WorldWideScience

Sample records for plato insecticide strip

  1. The insecticide resistance in stripped stem borer, Chilo suppressalis (Walker)

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ The stripped stem borer (SSB), Chilo suppressalis (Walker) is one of the major insect pests of rice in China. Chemical control has been a common practice in SSB management since 1950s. Insecticides used included BHC before 1983;organophosphorus insecticides (methyl-parathion, trichophon, methamidophos, and monocrotophos), and chlordimeform in mid-1970s-1980s; Shachongshuang (dimehypo) and Shachongdan (monousltap) since early 1980s. In recent years, SSB population and its damage to rice increased rapidly and failures on control has been reported. To find out the cause of failure and to put forward the suitable control methods, we studied the resistance of SSB to major insecticides used in China.

  2. Plato's Embryology.

    Science.gov (United States)

    Wilberding, James

    2015-01-01

    Embryology was a subject that inspired great cross-disciplinary discussion in antiquity, and Plato's Timaeus made an important contribution to this discussion, though Plato's precise views have remained a matter of controversy, especially regarding three key questions pertaining to the generation and nature of the seed: whether there is a female seed; what the nature of seed is; and whether the seed contains a preformed human being. In this paper I argue that Plato's positions on these three issues can be adequately determined, even if some other aspects of his theory cannot. In particular, it is argued that (i) Plato subscribes to the encephalo-myelogenic theory of seed, though he places particular emphasis on the soul being the true seed; (ii) Plato is a two-seed theorist, yet the female seed appears to make no contribution to reproduction; and (iii) Plato cannot be an advocate of preformationism.

  3. Neonicotinoid insecticide removal by prairie strips in row-cropped watersheds with historical seed coating use

    Science.gov (United States)

    Hladik, Michelle; Bradbury, Steven; Schulte, Lisa A.; Helmers, Matthew; Witte, Christopher; Kolpin, Dana W.; Garrett, Jessica D.; Harris, Mary

    2017-01-01

    Neonicotinoids are a widely used class of insecticides that are commonly applied as seed coatings for agricultural crops. Such neonicotinoid use may pose a risk to non-target insects, including pollinators and natural enemies of crop pests, and ecosystems. This study assessed neonicotinoid residues in groundwater, surface runoff water, soil, and native plants adjacent to corn and soybean crop fields with a history of being planted with neonicotinoid-treated seeds from 2008-2013. Data from six sites with the same crop management history, three with and three without in-field prairie strips, were collected in 2015-2016, 2-3 years after neonicotinoid (clothianidin and imidacloprid) seed treatments were last used. Three of the six neonicotinoids analyzed were detected in at least one environmental matrix: the two applied as seed coatings on the fields (clothianidin and imidacloprid) and another widely used neonicotinoid (thiamethoxam). Sites with prairie strips generally had lower concentrations of neonicotinoids: groundwater and footslope soil neonicotinoid concentrations were significantly lower in the sites with prairie strips than those without; mean concentrations for groundwater were 11 and 20 ng/L (p = 0.048) and seed treatments continued. There were no detections (limit of detection: 1 ng/g) of neonicotinoids in the foliage or roots of plants comprising prairie strips, indicating a low likelihood of exposure to pollinators and other insects visiting these plants following the cessation of seed coating use. Offsite transport of neonicotinoids to aquatic systems through the groundwater and surface water were furthermore reduced with prairie strips. This study demonstrates the potential for prairie strips comprising 10% of an agricultural catchment to mitigate the non-target impacts of neonicotinoids.

  4. Strip-based immunoassay for the simultaneous detection of the neonicotinoid insecticides imidacloprid and thiamethoxam in agricultural products.

