insect group accounting for 54% of the total capture. These data suggest that one reason green tree frogs were more abundant in canopy gaps was the increased availability of prey and that small canopy gaps provide early successional habitats that are beneficial to green tree frog populations.

  14. Inventory of frog species in the South Carolina Sandhills with a focus on the pine barrens treefrog and the gopher frog

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Tabular data consists of site specific locations of sampling points on Carolina Sandhills NWR for determination of frog species and more specifically sites with Pine...

  15. Inventory of frog species in the South Carolina Sandhills with a focus on the pine barrens treefrog and the gopher frog

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Proposal is to conduct an inventory of frogs and toads at the Carolina Sandhills NWR and adjoining lands. Special emphasis is to locate the pine barrens treefrog and...

  16. Play and Power

    DEFF Research Database (Denmark)

    The power of play, so central to psychoanalytic theory and practice, is conjoined to the social psychological or socio-politically coloured concept of power, giving rise to many fruitful discussions of how these concepts manifest themselves in clinical work with children, groups and adults....... The inspiration for this book was the 3-section EFPP conference in Copenhagen in May 2007 with the main theme "Play and Power". At the conference and in the book, this theme is presented both inside and outside the therapeutic space. It is amply illustrated in clinical cases from individual psychotherapies....... Play and power are also explored in the broader context of the community, however. In relation to society at large, psychoanalytic psychotherapy has important contributions to offer society, and we need playful creativity and power to bring forward our knowledge about it....

  17. Castle-palace of “La Calahorra”, Granada: influence of climatic and architectural factors in differential deterioration of their stone masonries

    Directory of Open Access Journals (Sweden)

    Guardia, J. J.

    2013-12-01

    Full Text Available The castle-palace of La Calahorra is a historical building (6th century with a dual-function. The exterior is a castle-fortress of late-medieval style, built with rubbles and rough ashlars of a crystalline limestone of great hardness and strength. The interior is a Renaissance palace, made of micritic limestone and dolomitic sandstone ashlars, both stone materials are porous, soft and low strength. The entire building has an orangey colored due to an iron patina that stains its stone masonries as a result of wind action. There is a differential deterioration among its external and internal, depending on the type of stone used factories, the rainwater and wind action and the building defects detected. While the exterior stone is in good state of conservation, the interior stones shows some important deterioration processes , mainly the micritic limestone present in the ornamental and decorative areas of the central courtyard.El castillo-palacio de La Calahorra es un edificio histórico (s. XVI con una doble funcionalidad. El exterior es un castillo-fortaleza de estilo tardo-medieval, construido con mampuestos y sillarejos de una caliza cristalina de gran dureza y resistencia. El interior es un palacio renacentista, hecho con sillares de caliza micrítica y arenisca dolomítica, ambos materiales pétreos son porosos, blandos y poco resistentes. Todo el edificio tiene una tonalidad anaranjada debido a la pátina de hierro que tiñe sus fábricas y que es consecuencia de la acción del viento. Existe un deterioro diferencial entre sus fábricas externas e internas, según el tipo de piedra empleado, la acción del agua de lluvia y el viento, y los defectos constructivos detectados. Mientras que la piedra exterior está en buen estado de conservación, las interiores sufren importantes procesos de deterioro, principalmente la caliza micrítica presente en las zonas ornamentales y decorativas del patio central.

  18. Compromised metamorphosis and thyroid hormone changes in wood frogs (Lithobates sylvaticus) raised on reclaimed wetlands on the Athabasca oil sands

    Energy Technology Data Exchange (ETDEWEB)

    Hersikorn, Blair D., E-mail: blair.hersikorn@usask.c [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, Saskatchewan, S7N 5B3 (Canada); Smits, Judit E.G., E-mail: judit.smits@ucalgary.c [Faculty of Veterinary Medicine, University of Calgary, 3280 Hospital Drive NW, Calgary, Alberta, T2N 4Z6 (Canada)

    2011-02-15

    The wet landscape approach to oil sands tailings reclamation in the Athabasca Oil Sands region involves creating wetlands from fluid tailings in mined-out pits. We measured time to metamorphosis, thyroid hormone status, and detoxification enzyme (EROD) induction in Wood frog (Lithobates sylvaticus) tadpoles raised on reclaimed oil sands wetlands of different ages [young ({<=}7 yr) vs. old (>7 yr)] and compared data with tadpoles raised on reference (control) wetlands. Metamorphosis was delayed or never occurred in tadpoles raised in young tailings; those exposed to older tailings developed similarly to those in reference wetlands. Thyroid hormone disruption likely played an important role in the metamorphosis delay as the T3:T4 ratio was lowest in tadpoles raised in young, tailings-affected wetlands. Our findings suggest tailings wetlands become less toxic with age, and that these amphibians will be able to complete their life cycle in tailing wetlands that have sufficiently detoxified with age. - This work provides guidance for reclamation of oil sands tailings and shows the usefulness of frogs and caging studies in environmental toxicology.

  19. Low structural variation in the host-defense peptide repertoire of the dwarf clawed frog Hymenochirus boettgeri (Pipidae.

    Directory of Open Access Journals (Sweden)

    Severine Matthijs

    Full Text Available THE skin secretion of many amphibians contains peptides that are able to kill a broad range of microorganisms (antimicrobial peptides: AMPs and potentially play a role in innate immune defense. Similar to the toxin arsenals of various animals, amphibian AMP repertoires typically show major structural variation, and previous studies have suggested that this may be the result of diversifying selection in adaptation to a diverse spectrum of pathogens. Here we report on transcriptome analyses that indicate a very different pattern in the dwarf clawed frog H. boettgeri. Our analyses reveal a diverse set of transcripts containing two to six tandem repeats, together encoding 14 distinct peptides. Five of these have recently been identified as AMPs, while three more are shown here to potently inhibit the growth of gram-negative bacteria, including multi-drug resistant strains of the medically important Pseudomonas aeruginosa. Although the number of predicted peptides is similar to the numbers of related AMPs in Xenopus and Silurana frog species, they show significantly lower structural variation. Selection analyses confirm that, in contrast to the AMPs of other amphibians, the H. boettgeri peptides did not evolve under diversifying selection. Instead, the low sequence variation among tandem repeats resulted from purifying selection, recent duplication and/or concerted gene evolution. Our study demonstrates that defense peptide repertoires of closely related taxa, after diverging from each other, may evolve under differential selective regimes, leading to contrasting patterns of structural diversity.

  20. Dynamics of testis-ova in a wild population of Japanese pond frogs, Rana nigromaculata.

    Science.gov (United States)

    Kobayashi, Tohru; Kumakura, Masahiko; Yoshie, Sumio; Sugishima, Tomomi; Horie, Yoshifumi

    2015-02-01

    Although many studies have reported the occurrence of testis-ova in wild frog populations, the origin and trigger of testis-ova differentiation/development remain unclear. A high frequency of testis-ova has been previously reported for wild populations of the Japanese pond frog, Rana nigromaculata (cf. Iwasawa and Asai, '59). In the present study, we aimed to clarify the dynamics of testis-ova in this frog species, including the origin and artificial induction of testis-ova. Testis-ova were observed in both mature frogs and puberty-stage frogs (i.e., 0- and 1-year-old frogs). However, the early stages of testis-ova (~pachytene stage) were mostly observed in puberty-stage male frogs at the onset of spermatogenesis. The early stages of testis-ova were observed in the cysts of early secondary spermatogonia and the single cysts of the primary spermatogonium. This finding indicates that testis-ova differentiation occurs during spermatogonial proliferation and that it is correlated with the initiation of spermatogenesis. We also examined whether estrogen exposure induced testis-ova differentiation and how it is correlated with the progression of spermatogenesis. When 1-year-old frogs were exposed to estradiol-17β during spring (i.e., when spermatogenesis was initiated), testis-ova differentiation was induced in a dose-dependent manner. However, this phenomenon did not occur in 1-year-old frogs during summer, (i.e., when the transition from spermatogonia to spermatocytes mainly occurs). These results present the first evidence that testis-ova of the Japanese pond frog are derived from primary and early secondary spermatogonia, and that estrogen exposure induces testis-ova differentiation accompanied by the initiation of spermatogenesis.

  1. Functional evolution of jumping in frogs: Interspecific differences in take-off and landing.

    Science.gov (United States)

    Reilly, Stephen M; Montuelle, Stephane J; Schmidt, André; Krause, Cornelia; Naylor, Emily; Essner, Richard L

    2016-03-01

    Ancestral frogs underwent anatomical shifts including elongation of the hindlimbs and pelvis and reduction of the tail and vertebral column that heralded the transition to jumping as a primary mode of locomotion. Jumping has been hypothesized to have evolved in a step-wise fashion with basal frogs taking-off with synchronous hindlimb extension and crash-landing on their bodies, and then their limbs move forward. Subsequently, frogs began to recycle the forelimbs forward earlier in the jump to control landing. Frogs with forelimb landing radiated into many forms, locomotor modes, habitats, and niches with controlled landing thought to improve escape behavior. While the biology of take-off behavior has seen considerable study, interspecific comparisons of take-off and landing behavior are limited. In order to understand the evolution of jumping and controlled landing in frogs, data are needed on the movements of the limbs and body across an array of taxa. Here, we present the first description and comparison of kinematics of the hindlimbs, forelimbs and body during take-off and landing in relation to ground reaction forces in four frog species spanning the frog phylogeny. The goal of this study is to understand what interspecific differences reveal about the evolution of take-off and controlled landing in frogs. We provide the first comparative description of the entire process of jumping in frogs. Statistical comparisons identify both homologous behaviors and significant differences among species that are used to map patterns of trait evolution and generate hypotheses regarding the functional evolution of take-off and landing in frogs.

  2. Behavioral Responses of Northern Leopard Frogs (Rana pipiens to Roads and Traffic: Implications for Population Persistence

    Directory of Open Access Journals (Sweden)

    Julie Bouchard

    2009-12-01

    Full Text Available A key goal in road ecology is to determine which species are most vulnerable to the negative effects of roads on population persistence. Theory suggests that species that avoid roads are less likely to be negatively affected by roads than those that do not avoid roads. The goal of this study was to take a step toward testing this prediction by evaluating the behavioral response to roads and traffic of a species whose populations are known to be negatively affected by roads and traffic, the northern leopard frog (Rana pipiens. We studied the movement patterns of northern leopard frogs during their spring migration from overwintering sites in a river to various breeding ponds that were disconnected from the river by roads. We performed short-distance translocations of migrating frogs, followed them visually, and documented their movement coordinates following each hop, both near the roads and in non-roaded areas. We found that frogs took longer to move near roads with more traffic and that their movement was quickest in areas without roads nearby. Frogs tended to deviate more from a straight-line course when they were released near roads than compared with control areas, but this response was independent of traffic volume. All frogs released near roads attempted to cross the road. On very low traffic roads (10.86 mean vehicles per hour, 94% of frogs crossed the road successfully, whereas at higher traffic roads (58.29 mean vehicles per hour 72% were successful. Our results suggest that frog's inability to avoid going onto roads and their slow movement combine to make them particularly vulnerable to road mortality, which likely explains the strong negative effects of roads on frog population abundance. Conservation efforts should focus on preventing frogs from accessing the road surface through the use of drift fencing and culverts.