    Science.gov (United States)

    Xu, Ting; Xu, Qi Gong; Li, Hao; Wang, Jia; Li, Qing X; Shelver, Weilin L; Li, Ji

    2012-11-15

    A semiquantitative strip immunoassay was developed for the rapid detection of imidacloprid and thiamethoxam in agricultural products using specific nanocolloidal gold-labeled monoclonal antibodies. The conjugates of imidacloprid-BSA, thiamethoxam-BSA and goat anti-mouse IgG were coated on the nitro-cellulose membrane of the strip, serving as test lines and control line, respectively. The flow of the complexes of gold labeled antibodies and insecticides along the strip resulted in intensive color formed on the test lines inversely proportional to the concentrations of imidacloprid and thiamethoxam. The visual detection limits of imidacloprid and thiamethoxam in assay buffer were 0.5 and 2 ng mL(-1), respectively. Matrix interference of cucumber, tomato, lettuce, apple, and orange on the strip assay could be eliminated by diluting sample extracts with assay buffer. The strip analysis of imidacloprid and thiamethoxam in these samples was compared to liquid chromatography-mass spectrometry and the results were in good agreement. The strip was stable for storage more than 5 months at 4 °C. The strip assay is a rapid and simple method for the simultaneous screening of imidacloprid and thiamethoxam in agricultural products.

  5. Filsafat Ketuhanan Menurut Plato

    Directory of Open Access Journals (Sweden)

    Ivan Th.J Weismann

    2005-06-01

    Full Text Available Plato adalah filsuf pertama yang menulis secara filosofis dan secara sistematik teologis mengenai konsep Ketuhanan sehingga dapatlah dikatakan bahwa ia adalah peletqk dasar bagi ilmu teologia dan memberikan pengaruh besar bagi perkembanganfilsafat Barat khususnya tentangkonsep Ketuhanan. Pemikiran Plato tentang Ketuhanan adalah upayanya untuk mereformasi konsep Ketuhanan yang terdapat pada masyarakat Yunani kuno. Tulisan ini berupaya menganalisis dan memahami Ketuhanan menurut Plato agar pembaca masa kini dapat mengerti lebih dalam lagi tentong konsep Ketuhanan yang dipahami masyarakat Yunani kuno dan khususnya menurut Plato, dan juga dapat dijadikan sebagai bahan perbandingan bagifilsafat Ketuhanan pada masa kini. Filsafat Ketuhanan menurut Plato ini penulis jelaskan dengan memperhatikandimensi metafisika, epistemologi, dan etika.

  6. [Plato psychiatrist, Foucault platonic].

    Science.gov (United States)

    Mathov, Nicolás

    2016-05-01

    This work explores the links between the concepts of "soul", "law" and "word" in Plato's work, in order to highlight the importance and the centrality of the philosophical-therapeutic dimension in the Greek philosopher's thought. In that way, this work pretends to show that "contemporary" problems usually discussed within "Human Sciences" in general, and Psychiatry in particular, should confront their knowledge with Plato's work, mainly due to the profound influence his ideas have had in our Greco-Christian culture. In that sense, and with that objective, this work also explores Michel Foucault's lucid and controversial interpretation of Plato.

  7. PLATO IV Accountancy Index.

    Science.gov (United States)

    Pondy, Dorothy, Comp.

    The catalog was compiled to assist instructors in planning community college and university curricula using the 48 computer-assisted accountancy lessons available on PLATO IV (Programmed Logic for Automatic Teaching Operation) for first semester accounting courses. It contains information on lesson access, lists of acceptable abbreviations for…

  8. Control Data's Education Offering: "Plato Would Have Enjoyed PLATO"

    Science.gov (United States)

    Datamation, 1976

    1976-01-01

    Programmed Learning and Teaching Operation (PLATO) distributes instructional materials in the form of text, numbers, animated drawings and other graphics for individualized, self-paced learning. (Author)

  9. From Pericles to Plato

    DEFF Research Database (Denmark)

    Larsen, Øjvind

    2012-01-01

    Plato is normally taken as one of the founders of Western political philosophy, not at least with his Republic. Here, he constructs a hierarchy of forms of governments, beginning with aristocracy at the top as a critical standard for the other forms of governments, and proceeding through timocrac......’ funeral oration is used to show that Pericles presented a democratic political philosophy that can serve as a counterpoint to Plato’s political philosophy in the Republic....