  3. START TO PLAY TENNIS LIKE INCETIVE TO DEVELOPMENT SPORTS IN MONTENEGRO

    Directory of Open Access Journals (Sweden)

    Dimitrije Rašović

    2006-06-01

    Full Text Available At the end of 19 centuries tenis like popular game has srarted to play in Vojvodina. At 1880 tennis grassy courts was built in Senta and from that year it started to play in Vojvodina. Austrohungarion officers propageted tennis who were built tennis courts in their barracks but they was built courts in city parks. At 1892 the first tennis competition organised which mean that the first clubs probably had establishment befor thet year. Later at 1894 tennis started to play at palace of greand duke Nikola in Cetinje. Later tennis started to play in srbia at 1900. At that year people organised the first tennis tournament in vrsac. Momcilo Tapavica the first sout slovenion who was montegrion descent who was participat at first modern olimpic’s games in atina at 1896 he gave great countrabucsion developeted tennis sport in Montenegro. Momcilo Tapavica come to palase of graund duke’s Nikola at 1902 and ofter thet date his all family moved to Herceg-Novi and they spent all time to secound world war. At first olimpic’s games Momcilo Tapavica took parr in these sports/tennis, life weights, wrestling. Certain thet like talented sportman he gave great contabution not only in tennis than he gave contribution in the other sports in Montenegro.

  4. Which frog's legs do froggies eat? The use of DNA barcoding for identification of deep frozen frog legs (Dicroglossidae, Amphibia commercialized in France

    Directory of Open Access Journals (Sweden)

    Annemarie Ohler

    2017-02-01

    Full Text Available Several millions frogs captured in the wild in Indonesia are sold for food yearly in French supermarkets, as deep frozen frog legs. They are commercialized as Rana macrodon, but up to 15 look-alike species might also be concerned by this trade. From December 2012 to May 2013, we bought 209 specimens of deep frozen frog legs, and identified them through a barcoding approach based on the 16S gene. Our results show that 206 out of the 209 specimens belong to Fejervarya cancrivora, two to Limnonectes macrodon and one to F. moodiei. Thus only 0.96 % of the frogs were correctly identified. Unless misclassification was intentional, it seems that Indonesian frog leg exporters are not able to discriminate between the species. The quasi absence of L. macrodon in our samples might be an indication of its rarity, confirming that its natural populations are declining rapidly, in agreement with its “vulnerable” status according to the IUCN Red List. Our results show that the genetic and morphological diversity of the frogs in trade is much higher than the genetic and morphological diversity measured so far by scientific studies. These results underline the need for large scale studies to assess the status of wild populations.

  5. 论莫言小说《蛙》中的“蛙”意象%The Frog Image in the Novel Frog by Mo Yan

    Institute of Scientific and Technical Information of China (English)

    蒋卉

    2012-01-01

    从远古神话到到当代小说,从考古、民俗到文学想象,“蛙”意象的产生与发展经历了一个漫长而富有变化的过程。文章结合文学人类学的理论对莫言长篇小说《蛙》中的“蛙”意象进行深度分析,追溯到“蛙”原型中的“蛙女神”,将其与小说中突出的人物“姑姑”进行对比,揭示这一原型意象的运用对小说文化蕴涵的提升作用。%The image of frog has a long history since its creation and differs quite well in different texts like ancient mythology,contemporary novels,archeology,folklore and literary i- maginations. This paper analyzes the image of frog from the perspective of literary anthropolo- gy in the novel Frog by Mo Yan. A comparative, study of the protagonist,the aunt of the nar- rator in the novel,and the frog goddess,the prototype frog, will be conducted,which indicates that the archetypal image of frog helps to enrich cultural connotations of the novel.

  6. Artificial wetlands as tools for frog conservation: stability and variability of reproduction characteristics in Sahara frog populations in Tunisian man-made lakes.

    Science.gov (United States)

    Bellakhal, Meher; Neveu, André; Fertouna-Bellakhal, Mouna; Aleya, Lotfi

    2017-09-27

    Amphibian populations are in decline principally due to climate change, environmental contaminants, and the reduction in wetlands. Even though data concerning current population trends are scarce, artificial wetlands appear to play a vital role in amphibian conservation. This study concerns the reproductive biology of the Sahara frog over a 2-year period in four Tunisian man-made lakes. Each month, gonad state (parameters: K, GSI, LCI), fecundity, and fertility of females (using 1227 clutches) were evaluated in the field under controlled conditions. Clutches were present for 110-130 days at two of the sites, but only for 60-80 days at the other two. Maximum egg laying occurred in May, corresponding to the highest point in the gonad somatic index. Clutch densities were higher in the smaller lakes. Female fecundity was in relation to body size; mean clutch fecundity attained 1416 eggs, with no differences observed according to site. Egg fertility varied over a 1-year period, with a maximum in May followed by a decrease when water temperature was at its highest. Eggs were smaller at the beginning of spawning; maximum size was in May, which might explain the higher fertility, but no maternal influence was detected. Embryonic development was strictly dependent on temperature. The population at each site appeared as a small patch within a metapopulation in overall good health, as shown by the relative temporal stability in reproduction variables. Constructed wetlands may therefore play an important role in the conservation of amphibians, especially in semi-arid zones.

  7. Surveys for presence of Oregon spotted frog (Rana pretiosa): background information and field methods

    Science.gov (United States)

    Pearl, Christopher A.; Clayton, David; Turner, Lauri

    2010-01-01

    The Oregon spotted frog (Rana pretiosa) is the most aquatic of the native frogs in the Pacific Northwest. The common name derives from the pattern of black, ragged-edged spots set against a brown or red ground color on the dorsum of adult frogs. Oregon spotted frogs are generally associated with wetland complexes that have several aquatic habitat types and sizeable coverage of emergent vegetation. Like other ranid frogs native to the Northwest, Oregon spotted frogs breed in spring, larvae transform in summer of their breeding year, and adults tend to be relatively short lived (3-5 yrs). Each life stage (egg, tadpole, juvenile and adult) has characteristics that present challenges for detection. Breeding can be explosive and completed within 1-2 weeks. Egg masses are laid in aggregations, often in a few locations in large areas of potential habitat. Egg masses can develop, hatch, and disintegrate in <2 weeks during warm weather. Tadpoles can be difficult to identify, have low survival, and spend most of their 3-4 months hidden in vegetation or flocculant substrates. Juveniles and adults are often difficult to capture and can spend summers away from breeding areas. Moreover, a substantial portion of extant populations are of limited size (<100 breeding adults), and field densities of all life stages are often low. An understanding of the biology of the species and use of multiple visits are thus important for assessing presence of Oregon spotted frogs. This report is meant to be a resource for USDA Region 6 Forest Service (FS) and OR/WA Bureau of Land Management (BLM) personnel tasked with surveying for the presence of Oregon spotted frogs. Our objective was to summarize information to improve the efficiency of field surveys and increase chances of detection if frogs are present. We include overviews of historical and extant ranges of Oregon spotted frog. We briefly summarize what is known of Oregon spotted frog habitat associations and review aspects of behavior and

  8. Accessory pathway for sound transfer in a neotropical frog.

    OpenAIRE

    1988-01-01

    A portion of the lateral body wall overlying the lung cavity of the arboreal frog, Eleutherodactylus coqui, vibrates in response to free-field sound. Peak displacement amplitude of the body wall in response to a natural call note presented at 73 decibels sound pressure level is 1.70 X 10(-9) m, roughly 8 decibels less than that of the ipsilateral eardrum, as measured by laser Doppler vibrometry. We show that the vibration magnitude varies predictably across the body profile and is posture and...

  9. Taxonomy Icon Data: Western clawed frog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Western clawed frog Xenopus tropicalis Chordata/Vertebrata/Amphibia Xenopus_tropicalis_L.png Xenopus..._tropicalis_NL.png Xenopus_tropicalis_S.png Xenopus_tropicalis_NS.png http://biosciencedbc....jp/taxonomy_icon/icon.cgi?i=Xenopus+tropicalis&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+...tropicalis&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+tropical...is&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+tropicalis&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=137 ...

  10. Plasma membrane electron transport in frog blood vessels

    Indian Academy of Sciences (India)

    Rashmi P Rao; K Nalini; J Prakasa Rao

    2009-12-01

    In an attempt to see if frog blood vessels possess a plasma membrane electron transport system, the postcaval vein and aorta isolated from Rana tigrina were tested for their ability to reduce ferricyanide, methylene blue, and 2,6-dichloroindophenol. While the dyes remained unchanged, ferricyanide was reduced to ferrocyanide. This reduction was resistant to inhibition by cyanide and azide. Heptane extraction or formalin fixation of the tissues markedly reduced the capability to reduce ferricyanide. Denuded aortas retained only 30% of the activity of intact tissue. Our results indicate that the amphibian postcaval vein and aorta exhibit plasma membrane electron transport

  11. Periodic Solutions of a Model of Mitosis in Frog Eggs

    Institute of Scientific and Technical Information of China (English)

    Bei-ye Feng; Zuo-huan Zheng

    2002-01-01

    In this paper,we discuss a simplified model of mitosis in frog eggs proposed by M.T. Borisuk and J.J.Tyson in [1]. By using rigorous qualitative analysis, we prove the existence of the periodic solutions on a large scale and present the space region of the periodic solutions and the parameter region coresponding to the periodic solution. We also present the space region and the parameter region where there are no periodic solutions. The results are in accordance with the numerical results in [1] up to the qualitative property.