  10. Peers on Socrates and Plato

    Science.gov (United States)

    Mackenzie, Jim

    2014-01-01

    There is more to be said about two of the topics Chris Peers addresses in his article "Freud, Plato and Irigaray: A morpho-logic of teaching and learning" (2012, Educational Philosophy and Theory, 44, 760-774), namely the Socratic method of teaching and Plato's stance with regard to women and feminism. My purpose in this article is…

  11. PLATO Sitcom Dialogs for Russian.

    Science.gov (United States)

    Dawson, Clayton; Provenzano, Nolen

    1981-01-01

    Situation comedy (sitcom) dialogs that are included in PLATO lessons for first year Russian students are described. These comprehension exercises make use of both the touch panel and the audio capabilities of PLATO. The sitcom dialogs were written by a native speaker of Russian and are based on the vocabulary in the textbook plus a small number of…

  12. Peers on Socrates and Plato

    Science.gov (United States)

    Mackenzie, Jim

    2014-01-01

    There is more to be said about two of the topics Chris Peers addresses in his article "Freud, Plato and Irigaray: A morpho-logic of teaching and learning" (2012, Educational Philosophy and Theory, 44, 760-774), namely the Socratic method of teaching and Plato's stance with regard to women and feminism. My purpose in this article is…

  13. Strip-based immunoassay for the simultaneous detection of the neonicotinoid insecticides imidacloprid and thiamethoxam in agricultural products

    Science.gov (United States)

    A semiquantitative strip immunoassay was developed for the rapid detection of imidacloprid and thiamethoxam in agricultural products using specific nanocolloidal gold-labeled monoclonal antibodies. The conjugates of imidacloprid-BSA and thiamethoxam-BSA and goat anti-mouse IgG were coated on the ni...

  14. Phusis and Nomos in Plato

    Directory of Open Access Journals (Sweden)

    Zahra Nouri Sanghdehi

    2017-07-01

    Full Text Available One of the greatest problems in Plato that appears in different forms in his works is the relation of nomos and phusis. This thesis has been in fifth century B.C as the contradiction of phusis and nomos among big thinkers. In this essay, we tried to investigate the relation of phusis and nomos in Plato’s thoughts according to current theories of the contradiction of these in dialogues Gorgias, Republic and Protagoras. Plato tries to minimize consequences of belief to contradiction of phusis and nomos in social and political life by assertion large scale relation between phusis and nomos. Plato depicts the ultimate solution of this problem in Law. There he accounts nomos as raised from phusis that is sub sovereignty of divine. Indeed union of phusis and gods in Plato’s thought is sanction for the identity of phusis and nomos.

  15. What is Plato? Inference and Allusion in Plato's "Sophist."

    Science.gov (United States)

    Quandahl, Ellen

    1989-01-01

    Discusses inference and allusion in the dialogue in Plato's Sophist. Examines the sense in which a locution is used, distinguishing among senses of the verb to be, and sets the ball rolling for the development of logic and the whole metaphysics of categories of being. (RAE)

  16. Insecticide poisoning

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/002832.htm Insecticide poisoning To use the sharing features on this page, please enable JavaScript. Insecticide is a chemical that kills bugs. Insecticide poisoning ...