  12. Tactical reproductive parasitism via larval cannibalism in Peruvian poison frogs

    Science.gov (United States)

    Brown, Jason L.; Morales, Victor; Summers, Kyle

    2008-01-01

    We report an unusual example of reproductive parasitism in amphibians. Dendrobates variabilis, an Amazonian poison frog, oviposits at the surface of the water in small pools in plants and deposits tadpoles within the pools. Tadpoles are highly cannibalistic and consume young tadpoles if they are accessible. Deposition of embryos and tadpoles in the same pool is common. Genetic analyses indicate that tadpoles are frequently unrelated to embryos in the same pool. A pool choice experiment in the field demonstrated that males carrying tadpoles prefer to place them in pools with embryos, facilitating reproductive parasitism via cannibalism. PMID:19042178

  13. Taxonomy Icon Data: Japanese tree frog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Japanese tree frog Hyla japonica Chordata/Vertebrata/Amphibia Hyla_japonica_L.png Hyla_jap...onica_NL.png Hyla_japonica_S.png Hyla_japonica_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+jap...onica&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+japonica&t=NL http://biosciencedbc....jp/taxonomy_icon/icon.cgi?i=Hyla+japonica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+jap

  14. Can play be defined?

    DEFF Research Database (Denmark)

    Eichberg, Henning

    2015-01-01

    Can play be defined? There is reason to raise critical questions about the established academic demand that at phenomenon – also in humanist studies – should first of all be defined, i.e. de-lineated and by neat lines limited to a “little box” that can be handled. The following chapter develops t....... Human beings can very well understand play – or whatever phenomenon in human life – without defining it........ The academic imperative of definition seems to be linked to the positivistic attempts – and produces sometimes monstrous definitions. Have they any philosophical value for our knowledge of what play is? Definition is not a universal instrument of knowledge-building, but a culturally specific construction...

  15. Playing and gaming

    DEFF Research Database (Denmark)

    Karoff, Helle Skovbjerg; Ejsing-Duun, Stine; Hanghøj, Thorkild

    2013-01-01

    The paper develops an approach of playing and gaming activities through the perspective of both activities as mood activities . The point of departure is that a game - is a tool with which we, through our practices, achieve different moods. This based on an empirical study of children's everyday...... lives, where the differences emerge through actual practices, i.e. through the creation of meaning in the specific situations. The overall argument is that it is not that important whether it is a playing or a gaming activity - it is however crucial to be aware of how moods occur and what their optimal...... dimensions: practices and moods. Practice is the concept of all the doing in the activities. Moods are the particular concept of sense and feeling of being, which is what we are drawn to when we are playing or gaming....

  16. Playing and gaming

    DEFF Research Database (Denmark)

    Karoff, Helle Skovbjerg; Ejsing-Duun, Stine; Hanghøj, Thorkild

    2013-01-01

    The paper develops an approach of playing and gaming activities through the perspective of both activities as mood activities . The point of departure is that a game - is a tool with which we, through our practices, achieve different moods. This based on an empirical study of children's everyday...... lives, where the differences emerge through actual practices, i.e. through the creation of meaning in the specific situations. The overall argument is that it is not that important whether it is a playing or a gaming activity - it is however crucial to be aware of how moods occur and what their optimal...... dimensions: practices and moods. Practice is the concept of all the doing in the activities. Moods are the particular concept of sense and feeling of being, which is what we are drawn to when we are playing or gaming....

  17. THE MONITORING AND ANALYSIS OF THE CHINESE TRADITIONAL ARCHITECTURE PAINTING DECAY – THE CASE OF JILAN PAVILION IN THE SUMMER PALACE

    Directory of Open Access Journals (Sweden)

    L. Zhan

    2017-08-01

    Full Text Available The painting is one of the most decorative elements of ancient Chinese architecture and it is sensitive to the natural environment. The outdoor painting is very easily to be affected by the natural environment and its color is easily to decay. In order to study the relationship between the painting decay and the physical environment, the two paintings on both east and west inner eaves of Jilan Pavilion beside the Kunming Lake in Summer Palace are taken as the research objects, because these two paintings are painted at the same period but their decay degrees are greatly different. Since 2013, the research group regularly monitors the color decay of these two paintings. Meanwhile, the physical environment around these two paintings has been monitored. Based on the analysis of the monitor data, it can be seen that the illumination is the major factor that causes the decay of the painting. Meanwhile, by using the ECOTECT software to stimulate the light environment around the Jilan Pavilion, it can be seen that it is the mirror reflection of the lake that causes the result that the illumination of the west eave (face east is stronger than that of the east eave (face west.

  18. Influence of CO2 change during 90-day experiment on growth characteristics and photosynthetic activity in vegetables grown in Lunar Palace 1

    Science.gov (United States)

    Shao, Lingzhi; Liu, Hong; Wang, Minjuan; Fu, Yuming; Dong, Chen; Liu, Guanghui

    To establish bioregenerative life support system (BLSS) on lunar or Mars bases in the future, it is necessary to firstly conduct manned simulation experiments on the ground. For this purpose, Lunar palace 1 as an integrative experimental facility for permanent astrobase life support artificial closed ecosystem was set up, and 90-day experiment was carried out in this system. Vegtables as one of the important plant units, provide various nutrient content for crews in the system, such as vitamin, antioxidants and so on. However, it is not clear yet that how the CO _{2} change during 90-day experiment to affect on growth characteristics and photosynthetic activity in vegtables grown in the system. In this study, red lettuce, red rape, romaine lettuce, and bibb lettuce grown in the system were chosen as the subject investigated. Growth, expressed as dry weight, length of shoot and root, leaf area, was mearsured, and photosynthesis,expressed as net photosynthetic rate, intercellular CO _{2} concentration, chlorophyll contents and fluorescence was analyzed to detemind influence of CO _{2} change during 90-day experiment on growth in vegtables grown in the system.

  19. 凯里民族文化宫消防设计探讨%Discussion on the fire protection design of the Kaili Culture Palace of Nationalities

    Institute of Scientific and Technical Information of China (English)

    郑锦; 傅勤勇; 张建平

    2012-01-01

    The layout of general plan and function division of the Kaili Cultural Palace of Nationalities in Guizhou province were introduced. The fire safety design difficulties, content parameters and measures to be taken of the fire protection driveway, fire compartment, safe evacuation, sprinkler system, facilities of smoke-prevention and smoke-exhaustion were analyzed in details. The surround fire protection driveway and operating site, the theatre's fire compartment, wet automatic sprinkler system, air-conditioning system and other aspects problems and their solutions were discussed.%介绍贵州省凯里民族文化宫的总平面布局、功能划分等基本情况.详细分析该工程的消防车道、防火分区、安全疏散、自动灭火系统、防排烟系统等方面的消防设计难点、内容参数及采取的措施,并对设计中在环形消防车道和登高车操作场地、剧院区的防火分区、自动喷水灭火系统、空调系统方面遇到的问题及其解决办法进行了探讨.

  20. Determinism and Gender in Galsworthy’s The Man of Property and Naguib Mahfouz’s Palace Walk A Naturalistic Approach

    Directory of Open Access Journals (Sweden)

    Abdulfattah Omar

    2016-11-01

    Full Text Available This article is concerned with analysing the concepts of determinism and gender in John Galsworthy’s The Man of Property and Naguib Mahfouz’s Palace Walk from a naturalistic point of view. Determinism is one of the important characteristics of literary naturalism developed by Emile Zola, an eminent French writer, in the second half of the nineteenth century. Analysis indicates that pessimistic determinism, a typical feature of literary naturalism, is represented in the two texts along with other naturalistic features such as conflict, frankness about sexual problems, and objectivity. Analysis also shows that both John Galsworthy and Naguib Mahfouz gave much space in the two novels for women and their problems. Both adopted a naturalist deterministic view of the concept of gender. They used naturalist settings and practices as vehicles for symbolic meanings to convey thematic significance. The notions of determinism and free will as well as the related concepts of fate and nature are central questions in the two texts. The two authors also extend the notion of determinism to gender problems. In the two novels, we see that women are determined to suffer and submit to male dominance and tyranny. Although it is difficult to determine whether the two authors were progressive in adopting an explicit anti-patriarch stance, it can be claimed that Galsworthy and Mahfouz were concerned with introducing the social problems of the age including women problems in an objective way. Keywords: determinism- gender- naturalism- Emile Zola- feminist naturalism

  1. Kubad-abad Sarayında Bulunan Kemer ve Askı Tokaları Belt and Buckle Straps Found in Kubad-abad Palace

    Directory of Open Access Journals (Sweden)

    Alptekin YAVAŞ

    2012-09-01

    Full Text Available The Anatolian Seljuk Period is one of the underregognized periods of Turkish Art of Metal. Our knowledge concerning this period is limited to some objects, such as incense and candle holders made from percious metals. In this article, belts and hunger buckles are first promoted as wares of daily use in Medieval Turkish Period. The last 30 years-long excavations in Kubad-Abad Palace located in Beyşehir district of Konya, one of the best preserved palaces of the Anatolian Seljuk Period, made available to retrieve number of different objects asantiques giving insights into the Medieval times. Kubad-Abad is locatedon an alluvium plain on the south-western shores of Konya-BeyşehirLake, at the foot of the Anamas Mountain. It surrounds the Bronze Agemound. It is a large city-palace that stretches from the lake shore – evenfrom the islands in the lake – to the Anamas Mountain and holds tensof constructions. The metal findings of the palace famous with itsworldwide known tiles hold a very rich repertoire. The belts and hungerbuckles as poorly known finds provide solid evidence with regards torecognition of the wares of daily use in Seljuks. The nature of belt andbuckle straps pertain to the Medieval Turkish period has not beenattempted in detail so far. Among these, one-side written bordurehunger buckle is a rare object in the Anatolian Seljuk Period andpossibly belongs to sultan and his family circle. Anadolu Selçuklu dönemi, Türk Maden Sanatının en az bilinen dönemlerinden biridir. Bu döneme ilişkin veriler kıymetli metallerden yapılmış şamdan, buhurdan gibi objelerle sınırlıdır. Bu çalışmada Ortaçağ Türk Dönemi Kazıları arasında ilk kez gündelik kullanım eşyalarından kemer ve askı tokaları tanıtılacaktır. Anadolu Selçuklu döneminin günümüze en iyi durumda ulaşabilmiş saraylarından biri olan Konya-Beyşehir ilçesindeki Kubad-Abad Sarayında yaklaşık 30 yıldır süren kazı çalışmaları ile Orta

  2. Characterization of the glaze and in-glaze pigments of the nineteenth-century relief tiles from the Pena National Palace, Sintra, Portugal

    Science.gov (United States)

    Coutinho, M. L.; Veiga, J. P.; Alves, L. C.; Mirão, J.; Dias, L.; Lima, A. M.; Muralha, V. S.; Macedo, M. F.