  17. The Method of Hypothesis in Plato's Philosophy

    Directory of Open Access Journals (Sweden)

    Malihe Aboie Mehrizi

    2016-09-01

    Full Text Available The article deals with the examination of method of hypothesis in Plato's philosophy. This method, respectively, will be examined in three dialogues of Meno, Phaedon and Republic in which it is explicitly indicated. It will be shown the process of change of Plato’s attitude towards the position and usage of the method of hypothesis in his realm of philosophy. In Meno, considering the geometry, Plato attempts to introduce a method that can be used in the realm of philosophy. But, ultimately in Republic, Plato’s special attention to the method and its importance in the philosophical investigations, leads him to revise it. Here, finally Plato introduces the particular method of philosophy, i.e., the dialectic

  18. Plato's Anti-Kohlbergian Program for Moral Education

    Science.gov (United States)

    Jonas, Mark E.

    2016-01-01

    Following Lawrence Kohlberg it has been commonplace to regard Plato's moral theory as "intellectualist", where Plato supposedly believes that becoming virtuous requires nothing other than "philosophical knowledge or intuition of the ideal form of the good". This is a radical misunderstanding of Plato's educational programme,…

  19. THEORY OF LOVE IN PLATO'S PHILOSOPHY

    Directory of Open Access Journals (Sweden)

    ZOHREH MOZAFARI

    2015-01-01

    Full Text Available The article presents a philosophical analysis of the phenomenon of Plato’s love. It is noted that a large number of works are devoted to the philosophy of Plato’s love, but not all aspects of his philosophy are studied, for example the problems of erotosophy of Plato. Phenomenon of love interested philosophers since ancient times. The first attempts to explain the phenomenon of love appeared in ancient times. These attempts were made by ancient philosophers Socrates, Plato and Aristotle. Platonism is a multifaceted teaching; identification of all possibilities of Plato’s erotic philosophy which can supplement other fields of philosophy is important and topical. 

  20. Quoting Plato in Porphyrius' Cuestiones homericas

    Directory of Open Access Journals (Sweden)

    Lucía Rodríguez‑Noriega Guillén

    2016-08-01

    Full Text Available This paper studies the quotations of Plato in Porphyry’s Homeric Questions,including their typology (literal quotation, allusion, paraphrase, etc., their beingor not direct citations, their function in the work, and their possible parallels inother authors.

  1. Plato's problem an introduction to mathematical platonism

    CERN Document Server

    Panza, M

    2013-01-01

    What is mathematics about? And how can we have access to the reality it is supposed to describe? The book tells the story of this problem, first raised by Plato, through the views of Aristotle, Proclus, Kant, Frege, Gödel, Benacerraf, up to the most recent debate on mathematical platonism.

  2. The PLATO 2.0 mission

    NARCIS (Netherlands)

    Rauer, H.; et al., [Unknown; Hekker, S.

    2014-01-01

    PLATO 2.0 has recently been selected for ESA’s M3 launch opportunity (2022/24). Providing accurate key planet parameters (radius, mass, density and age) in statistical numbers, it addresses fundamental questions such as: How do planetary systems form and evolve? Are there other systems with planets

  3. Results of the 1975 Delaware PLATO Project.

    Science.gov (United States)

    Hofstetter, Fred T.

    During the Spring semester of 1975, the University of Delaware initiated a PLATO project with the dual purpose of demonstrating how a computer system might function in a university and of evaluating what part such a system might play in the future of the university and its supporting community. The demonstration phase of the project, which…

  4. Socrates, Plato, "Eros" and Liberal Education

    Science.gov (United States)

    McPherran, Mark L.

    2010-01-01

    This paper focuses on the educational method--the "elenchos"--of Plato's Socrates, arguing, against some prominent interpretations, that it is love, both "eros" and "philia", that is the key that links Socrates' philosophy with his education. This analysis, of course, raises some difficult questions regarding the relationship between teacher and…

  5. Plato's Protagoras: Professional Models, Ethical Concerns.

    Science.gov (United States)

    Gregory, Marshall W.

    1983-01-01

    In Plato's model his clear criticism of Protagorean careerism and his negotiation with Socratic radicalism shows he is a centrist cultivating criticism and open discourse. In an age when academe seems to have lost a sense of its identify and function in society, its most enduring contributions are criticism and discourse. (MLW)

  6. What scientists can learn from Plato's Symposium

    Science.gov (United States)

    van Emmerik, Tim

    2015-04-01

    Conferences and scientific meetings are as old as science itself. The ancient Greeks where (in)famous for organizing so-called symposiums. During a symposium (from Greek, drinking together), attendees followed a program that contained both social and scientific aspects, focused around a certain topic. Whilst drinking and eating, all participants were expected to share their vision on the topic of interest by giving an oral presentation. The goal of these meetings was to arrive at a new common understanding and to come closer to the truth. Plato et al. knew very well how to organize an effective scientific conference, which should make use overthink the way we are organizing present-day conferences. Scientific meetings aim to connect researchers, share research and unravel the truth. The question is now: how do we get this done effectively? Plato knew that discussing science with strangers is difficult and he believed that talking about heavy matter could be done best when combined with social events. What if we try to go back to the times of Plato and model our conferences after the ancient symposiums? We might drop laying on couches and covering ourselves in ivy and flowers. However, a mix of social and scientific events will contribute to achieving the ultimate goal of why scientists go to conferences: to connect, to share and to unravel the truth.

  7. From Plato to Orwell: Utopian Rhetoric in a Dystopian World.

    Science.gov (United States)

    Deatherage, Scott

    Plato's "Republic" and George Orwell's "1984" both posit visionary worlds, one where humans are virtuous and understand what Plato refers to as "the Good," and the other where citizens are pawns of a government which uses language as a form of tyranny and control. Despite these overarching differences in philosophical…

  8. A Summary of Plato Curriculum and Research Materials.

    Science.gov (United States)

    Lyman, Elisabeth R.

    PLATO (programmed Logic for Automatic Teaching Operations) is a computer-based teaching system which was developed in the Coordinated Science Laboratory at the University of Illinois to explore the possibilities of automation in individual instruction. The history of the PLATO program is summarized here, along with a list of courses which used…

  9. From Plato to Orwell: Utopian Rhetoric in a Dystopian World.

    Science.gov (United States)

    Deatherage, Scott

    Plato's "Republic" and George Orwell's "1984" both posit visionary worlds, one where humans are virtuous and understand what Plato refers to as "the Good," and the other where citizens are pawns of a government which uses language as a form of tyranny and control. Despite these overarching differences in philosophical…

  10. Plato the Pederast: Rhetoric and Cultural Procreation in the Dialogues.

    Science.gov (United States)

    Ervin, Elizabeth

    1993-01-01

    Examines Plato's Dialogues by reading them through two cultural lenses: the role of eros in classical Greece and its analogous relationship to language and rhetoric; and the educational function of eros within the ancient institution of pederasty. Shows how the cultural values of ancient Greece manifested themselves in Plato's erotic educational…

  11. Plato's Philosophy of Education and the Common Core Debate

    Science.gov (United States)

    Murphy, Madonna M.

    2015-01-01

    This paper examines Plato's Philosophy of Education asking what he would say about the current Common Core initiative which is to better help students to become college and career ready. Plato would be in favor of the common core in as much as the standards are tied to specific skills needed in various career jobs as he was a proponent of…

  12. Fourth Summative Report of the Delaware PLATO Project.

    Science.gov (United States)

    Hofstetter, Fred T.

    A brief history of the Delaware PLATO project and descriptions of new developments in facilities, applications, user services, research, evaluation, and courseware produced since the Third Summative Report (1978) are provided, as well as an overview of PLATO applications at the University of Delaware. Sample lessons, illustrations, and activity…

  13. Fifth Summative Report of the Delaware PLATO Project.

    Science.gov (United States)

    Hofstetter, Fred T.