    2016-07-01

    The glaze and in-glaze pigments of the historical nineteenth-century glazed tiles from the Pena National Palace (Sintra, Portugal) were characterized using a multi-analytical approach. Chemical composition and microstructural characterization were ascertained by µ-PIXE, µ-Raman, optical microscopy and VP-SEM-EDS. The manufacturing technique and colour palette in these tiles were found to be close to the ceramic pigments used in traditional majolica. The blue and purple colours derive from cobalt oxide and manganese oxide, respectively. A mixture of Pb-Sn-Sb yellow with cobalt oxide and iron oxide was used for green and dark yellow, respectively, while grey tonalities consist of a complex mixture of cobalt oxide, manganese oxide and Pb-Sn-Sb yellow in different proportions. Results obtained allowed the determination of the oxides and elements used in pigments as well as production techniques, resorting to traditional majolica manufacture, although the tiles were produced by the end of the nineteenth century.

  3. 从紫禁城到故宫博物院--一种媒介文化角度的审视%From the Forbidden City to the Palace Museum

    Institute of Scientific and Technical Information of China (English)

    程丽红; 程玥

    2014-01-01

    Buildings, an important carrier of civilization and culture, have media’s attributes and are con-veying the particular time-bound concept of media culture. The Palace Museum, a building group, is not only a roy-al palace or a museum with rich cultural relics, but a carrier of social mainstream culture. In changing times, it pre-sented different historic and cultural connotation from its ownership transfer. Proceeding from the need of imperi-al tyranny, the feudal Forbidden City served as a dispensable domicile and a place to run the government for the emperors of the Ming and Qing Dynasties. Meanwhile, it, as a media, was endowed with special cultural mission that symbolized the great political unification and represented the imperial culture. It was constructing the main-stream cultural system of the feudal society in the form of media culture. when the Chinese Republic was establish-ing, the Palace Museum was set up. The Palace Museum became the main power to shape democratic culture. The Palace Museum evolved from imperial palace into public museum. The construction of the Palace Museum is long and winding, which reflects the hardship of democratic revolutions and democratic ideals much more profoundly.%建筑物作为一种重要的文明与文化载体,具有媒介的属性,传达着特定时代的媒介文化观念。故宫建筑群不单是一座皇家宫殿,一家文物藏量丰富的博物馆,它同时是社会主流文化的载体,在时代变迁中追随着所有权的转换而呈现不同的历史文化内涵,透露出不同的媒介文化信息。封建时代的紫禁城在为明清帝王提供必要的居住与临政场所的同时,也作为媒介,被赋予了特殊的文化使命,以媒介文化的形式,建构着封建社会的主流文化体系。民国建立,故宫博物院创建,其所蕴含的媒介文化性质、功能亦为之一变,成为建构民主文化的重要力量。而故宫博物院建院过程的漫长

  4. General game playing

    CERN Document Server

    Genesereth, Michael

    2014-01-01

    General game players are computer systems able to play strategy games based solely on formal game descriptions supplied at ""runtime"" (n other words, they don't know the rules until the game starts). Unlike specialized game players, such as Deep Blue, general game players cannot rely on algorithms designed in advance for specific games; they must discover such algorithms themselves. General game playing expertise depends on intelligence on the part of the game player and not just intelligence of the programmer of the game player.GGP is an interesting application in its own right. It is intell

  5. Playful Collaboration (or Not)

    DEFF Research Database (Denmark)

    Bogers, Marcel; Sproedt, Henrik

    2011-01-01

    also be conducive to deep learning. As such, a game can engage different dimensions of learning and embed elements of active, collaborative, cooperative and problem-based learning. Building on this logic, we present an exploratory case study of the use of a particular board game in a class of a course......This paper explores how games and play, which are deeply rooted in human beings as a way to learn and interact, can be used to teach certain concepts and practices related to open collaborative innovation. We discuss how playing games can be a source of creativity, imagination and fun, while it can...

  6. Five recent play dates

    DEFF Research Database (Denmark)

    Abildgaard, Mette Simonsen; Birkbak, Andreas; Jensen, Torben Elgaard

    2017-01-01

    An advantage of the playground metaphor is that it comes with the activity of going out on ‘play dates’ and developing friendships. In such playful relationships, there is always something at stake, but the interaction is also fun and inherently exploratory. In the following, we take a tour of five...... recent collaborative projects that the TANTlab has participated in. The projects differ widely and testify to different experiences with collaboration and intervention – from a data print on obesity with other researchers to a Facebook-driven intervention in Aalborg municipality’s primary school reform...

  7. Evolutionary and natural history of the turtle frog, Myobatrachus gouldii, a bizarre myobatrachid frog in the southwestern Australian biodiversity hotspot.

    Science.gov (United States)

    Vertucci, Samantha; Pepper, Mitzy; Edwards, Danielle L; Roberts, J Dale; Mitchell, Nicola; Keogh, J Scott

    2017-01-01

    Southwest Australia (SWA) is a global biodiversity hotspot and a centre of diversity and endemism for the Australo-Papuan myobatrachid frogs. Myobatrachus gouldii (the turtle frog) has a highly derived morphology associated with its forward burrowing behaviour, largely subterranean habit, and unusual mode of reproduction. Its sister genera Metacrinia and Arenophryne have restricted distributions in Western Australia with significant phylogeographic structure, leading to the recent description of a new species in the latter. In contrast, Myobatrachus is distributed widely throughout SWA over multiple climatic zones, but little is known of its population structure, geographic variation in morphology, or reproduction. We generated molecular and morphological data to test for genetic and morphological variation, and to assess whether substrate specialisation in this species may have led to phylogeographic structuring similar to that of other plant and animal taxa in SWA. We assembled sequence data for one mitochondrial and four nuclear DNA loci (3628 base pairs) for 42 turtle frogs sampled throughout their range. Likelihood phylogenetic analyses revealed shallow phylogeographic structure in the mtDNA locus (up to 3.3% genetic distance) and little variation in three of the four nDNA loci. The mtDNA haplotype network suggests five geographically allopatric groups, with no shared haplotypes between regions. These geographic patterns are congruent with several other SWA species, with genetic groups restricted to major hydrological divisions, the Swan Coastal Plain, and the Darling Scarp. The geographically structured genetic groups showed no evidence of significant morphological differentiation (242 individuals), and there was little sexual size dimorphism, but subtle differences in reproductive traits suggest more opportunistic breeding in lower rainfall zones. Call data were compared to sister genera Metacrinia and Arenophryne and found to be highly conservative across

  8. Chasing maximal performance: a cautionary tale from the celebrated jumping frogs of Calaveras County.

    Science.gov (United States)

    Astley, H C; Abbott, E M; Azizi, E; Marsh, R L; Roberts, T J

    2013-11-01

    Maximal performance is an essential metric for understanding many aspects of an organism's biology, but it can be difficult to determine because a measured maximum may reflect only a peak level of effort, not a physiological limit. We used a unique opportunity provided by a frog jumping contest to evaluate the validity of existing laboratory estimates of maximum jumping performance in bullfrogs (Rana catesbeiana). We recorded video of 3124 bullfrog jumps over the course of the 4-day contest at the Calaveras County Jumping Frog Jubilee, and determined jump distance from these images and a calibration of the jump arena. Frogs were divided into two groups: 'rental' frogs collected by fair organizers and jumped by the general public, and frogs collected and jumped by experienced, 'professional' teams. A total of 58% of recorded jumps surpassed the maximum jump distance in the literature (1.295 m), and the longest jump was 2.2 m. Compared with rental frogs, professionally jumped frogs jumped farther, and the distribution of jump distances for this group was skewed towards long jumps. Calculated muscular work, historical records and the skewed distribution of jump distances all suggest that the longest jumps represent the true performance limit for this species. Using resampling, we estimated the probability of observing a given jump distance for various sample sizes, showing that large sample sizes are required to detect rare maximal jumps. These results show the importance of sample size, animal motivation and physiological conditions for accurate maximal performance estimates.

  9. Prevalence of malformed frogs in Kaoping and Tungkang river basins of southern Taiwan.

    Science.gov (United States)

    Huang, Da-Ji; Chiu, Yuh-Wen; Chen, Chien-Min; Huang, Kai-Hsiang; Wang, Shu-Yin

    2010-05-01

    In this study we found many amphibians with bizarre appearances, known as malformations in Pingtung County southern Taiwan. For this investigation we collected frogs inhabiting the Kaoping and Tungkang river watersheds between February 2006 and June 2007. Among the total number of 10,909 normal frogs (i.e., anurans) collected during the investigation period, the Indian rice frogs (Rana limnocharis) account for the greatest number next is the Chinese bullfrog (Rana rugulosa). Of all the 244 captured malformed frogs, the Indian rice frog account for the greatest proportion. These malformed frogs have their main distribution in upstream areas of these two rivers. Our result indicates that the appearance rate of malformed frogs is 1.8% in the upstream reaches of the Kaoping River and 2.6%, and 0.8%, respectively in the upstream and midstream reaches of the Tungkang river. The most-commonly-found malformation is the lack of palms, followed by the lack of appendages, exostosis, and a malformed appendicular. It is, therefore, reasonable to speculate that the causes for the malformation may be related to the increased organic pollutants and agricultural chemicals used in the upstream reaches of these two rivers.

  10. Landing in basal frogs: evidence of saltational patterns in the evolution of anuran locomotion

    Science.gov (United States)

    Essner, Richard L.; Suffian, Daniel J.; Bishop, Phillip J.; Reilly, Stephen M.

    2010-10-01

    All frogs are assumed to jump in a similar manner by rapidly extending hindlimbs during the propulsive phase and rotating the limbs forward during flight in order to land forelimbs first. However, studies of jumping behavior are lacking in the most primitive living frogs of the family Leiopelmatidae. These semi-aquatic or terrestrial anurans retain a suite of plesiomorphic morphological features and are unique in using an asynchronous (trot-like) rather than synchronous “frog-kick” swimming gait of other frogs. We compared jumping behavior in leiopelmatids to more derived frogs and found that leiopelmatids maintain extended hindlimbs throughout flight and landing phases and do not land on adducted forelimbs. These “belly-flop” landings limit the ability for repeated jumps and are consistent with a riparian origin of jumping in frogs. The unique behavior of leiopelmatids shows that frogs evolved jumping before they perfected landing. Moreover, an inability to rapidly cycle the limbs may provide a functional explanation for the absence of synchronous swimming in leiopelmatids.