    A brief history of the Delaware PLATO project and descriptions of the new developments in facilities, applications, user services, research, evaluation, and courseware produced since the Fourth Summative Report (1979) are provided, as well as an overview of PLATO applications at the University of Delaware. Sample lessons, illustrations, and…

  14. Third Summative Report of the Delaware PLATO Project.

    Science.gov (United States)

    Hofstetter, Fred T.

    Descriptions of new developments in the areas of facilities, applications, user services, support staff, research, evaluation, and courseware production since the Second Summative Report (1977) are provided, as well as a summative overview of PLATO applications at the University of Delaware. Through the purchase of its own PLATO system, this…

  15. Plato's ghost the modernist transformation of mathematics

    CERN Document Server

    Gray, Jeremy

    2008-01-01

    Plato's Ghost is the first book to examine the development of mathematics from 1880 to 1920 as a modernist transformation similar to those in art, literature, and music. Jeremy Gray traces the growth of mathematical modernism from its roots in problem solving and theory to its interactions with physics, philosophy, theology, psychology, and ideas about real and artificial languages. He shows how mathematics was popularized, and explains how mathematical modernism not only gave expression to the work of mathematicians and the professional image they sought to create for themselves, but how modernism also introduced deeper and ultimately unanswerable questions

  16. Pemikiran Epistemologi Barat: dari Plato Sampai Gonseth

    Directory of Open Access Journals (Sweden)

    Nunu Burhanuddin

    2015-06-01

    Full Text Available This paper riviewing the Western epistemology thought. The theme focuses on Plato to Gonseth. The Epistemology that referred in this article, is to think about "how humans acquire knowledge?". From this then appear four types of sect modern western epistemology thought, namely: sect of empiricism, rationalism sect, kantinian sect, sect of positivism. Furthermore, the social positivism sciences developed by Comte leaves serious problems associated with the loss of the role of the subject. This problem being the background of epistemology philosophy appears that by Emund Husserl developed through the phenomenology, Habermas through hermeneutics, and Ferdinand Gonseth through critical theory.

  17. The PLATO 2.0 Mission

    CERN Document Server

    Rauer, H; Aerts, C; Appourchaux, T; Benz, W; Brandeker, A; Christensen-Dalsgaard, J; Deleuil, M; Gizon, L; Güdel, M; Janot-Pacheco, E; Mas-Hesse, M; Pagano, I; Piotto, G; Pollacco, D; Santos, N C; Smith, A; -C., J; Suárez,; Szabó, R; Udry, S; Adibekyan, V; Alibert, Y; Almenara, J -M; Amaro-Seoane, P; Eiff, M Ammler-von; Antonello, E; Ball, W; Barnes, S; Baudin, F; Belkacem, K; Bergemann, M; Birch, A; Boisse, I; Bonomo, A S; Borsa, F; Brandão, I M; Brocato, E; Brun, S; Burleigh, M; Burston, R; Cabrera, J; Cassisi, S; Chaplin, W; Charpinet, S; Chiappini, C; Csizmadia, Sz; Cunha, M; Damasso, M; Davies, M B; Deeg, H J; Fialho, F de Oliveira; DÍaz, R F; Dreizler, S; Dreyer, C; Eggenberger, P; Ehrenreich, D; Eigmüller, P; Erikson, A; Farmer, R; Feltzing, S; Figueira, P; Forveille, T; Fridlund, M; García, R; Giuffrida, G; Godolt, M; da Silva, J Gomes; Goupil, M -J; Granzer, T; Grenfell, J L; Grotsch-Noels, A; Günther, E; Haswell, C A; Hatzes, A P; Hébrard, G; Hekker, S; Helled, R; Heng, K; Jenkins, J M; Khodachenko, M L; Kislyakova, K G; Kley, W; Kolb, U; Krivova, N; Kupka, F; Lammer, H; Lanza, A F; Lebreton, Y; Magrin, D; Marcos-Arenal, P; Marrese, P M; Marques, J P; Martins, J; Mathis, S; Mathur, S; Messina, S; Miglio, A; Montalban, J; Montalto, M; Monteiro, M J P F G; Moradi, H; Moravveji, E; Mordasini, C; Morel, T; Mortier, A; Nascimbeni, V; Nielsen, M B; Noack, L; Norton, A J; Ofir, A; Oshagh, M; Ouazzani, R -M; Pápics, P; Parro, V C; Petit, P; Plez, B; Poretti, E; Quirrenbach, A; Ragazzoni, R; Raimondo, G; Rainer, M; Reese, D R; Redmer, R; Reffert, S; Rojas-Ayala, B; Roxburgh, I W; Solanki, S K; Salmon, S; Santerne, A; Schneider, J; Schou, J; Schuh, S; Schunker, H; Silva-Valio, A; Silvotti, R; Skillen, I; Snellen, I; Sohl, F; Sousa, A S; Sozzetti, A; Stello, D; Strassmeier, K G; Švanda, M; Szabó, G M; Tkachenko, A; Valencia, D; van Grootel, V; Vauclair, S D; Ventura, P; Wagner, F W; Walton, N A; Weingrill, J; Werner, S C; Wheatley, P J; Zwintz, K