  11. Poison frogs rely on experience to find the way home in the rainforest.

    Science.gov (United States)

    Pašukonis, Andrius; Warrington, Ian; Ringler, Max; Hödl, Walter

    2014-11-01

    Among vertebrates, comparable spatial learning abilities have been found in birds, mammals, turtles and fishes, but virtually nothing is known about such abilities in amphibians. Overall, amphibians are the most sedentary vertebrates, but poison frogs (Dendrobatidae) routinely shuttle tadpoles from terrestrial territories to dispersed aquatic deposition sites. We hypothesize that dendrobatid frogs rely on learning for flexible navigation. We tested the role of experience with the local cues for poison frog way-finding by (i) experimentally displacing territorial males of Allobates femoralis over several hundred metres, (ii) using a harmonic direction finder with miniature transponders to track these small frogs, and (iii) using a natural river barrier to separate the translocated frogs from any familiar landmarks. We found that homeward orientation was disrupted by the translocation to the unfamiliar area but frogs translocated over similar distances in their local area showed significant homeward orientation and returned to their territories via a direct path. We suggest that poison frogs rely on spatial learning for way-finding in their local area.

  12. Pathological Study of Blood Parasites in Rice Field Frogs, Hoplobatrachus rugulosus (Wiegmann, 1834

    Directory of Open Access Journals (Sweden)

    Achariya Sailasuta

    2011-01-01

    Full Text Available One hundred and forty adult rice field frogs, Hoplobatrachus rugulosus (Wiegmann, 1834, were collected in Srakaew province, Thailand. For blood parasite examination, thin blood smears were made and routinely stained with Giemsa. The results showed that 70% of the frogs (98/140 were infected with 5 species of blood parasites, including a Trypanosoma rotatorium-like organism, Trypanosoma chattoni, Hepatozoon sp. a, Hepatozoon sp. b, and Lankesterella minima. Pathological examination of the liver, lung, spleen, and kidney of the frogs that were apparently infected with one of these blood parasites were collected and processed by routine histology and subsequently stained with haematoxylin and eosin. Histopathological findings associated with the Trypanosoma rotatorium-like organism and Trypanosoma chattoni-infected frogs showed no pathological lesions. Hepatozoon sp. a and Hepatozoon sp. b-infected frogs developed inflammatory lesions predominantly in the liver, demonstrating granuloma-like lesions with Hepatozoon sp. meronts at the centre. Tissue sections of Lankesterella minima-infected frogs also showed lesions. Liver and spleen showed inflammatory lesions with an accumulation of melanomacrophage centres (MMCs surrounding the meronts and merozoites. It is suggested that Hepatozoon sp. a, Hepatozoon sp. b, and Lankesterella minima-infections are capable of producing inflammatory lesions in the visceral organs of rice field frogs, and the severity of lesions is tentatively related to levels of parasitemia.

  13. The Activity of Play

    DEFF Research Database (Denmark)

    Pichlmair, Martin

    2016-01-01

    This paper presents Activity Theory as a framework for understanding the action of playing games with the intention of building a foundation for the creation of new game design tools and methods. Activity Theory, an epistemological framework rooted in Soviet psychology of the first half of the 20...

  14. Playing the Role

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The G20 London summit made history. While applauding the summit’s productive communique, Ni Xiaoling, senior financial observer with Xinhua News Agency, warns of the gap between the greater responsibilities the International Monetary Fund shoulders and its limited capabilities to play the role of coordinator in economic globalization.

  15. Abstraction through Game Play

    Science.gov (United States)

    Avraamidou, Antri; Monaghan, John; Walker, Aisha

    2012-01-01

    This paper examines the computer game play of an 11-year-old boy. In the course of building a virtual house he developed and used, without assistance, an artefact and an accompanying strategy to ensure that his house was symmetric. We argue that the creation and use of this artefact-strategy is a mathematical abstraction. The discussion…

  16. Mobilities at Play

    DEFF Research Database (Denmark)

    Ungruhe, Christian

    2017-01-01

    -level perspective there is still an analytical gap between the ambitions and experiences of migrating players and economic power relations at play on the one hand and the socio-cultural embedding of the transnational connections in football migration on the other. In order to understand why and how football...

  17. Play's Importance in School

    Science.gov (United States)

    Sandberg, Anette; Heden, Rebecca

    2011-01-01

    The purpose of this study is to contribute knowledge on and gain an understanding of elementary school teachers' perspectives on the function of play in children's learning processes. The study is qualitative with a hermeneutical approach and has George Herbert Mead as a theoretical frame of reference. Interviews have been carried out with seven…

  18. Play framework essentials

    CERN Document Server

    Richard-Foy, Julien

    2014-01-01

    This book targets Java and Scala developers who already have some experience in web development and who want to master Play framework quickly and efficiently. This book assumes you have a good level of knowledge and understanding of efficient Java and Scala code.

  19. A Significant Play

    Institute of Scientific and Technical Information of China (English)

    梁海光; 陈明

    2002-01-01

    Yesterday evening, I went to see a play. It was really significant. It was about Zheng Xiaoyue, a very clever and diligent middle school student. Unfortunately, her mother died when she and her brother were very young. Her father was out of work and,

  20. Embryo Development of Tree Frog Polypedates leucomystax at Campus of State University of Malang

    Directory of Open Access Journals (Sweden)

    Pearlindah

    2012-12-01

    Full Text Available Tree frogs live in natural places which are unpolluted. Regarding their role as an ecological indicator, the decrease of frogs population in a particular habitat indicates the danger of environment quality decrease. Moreover, this condition can harm the frogs themselves. All kinds of frogs breed in aqueous environment such as ponds, marshes, and farming fields. One of the tree frogs, Polypedates leucomystax, which belongs to Familia Rachophoridae, is widely spread in Indonesia. This frog has yellowish brown skin with black spots or six lines extending from head to the posterior tip of body. A breeding couple of the frog produces foam nests on the water or plants around water body, where they will nest their fertilized eggs. This species produces over a hundred embryos in one spawning season. These embryos require appropriate conditions to develop normally in the nature. Frog embryo development may becomes a reference to understand how the frog population survives. This study focused on P. leucomystax with regards to its decrease in number due to the drying up of the environment and a lot lost of trees in Campus of State University of Malang. The development of P. leucomystax embryos in the reproduction foam was observed until it reached a tadpole stage. The result showed that the embryos developed in the foam until they hatched then they move out of the foam into the water under which they would continue their development. Considering that water body is a critical requirement for the development of P. leucomystax embryos, it is our responsibility to make any efforts to conserve not only the trees but also any type of water bodies including ponds, marshes, and farming fields as well.

  1. The genetic structure of a relict population of wood frogs

    Science.gov (United States)

    Scherer, Rick; Muths, Erin; Noon, Barry; Oyler-McCance, Sara

    2012-01-01

    Habitat fragmentation and the associated reduction in connectivity between habitat patches are commonly cited causes of genetic differentiation and reduced genetic variation in animal populations. We used eight microsatellite markers to investigate genetic structure and levels of genetic diversity in a relict population of wood frogs (Lithobates sylvatica) in Rocky Mountain National Park, Colorado, where recent disturbances have altered hydrologic processes and fragmented amphibian habitat. We also estimated migration rates among subpopulations, tested for a pattern of isolation-by-distance, and looked for evidence of a recent population bottleneck. The results from the clustering algorithm in Program STRUCTURE indicated the population is partitioned into two genetic clusters (subpopulations), and this result was further supported by factorial component analysis. In addition, an estimate of FST (FST = 0.0675, P value \\0.0001) supported the genetic differentiation of the two clusters. Estimates of migration rates among the two subpopulations were low, as were estimates of genetic variability. Conservation of the population of wood frogs may be improved by increasing the spatial distribution of the population and improving gene flow between the subpopulations. Construction or restoration of wetlands in the landscape between the clusters has the potential to address each of these objectives.

  2. New genus of diminutive microhylid frogs from Papua New Guinea

    Directory of Open Access Journals (Sweden)

    Fred Kraus

    2010-06-01

    Full Text Available A new genus of diminutive (10.1-11.3 mm microhylid frogs is described from New Guinea that is unique in its combination ofonly seven presacral vertebrae, a reduced phalangeal formula that leaves the first fingers and first toes as vestigial nubs, and reduction of the prepollex and prehallux to single elements. Relationships to other genera are unknown, but overall similarity suggests some relationship to Cophixalus, although that genus also differs in some muscle characters and likely remains paraphyletic. The new genus contains two species, which are among the smallest known frogs in the world. Their miniaturization may be related to their inhabiting leaf litter, exploitation of which may for small size. The new genus is currently known only from one mountaintop in the southeasternmost portion of New Guinea and another on a nearby island. This region is part of the East Papuan Composite Terrane and, should this lineage prove endemic to that region, it may suggest that it originated prior to that geological unit’s docking with mainland New Guinea at 23–29 MY.

  3. Evolution of advertisement calls in African clawed frogs

    Science.gov (United States)

    Tobias, Martha L.; Evans, Ben J.; Kelley, Darcy B.

    2014-01-01

    Summary For most frogs, advertisement calls are essential for reproductive success, conveying information on species identity, male quality, sexual state and location. While the evolutionary divergence of call characters has been examined in a number of species, the relative impacts of genetic drift or natural and sexual selection remain unclear. Insights into the evolutionary trajectory of vocal signals can be gained by examining how advertisement calls vary in a phylogenetic context. Evolution by genetic drift would be supported if more closely related species express more similar songs. Conversely, a poor correlation between evolutionary history and song expression would suggest evolution shaped by natural or sexual selection. Here, we measure seven song characters in 20 described and two undescribed species of African clawed frogs (genera Xenopus and Silurana) and four populations of X. laevis. We identify three call types — click, burst and trill — that can be distinguished by click number, call rate and intensity modulation. A fourth type is biphasic, consisting of two of the above. Call types vary in complexity from the simplest, a click, to the most complex, a biphasic call. Maximum parsimony analysis of variation in call type suggests that the ancestral type was of intermediate complexity. Each call type evolved independently more than once and call type is typically not shared by closely related species. These results indicate that call type is homoplasious and has low phylogenetic signal. We conclude that the evolution of call type is not due to genetic drift, but is under selective pressure. PMID:24723737

  4. Possible postsynaptic action of aminoglycosides in the frog rectus abdominis.

    Directory of Open Access Journals (Sweden)

    Karataş Y

    2000-04-01

    Full Text Available The present study was undertaken to investigate the postsynaptic effects of aminoglycosides on contractions evoked by acetylcholine (ACh, KCl, electrical field stimulation (EFS and Na(+- and Ca(2+-free Ringer solution with 0.2 mM Na2 EDTA (NaFCaFR in the isolated frog rectus abdominis. Neomycin inhibited contraction elicited by ACh, NaFCaFR, and EFS at the higher frequencies (8 and 10 Hz but not those elicited by KCl and EFS at the lower frequencies (2, 3 and 5 Hz. D-tubocurarine inhibited ACh-induced contractions in a concentration-dependent manner. In addition, drug reduced EFS-evoked contractions to a limited extent. Lower concentrations (10(-5, 5 x 10(-5, 10(-4, 2 x 10(-4 and 3 x 10(-4 M but not higher concentrations (4 x 10(-4 and 5 x 10(-4 M of methoxyverapamil exhibited a concentration-dependent inhibitory action on NaFCaFR-induced contractions. Similar inhibitions of the same type of contraction were displayed by aminoglycosides (neomycin, streptomycin, netilmycin, gentamycin and amikacin. These results suggest that in addition to their antagonistic action on nicotinic receptors in the frog rectus abdominis, aminoglycosides may exert stabilizing effects on some functional components contributing to contractions at the membrane.

  5. Octylphenol induced gene expression in testes of Frog, Rana chensinensis.

    Science.gov (United States)

    Li, Xinyi; Liu, Jia; Zhang, Yuhui

    2016-06-01

    Octylphenol (OP) is an endocrine-disrupting chemical (EDC), which can disrupt the reproductive system. To understand the effect of OP, a subtractive cDNA library was constructed using suppression subtractive hybridization (SSH) to identify alterations of gene transcription in the testes of the frog Rana chensinensis after OP exposure. Two hundred positive clones were selected and 134 sequences of gene fragments were produced from the subtractive library randomly. These genes were identified to be involved in metabolic process, cellular process, biological regulation, stimulus, immune system and female pregnancy process. In order to verify the efficiency of the subtractive cDNA library, PSG9 and PAPP-A were analyzed further as two representatives of differentially expressed transcription genes using semi-quantitative RT-PCR. Our result was the first successful construction of the subtractive cDNA library in frog testes after OP treatment. Based on this cDNA library, OP was shown to affect multiple physiological processes including inducing immune response, disrupting the steroid hormone synthesis and influencing spermatogenesis in the testis by up-regulation of specific genes.

  6. Evolution of advertisement calls in African clawed frogs.

    Science.gov (United States)

    Tobias, Martha L; Evans, Ben J; Kelley, Darcy B

    2011-01-01

    For most frogs, advertisement calls are essential for reproductive success, conveying information on species identity, male quality, sexual state and location. While the evolutionary divergence of call characters has been examined in a number of species, the relative impacts of genetic drift or natural and sexual selection remain unclear. Insights into the evolutionary trajectory of vocal signals can be gained by examining how advertisement calls vary in a phylogenetic context. Evolution by genetic drift would be supported if more closely related species express more similar songs. Conversely, a poor correlation between evolutionary history and song expression would suggest evolution shaped by natural or sexual selection. Here, we measure seven song characters in 20 described and two undescribed species of African clawed frogs (genera Xenopus and Silurana) and four populations of X. laevis. We identify three call types - click, burst and trill - that can be distinguished by click number, call rate and intensity modulation. A fourth type is biphasic, consisting of two of the above. Call types vary in complexity from the simplest, a click, to the most complex, a biphasic call. Maximum parsimony analysis of variation in call type suggests that the ancestral type was of intermediate complexity. Each call type evolved independently more than once and call type is typically not shared by closely related species. These results indicate that call type is homoplasious and has low phylogenetic signal. We conclude that the evolution of call type is not due to genetic drift, but is under selective pressure.

  7. [Meiotic chromosomes of the tree frog Smilisca baudinii (Anura: Hylidae)].

    Science.gov (United States)

    Hernández-Guzmán, Javier; Arias-Rodriguez, Lenin; Indy, Jeane Rimber

    2011-03-01

    The Mexican tree frog Smilisca baudinii, is a very common frog in Central America. In spite their importance to keep the ecological equilibrium of the rainforest, its biology and genetics are poorly known. In order to contribute with its biological knowledge, we described the typical meiotic karyotype based in standard cytogenetic protocols to specimens collected in Tabasco, Mexico. The study was centered in the analysis of 131 chromosome spreads at meiotic stage from two adults of the species (one female and one male). The metaphase analysis allowed the establishment of the modal haploid number of 1n = 12 bivalent chromosomes. The chromosomic formulae from the haploid bivalent karyotype was integrated by 12 biarmed chromosomes characterized by twelve pairs of metacentric-submetacentric (msm) chromosomes. The meiotic counting gives the idea that diploid chromosome number is integrated by a complement of 2n = 24 biarmed chromosomes. The presence of sex chromosomes from female and male meiotic spreads was not observed. Current results suggest that S. baudinii chromosome structure is well shared among Hylidae family and "B" chromosomes are particular structures that have very important evolutionary consequences in species diversification.

  8. Ultrastructure of venom glands in the frog (Rana esculenta).

    Science.gov (United States)

    De Perez, G; Hindelang, C

    1985-01-01

    Electron microscopic study of skin venom glands in the frog, Rana esculenta, revealed the syncytial structure of the inner (secretory) wall which presents two distinct zones: a basal (juxtamuscular) one, which contains nuclei and major cytoplasmic organelles, and an apical one where large electron-dense granules form and accumulate. Granules are seen to arise inside clusters of tightly packed smooth endoplasmic reticulum (SER) elements, which suggests that the SER system is mainly involved in synthesis of this material. A high glutaraldehyde concentration (5%) also reveals a poorly defined material filling the intergranular cytoplasm. No apical limits to the syncytium could be traced, which suggests massive holocrine secretion. Nerves insinuate between the muscle cells and occur all along the internal face of the muscular layer, sometimes in close contact with the syncytium. The gland duct, the wall of which consists of epidermal cells, is blocked, in contact with the gland, by an epidermal bud linked externally to the muscle layer surrounding the gland. Thus, only strong muscle tension such as to expel all or part of the epidermal bud can trigger granule release. This phenomenon can be induced by the subcutaneous injection of epinephrine, but the high and distressing dose needed to provoke appreciable changes in venom glands renders unlikely any natural intense venom release triggered by epinephrine in the frog.

  9. Localization and characterization of adrenergic receptors on frog skin melanophores.

    Science.gov (United States)

    Longshore, M A; Horowitz, J M

    1981-07-01

    The functional location of adrenergic binding sites was studied in frog skin melanophores by injecting norepinephrine (NE) outside and inside a melanophore. In 49 groups of cells (75% of the fields tested) iontophoretic injection of NE outside the cell caused melanosome aggregation in the target cell and/or in the field. In six cells in which a resting membrane potential was measured before and after intracellular injection (10-90 nA), NE elicited no change in melanosome configuration. Once the receptors were localized, the effect of temperature on these receptors was determined by measuring the reflectance of skins (an indication of melanosome aggregation or dispersion) in two populations of frogs treated with NE, Rana pipiens pipiens (with dominant alpha-receptors) and Rana berlandieri forreri (with dominant beta-receptors). NE (0.1 mM) caused melanosome aggregation in the former and dispersion in the latter tested at 12, 22, and 40 degrees C. The iontophoretic and reflectance results suggest that the binding site of the adrenergic receptor is located on the outer surface of the plasma membrane of melanophores and that alpha- and beta-receptors evoke aggregation and dispersion, respectively, within the temperature range of these experiments.

  10. Axonal transport of thiamine in frog sciatic nerves in vitro.

    Science.gov (United States)

    Bergquist, J E; Hanson, M

    1983-03-01

    Thiamine has an essential and unknown function in nerve membranes. Administration of thiamine can alleviate symptoms of thiamine deficiency within a few hours. The time course is consistent with a fast axonal transport of the vitamin. Very little is known about axonal transport of low-molecular-weight substances with a preferential localization to the axon membrane. We investigated if labeled thiamine could be transported in the frog sciatic nerve. Radioactivity accumulated proximal to a ligature on the sciatic nerve after supplying the dorsal ganglia with [35S]thiamine in vitro. The accumulation was reduced by inhibition of the energy metabolism with dinitrophenol and by inhibition of protein synthesis in the ganglia with cycloheximide. Vinblastine did not affect the accumulation of thiamine at a concentration which was sufficient to block transport of [3H]leucine-labeled proteins. Accumulation distal to a ligature could be demonstrated in vivo but not in vitro after injecting the gastrocnemius muscle with labeled thiamine. Axonal transport of [3H]leucine-labeled proteins was inhibited by thiamine at millimolar concentrations in the incubation medium. A transient reduction of the compound action potential was obtained at these concentrations. Thiamine was migrating at a fast rate in frog sciatic nerves in both orthograde and retrograde directions. The uptake and/or transport was dependent on energy metabolism and a concomitant protein synthesis. The lack of effect by vinblastine suggests that the transported fraction of thiamine differs in subcellular localization from the bulk of transported [3H]leucine-labeled proteins.

  11. Remodeling of the metabolome during early frog development.

    Directory of Open Access Journals (Sweden)

    Livia Vastag

    Full Text Available A rapid series of synchronous cell divisions initiates embryogenesis in many animal species, including the frog Xenopus laevis. After many of these cleavage cycles, the nuclear to cytoplasmic ratio increases sufficiently to somehow cause cell cycles to elongate and become asynchronous at the mid-blastula transition (MBT. We have discovered that an unanticipated remodeling of core metabolic pathways occurs during the cleavage cycles and the MBT in X. laevis, as evidenced by widespread changes in metabolite abundance. While many of the changes in metabolite abundance were consistently observed, it was also evident that different female frogs laid eggs with different levels of at least some metabolites. Metabolite tracing with heavy isotopes demonstrated that alanine is consumed to generate energy for the early embryo. dATP pools were found to decline during the MBT and we have confirmed that maternal pools of dNTPs are functionally exhausted at the onset of the MBT. Our results support an alternative hypothesis that the cell cycle lengthening at the MBT is triggered not by a limiting maternal protein, as is usually proposed, but by a decline in dNTP pools brought about by the exponentially increasing demands of DNA synthesis.

  12. Effects of host species and life stage on the helminth communities of sympatric northern leopard frogs (Lithobates pipiens) and wood frogs (Lithobates sylvaticus) in the Sheyenne National Grasslands, North Dakota.

    Science.gov (United States)

    Gustafson, Kyle D; Newman, Robert A; Tkach, Vasyl V

    2013-08-01

    We studied helminth communities in sympatric populations of leopard frogs (Lithobates pipiens) and wood frogs (Lithobates sylvaticus) and assessed the effects of host species and life stage on helminth community composition and helminth species richness. We examined 328 amphibians including 218 northern leopard frogs and 110 wood frogs collected between April and August of 2009 and 2010 in the Sheyenne National Grasslands of southeastern North Dakota. Echinostomatid metacercariae were the most common helminths found, with the highest prevalence in metamorphic wood frogs. Host species significantly influenced helminth community composition, and host life stage significantly influenced the component community composition of leopard frogs. In these sympatric populations, leopard frogs were common hosts for adult trematodes whereas wood frogs exhibited a higher prevalence of nematodes with direct life cycles. Metamorphic frogs were commonly infected with echinostomatid metacercariae and other larval trematodes whereas juvenile and adult frogs were most-frequently infected with directly transmitted nematodes and trophically transmitted trematodes. Accordingly, helminth species richness increased with the developmental life stage of the host.

  13. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob;

    2014-01-01

    A new agent-based modelling tool has been developed to allow the modelling of populations of individuals whose interactions are characterised by tightly timed dynamics. The tool was developed to model male frog calling dynamics, to facilitate research into what local rules may be employed...... Frog, E. coqui, is implemented as a case study for the presentation and discussion of the tool, and results from this model are presented. RANA, in its present stage of development, is shown to be able to handle the problem of modelling calling frogs, and several fruitful extensions are proposed...

  14. Effect of various lysosomes and endotoxin on vascular permeability in frogs and mice.

    Science.gov (United States)

    Csákó, G; Reichel, A; Csernyánszky, H; Reichel, U

    1975-01-01

    Blood-lymph permeability increasing effects of frog liver lysosomes, Escherichia coli 0111 endotoxin, bradykinin and serotonin were demonstrated in frogs with a method developed by the authors. These actions were expressed in a faster dye saturation in the lymph as compared to that of the controls. 2. The method is based on the determinations of concentration of Evans blue transported as protein-bound dye into the lymph. 3. Frog liver and polymorphonuclear leukocyte lysosomes had a capillary permeability increasing action tested by local skin response when injecting Evans blue intravenously in mice. 4. All these phenomena are similar to events described earlier in mammalian systems.

  15. Play or science?

    DEFF Research Database (Denmark)

    Lieberoth, Andreas; Pedersen, Mads Kock; Sherson, Jacob

    2015-01-01

    Crowdscience games may hold unique potentials as learning opportunities compared to games made for fun or education. They are part of an actual science problem solving process: By playing, players help scientists, and thereby interact with real continuous research processes. This mixes the two...... worlds of play and science in new ways. During usability testing we discovered that users of the crowdscience game Quantum Dreams tended to answer questions in game terms, even when directed explicitly to give science explanations. We then examined these competing frames of understanding though a mixed...... correlational and grounded theory analysis. This essay presents the core ideas of crowdscience games as learning opportunities, and reports how a group of players used “game”, “science” and “conceptual” frames to interpret their experience. Our results suggest that oscillating between the frames instead...

  16. Understanding Games as Played

    DEFF Research Database (Denmark)

    Leino, Olli Tapio

    2009-01-01

    Researchers interested in player’s experience would assumedly, across disciplines, agree that the goal behind enquiries into player’s experience is to understand the how games’ features end up affecting the player’s experience. Much of the contemporary interdisciplinary research into player......’s experience leans toward the empirical-scientific, in the forms (neuro)psychology, sociology and cognitive science, to name a few. In such approaches, for example demonstrating correlation between physiological symptoms and an in-game event may amount to ‘understanding’. However, the experience of computer...... game play is a viable topic also for computer game studies within the general tradition of humanities. In such context, the idea of ‘understanding an experience’ invites an approach focusing on the experienced significance of events and objects within computer game play. This focus, in turn, suggests...

  17. Ravens at Play

    Directory of Open Access Journals (Sweden)

    Deborah Bird Rose

    2011-09-01

    Full Text Available ‘We were driving through Death Valley, an American-Australian and two Aussies, taking the scenic route from Las Vegas to Santa Cruz.’ This multi-voiced account of multispecies encounters along a highway takes up the challenge of playful and humorous writing that is as well deeply serious and theoretically provocative. Our travels brought us into what Donna Haraway calls the contact zone: a region of recognition and response. The contact zone is a place of significant questions: ‘Who are you, and so who are we? Here we are, and so what are we to become?’ Events were everything in this ecology of play, in which the movements of all the actors involved the material field in its entirety. We were brought into dances of approach and withdrawal, dances emerging directly, to paraphrase Brian Massumi, from the dynamic relation between a myriad of charged particles.

  18. Public Computation & Boundary Play

    CERN Document Server

    Sengupta, Pratim

    2016-01-01

    In this paper, we introduce 'public computation' as a genre of learning environments that can be used to radically broaden public participation in authentic, computation-enabled STEM disciplinary practices. Our paradigmatic approach utilizes open source software designed for professional scientists, engineers and digital artists, and situates them in an undiluted form, alongside live and archived expert support, in a public space. We present a case study of DigiPlay, a prototypical public computation space we designed at the University of Calgary, where users can interact directly with scientific simulations as well as the underlying open source code using an array of massive multi- touch screens. We argue that in such a space, public interactions with the code can be thought of as boundary work and play, through which public participation becomes legitimate scientific act, as the public engages in scientific creation through truly open-ended explorations with the code.

  19. Play. Learn. Innovate

    DEFF Research Database (Denmark)

    Sproedt, Henrik

    evidence that play and games could be interesting perspectives to take in order to understand complex social interaction. I come to the conclusion that – in innovation settings – the social dynamics that affect the process are essentially about transformation of knowledge across boundaries. I propose......„Play. Learn. Innovate. – Grasping the Social Dynamics of Participatory Innovation“ the title of this thesis describes how the complex interplay of unexpected events led to some burning questions and eventually to this thesis, which one could call an innovation*1*. During several years...... study were to better understand the theoretical foundations and practical implications of complex social interaction in organizational innovation settings. As I did not find any existing models or hypotheses that I was interested in testing I set out to discover how I could grasp complex social...

  20. "Playing" with our users

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2014-01-01

    was from the amazing Dr Anthony Lewis Brooks (aka Tony) who has conceived the concepts GameAbilitation, ArtAbilitation, and Ludic Engagement Designs for All. While presenting some of his work on GameAbilitation and ArtAbilitation he brought up the subject of conducting research with users with disabilities......, about what happens to our users when research is over, funds are gone and the curtain of experiments has fallen. Dr Brooks presented the case of a young user who while unable to move and communicate had to part with the test device that provided him with interactive playful experience. We’ve all been...... confined in a house. For researchers that work with people with disabilities and in my case with playful interactions and positive immersive experience, we might have to think harder when we write project proposals or sketch our methodology. Devices, software and experience should be available to the users...

  1. Creativity and Playfulness

    DEFF Research Database (Denmark)

    Ejsing-Duun, Stine; Skovbjerg, Helle Marie

    2015-01-01

    Abstract: This article explores how student behavior and interactions change when teachers use “producing games” as a primary pedagogical strategy (Papert, 1980; Ejsing-Duun and Karoff, 2014). Based on student and teacher actions and responses, as well as on students' production—observed during f...... fieldwork—this paper emphasizes the importance of understanding how students explore creativity and playfulness while producing in learning situations....

  2. Creativity and Playfulness

    DEFF Research Database (Denmark)

    Ejsing-Duun, Stine; Skovbjerg, Helle Marie

    2015-01-01

    Abstract: This article explores how student behavior and interactions change when teachers use “producing games” as a primary pedagogical strategy (Papert, 1980; Ejsing-Duun and Karoff, 2014). Based on student and teacher actions and responses, as well as on students' production—observed during f...... fieldwork—this paper emphasizes the importance of understanding how students explore creativity and playfulness while producing in learning situations....

  3. Oxidative phosphorylation efficiency, proton conductance and reactive oxygen species production of liver mitochondria correlates with body mass in frogs.

    Science.gov (United States)

    Roussel, Damien; Salin, Karine; Dumet, Adeline; Romestaing, Caroline; Rey, Benjamin; Voituron, Yann

    2015-10-01

    Body size is a central biological parameter affecting most biological processes (especially energetics) and the mitochondrion is a key organelle controlling metabolism and is also the cell's main source of chemical energy. However, the link between body size and mitochondrial function is still unclear, especially in ectotherms. In this study, we investigated several parameters of mitochondrial bioenergetics in the liver of three closely related species of frog (the common frog Rana temporaria, the marsh frog Pelophylax ridibundus and the bull frog Lithobates catesbeiana). These particular species were chosen because of their differences in adult body mass. We found that mitochondrial coupling efficiency was markedly increased with animal size, which led to a higher ATP production (+70%) in the larger frogs (L. catesbeiana) compared with the smaller frogs (R. temporaria). This was essentially driven by a strong negative dependence of mitochondrial proton conductance on body mass. Liver mitochondria from the larger frogs (L. catesbeiana) displayed 50% of the proton conductance of mitochondria from the smaller frogs (R. temporaria). Contrary to our prediction, the low mitochondrial proton conductance measured in L. catesbeiana was not associated with higher reactive oxygen species production. Instead, liver mitochondria from the larger individuals produced significantly lower levels of radical oxygen species than those from the smaller frogs. Collectively, the data show that key bioenergetics parameters of mitochondria (proton leak, ATP production efficiency and radical oxygen species production) are correlated with body mass in frogs. This research expands our understanding of the relationship between mitochondrial function and the evolution of allometric scaling in ectotherms.

  4. Annual cycles of urinary reproductive steroid concentrations in wild and captive endangered Fijian ground frogs (Platymantis vitiana).

    Science.gov (United States)

    Narayan, Edward J; Molinia, Frank C; Christi, Ketan S; Morley, Craig G; Cockrem, John F

    2010-03-01

    Annual cycles of reproductive steroid metabolites were measured in urine collected from free-living and captive tropical endangered Fijian ground frogs (Platymantis vitiana) a terrestrial breeding. Free-living frogs were sampled on Viwa Island, Fiji and captive frogs were maintained in an outdoor enclosure in Suva, Fiji. Urinary estrone, progesterone and testosterone metabolite concentrations increased in male and female frogs after hCG challenges, with clear peaks in steroid concentrations 2 or 3 days after the challenges. There were annual cycles of testosterone metabolites in wild and captive males, and of estrone and progesterone metabolites in wild and captive females. Peaks of steroid concentrations in the wet season corresponded with periods of mating and egg laying in females in December and January. Steroid concentrations declined in January and February when maximum egg sizes in females were also declining. Body weights of wild male and vitellogenic female frogs showed annual cycles. Body weights of non-vitellogenic female frogs varied significantly between months, although there was no clear pattern of annual changes. Body weights of the 3 captive male frogs and 4 captive female frogs were similar to those of the wild frogs. Estrone metabolites were 80% successful in identifying non-vitellogenic females from males. The results suggest that the Fijian ground frog is a seasonal breeder with an annual gonadal cycle, and this species is likely to be photoperiodic. Urinary steroid measurements can provide useful information on reproductive cycles in endangered amphibians.

  5. Description of the tadpoles of two endemic frogs: the Phu Luang cascade frog Odorrana aureola (Anura: Ranidae) and the Isan big-headed frog Limnonectes isanensis (Anura: Dicroglossidae) from northeastern Thailand.

    Science.gov (United States)

    Ampai, Natee; Rujirawan, Attapol; Arkajag, Jirachai; Mcleod, David S; Aowphol, Anchalee

    2015-07-07

    We describe the external morphology of the tadpoles of two frogs endemic to Thailand: the Phu Luang cascade frog    (Odorrana aureola) and the Isan big-headed frog (Limnonectes isanensis) from the type localities in the Phu Luang Wildlife Sanctuary, Loei Province, northeastern Thailand. Morphological and genetic characters (16S rRNA) were used to identify specimen and match tadpoles to the adults. Detailed descriptions of external morphology and coloration in life are provided for both species. We provide a brief discussion of the ecology of these tadpoles and a comparison to previously published data from tadpoles of closely related taxa. Additionally, we provide evidence for the utility of larval morphology in resolving the taxonomic puzzles presented by cryptic species complexes.

  6. Real estate ads in Emei music frog vocalizations: female preference for calls emanating from burrows.

    Science.gov (United States)

    Cui, Jianguo; Tang, Yezhong; Narins, Peter M

    2012-06-23

    During female mate choice, both the male's phenotype and resources (e.g. his nest) contribute to the chooser's fitness. Animals other than humans are not known to advertise resource characteristics to potential mates through vocal communication; although in some species of anurans and birds, females do evaluate male qualities through vocal communication. Here, we demonstrate that calls of the male Emei music frog (Babina dauchina), vocalizing from male-built nests, reflect nest structure information that can be recognized by females. Inside-nest calls consisted of notes with energy concentrated at lower frequency ranges and longer note durations when compared with outside-nest calls. Centre frequencies and note durations of the inside calls positively correlate with the area of the burrow entrance and the depth of the burrow, respectively. When given a choice between outside and inside calls played back alternately, more than 70 per cent of the females (33/47) chose inside calls. These results demonstrate that males of this species faithfully advertise whether or not they possess a nest to potential mates by vocal communication, which probably facilitates optimal mate selection by females. These results revealed a novel function of advertisement calls, which is consistent with the wide variation in both call complexity and social behaviour within amphibians.

  7. Changes in Electroencephalogram Approximate Entropy Reflect Auditory Processing and Functional Complexity in Frogs

    Institute of Scientific and Technical Information of China (English)

    Yansu LIU; Yanzhu FAN; Fei XUE; Xizi YUE; Steven E BRAUTH; Yezhong TANG; Guangzhan FANG

    2016-01-01

    Brain systems engage in what are generally considered to be among the most complex forms of information processing. In the present study, we investigated the functional complexity of anuran auditory processing using the approximate entropy (ApEn) protocol for electroencephalogram (EEG) recordings from the forebrain and midbrain while male and female music frogs (Babina daunchina) listened to acoustic stimuli whose biological significance varied. The stimuli used were synthesized white noise (reflecting a novel signal), conspecific male advertisement calls with either high or low sexual attractiveness (relfecting sexual selection) and silence (relfecting a baseline). The results showed that 1) ApEn evoked by conspeciifc calls exceeded ApEn evoked by synthesized white noise in the left mesencephalon indicating this structure plays a critical role in processing acoustic signals with biological signiifcance;2) ApEn in the mesencephalon was significantly higher than for the telencephalon, consistent with the fact that the anuran midbrain contains a large well-organized auditory nucleus (torus semicircularis) while the forebrain does not; 3) for females ApEn in the mesencephalon was signiifcantly different than that of males, suggesting that males and females process biological stimuli related to mate choice differently.

  8. The role of climatic and geological events in generating diversity in Ethiopian grass frogs (genus Ptychadena).

    Science.gov (United States)

    Smith, Megan L; Noonan, Brice P; Colston, Timothy J

    2017-08-01

    Ethiopia is a world biodiversity hotspot and harbours levels of biotic endemism unmatched in the Horn of Africa, largely due to topographic-and thus habitat-complexity, which results from a very active geological and climatic history. Among Ethiopian vertebrate fauna, amphibians harbour the highest levels of endemism, making amphibians a compelling system for the exploration of the impacts of Ethiopia's complex abiotic history on biotic diversification. Grass frogs of the genus Ptychadena are notably diverse in Ethiopia, where they have undergone an evolutionary radiation. We used molecular data and expanded taxon sampling to test for cryptic diversity and to explore diversification patterns in both the highland radiation and two widespread lowland Ptychadena. Species delimitation results support the presence of nine highland species and four lowland species in our dataset, and divergence dating suggests that both geologic events and climatic fluctuations played a complex and confounded role in the diversification of Ptychadena in Ethiopia. We rectify the taxonomy of the endemic P. neumanni species complex, elevating one formally synonymized name and describing three novel taxa. Finally, we describe two novel lowland Ptychadena species that occur in Ethiopia and may be more broadly distributed.

  9. Motivation, Creativity, Play & Learning

    DEFF Research Database (Denmark)

    Petersson, Eva

    2005-01-01

    implementation of robotic physical movement synchronously manipulated from sourced data movement information of a human. SoundScapes is a concept based on non-verbal communication and stimulation through interactive play with sounds and images, which is being realised in the production of a non-wearable sensor...... groups of children, including children with severe physical/multi disabilities. The sourced capture of the human data is from enhanced virtual interactive space created from sensors. The data is constituted of the situated multimodal communication and forms of expression. The ‘VIS’ is considered...

  10. Motivation, Creativity, Play & Learning

    DEFF Research Database (Denmark)

    Petersson, Eva

    2005-01-01

    implementation of robotic physical movement synchronously manipulated from sourced data movement information of a human. SoundScapes is a concept based on non-verbal communication and stimulation through interactive play with sounds and images, which is being realised in the production of a non-wearable sensor...... groups of children, including children with severe physical/multi disabilities. The sourced capture of the human data is from enhanced virtual interactive space created from sensors. The data is constituted of the situated multimodal communication and forms of expression. The ‘VIS’ is considered...

  11. "Playing" with our users

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2014-01-01

    . Unfortunately if donated in the school they are rarely being used by the students. In the case of virtual reality or artistic installations it is extremely difficult to provide such equipment to users. Last but not least we are not sure how the software will be used and if the experience will continue...... after the conduct of the research. If not due to restrictions, user should at least continue to be part of the research’s debrief and next steps. While I was in Nottingham I realised that sometimes our research, our playful educational experience, our DIY VR helmet, our beta, glitchy, research-only game...

  12. Turning training into play

    DEFF Research Database (Denmark)

    Aarhus, Rikke; Grönvall, Erik; Larsen, Simon Bo;

    2011-01-01

    Embodied gaming has been adopted and gained credibility in the field of physical rehabilitation. In this paper, we report on findings from a six-month-long study of three groups of senior citizens, and their use of Nintendo Wii Fit in a supervised physical training context. We argue that the study...... participants generally found physical training both fun and socially engaging, and experienced improved fitness. We also argue that embodied gaming motivates seniors to do more than they think themselves capable of, and allows seniors with different mental and physical capabilities to play together. However...

  13. Play and playfulness, basic features of early childhood education

    NARCIS (Netherlands)

    Singer, E.

    2013-01-01

    This article argues that play and playfulness are basic features in early childhood education, but that play curricula can have serious drawbacks. The starting point is the play theory of the Dutch historian Johan Huizinga, a radical critic of the focus on the educational benefits of play. According

  14. Play and playfulness, basic features of early childhood education

    NARCIS (Netherlands)

    Singer, E.

    2013-01-01

    This article argues that play and playfulness are basic features in early childhood education, but that play curricula can have serious drawbacks. The starting point is the play theory of the Dutch historian Johan Huizinga, a radical critic of the focus on the educational benefits of play. According

  15. Instruction Manual and Frog Survey Protocols for Region 1 National Wildlife Refuges, East-side Zone

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This manual is intended to assist biologists wishing to conduct surveys for frogs and toads. The document includes detailed information on how to conduct surveys,...

  16. Western spotted frog (Rana pretiosa) distribution in the Bonneville Basin of western Utah: Research in progress

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report provides information on the western spotted frog (Rana pretiosa) which occurs in Tule Valley, Utah. The following topics are discussed; general...

  17. A New Hybrid Shuffled Frog Leaping Algorithm to Solve Non-convex Economic Load Dispatch Problem

    Directory of Open Access Journals (Sweden)

    Ehsan Bijami

    2011-11-01

    Full Text Available This paper presents a New Hybrid Shuffled Frog Leaping (NHSFL algorithm applied to solve Economic Load Dispatch (ELD problem. Practical ELD has non-convex cost function and various equality and inequality constraints that convert the ELD problem as a nonlinear, non-convex and non-smooth optimization problem. In this paper, a new frog leaping rule is proposed to improve the local exploration and the performance of the conventional SFL algorithm. Also a genetic mutation operator is used for the creation of new frogs instead of random frog creation that improves the convergence. To show the efficiency of the proposed approach, the non-convex ELD problem is solved using conventional SFL and an improved SFL method proposed by other researchers. Then the results of SFL methods are compared to the results obtained by the proposed NHSFL algorithm. Simulation studies show that the results obtained by NHSFL are more effective and better compared with these algorithms.

  18. Recovery plan for the California Red-legged frog (Rana aurora draytonii)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objective of this plan is to reduce threats and improve the population status of the California red-legged frog sufficiently to warrant delisting. Actions...

  19. Okefenokee and Banks Lake National Wildlife Refuge 2009 Frog Abnormality Survey Summary

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Summary of frog observations for abnormal conditions at select sites on both Okefenokee and Banks Lake NWRs. During the 2009 summer, STEP students Zach Carter along...

  20. The Inconsistency Between The Notorious Jumping Frog of Calaveras County and The Man That Corrupted Hadleyburg

    Institute of Scientific and Technical Information of China (English)

    TAN Wen-hua

    2015-01-01

    This paper compares Mark Twain’s The Notorious Jumping Frog of Calaveras County and The Man That Corrupted Had⁃leyburg, in terms of their stylistic and semantic inconsistency, specifically, their narrative technique and moral vision.