    2013-01-01

    PLATO 2.0 is a mission candidate for ESA's M3 launch opportunity (2022/24). It addresses fundamental questions such as: How do planetary systems form and evolve? Are there other systems with planets like ours, able to develop life? The PLATO 2.0 instrument consists of 34 small aperture telescopes providing a wide field-of-view and a large photometric magnitude range. It targets bright stars in wide fields to detect and characterize planets down to Earth-size by photometric transits, whose masses can then be determined by ground-based radial-velocity follow-up measurements. Asteroseismology will be performed for stars <=11mag to obtain highly accurate stellar parameters, including masses and ages. The combination of bright targets and asteroseismology results in high accuracy for the bulk planet parameters: 2%, 4-10% and 10% for planet radii, masses and ages, respectively. The foreseen baseline observing strategy includes two long pointings (2-3 years) to detect and bulk characterize planets reaching into t...

  18. Plato on Metaphysical Explanation: Does 'Participating' Mean Nothing?

    Directory of Open Access Journals (Sweden)

    Christine J. Thomas

    2014-12-01

    Full Text Available According to Aristotle, Plato's efforts at metaphysical explanation not only fail, they are nonsensical. In particular, Plato's appeals to Forms as metaphysically explanatory of the sensibles that participate in them is "empty talk" since "'participating' means nothing" (Met. 992a28-9. I defend Plato against Aristotle's charge by identifying a particular, substantive model of metaphysical predication as the favored model of Plato's late ontology. The model posits two basic metaphysical predication relations: self-predication and participation. In order to understand the participation relation, it is important first to understand how Plato's Forms are self-predicative paradigms. According to the favored model, Forms are self-predicative paradigms insofar as they are ideal, abstract encoders of structural essences. Sensibles participate in Forms by exemplifying the structures encoded in the Forms. Given plausible conditions on metaphysical explanation, Plato's appeals to abstract Forms as metaphysically explanatory of sensibles is a reasonable competitor for Aristotle's appeals to natural, substantial forms. At the very least, Plato's appeals to a participation relation are not empty.

  19. Technology validation of the PLATO CCD at ESA

    Science.gov (United States)

    Prod'homme, Thibaut; Verhoeve, Peter; Beaufort, Thierry; Duvet, Ludovic; Lemmel, Frederic; Smit, Hans; Blommaert, Sander; Oosterbroek, Tim; van der Luijt, Cornelis; Visser, Ivo; Heijnen, Jerko; Butler, Bart

    2016-07-01

    PLATO { PLAnetary Transits and Oscillations of stars { is the third medium-class mission to be selected in the European Space Agency (ESA) Science and Robotic Exploration Cosmic Vision programme. Due for launch in 2025, the payload makes use of a large format (8 cm x 8 cm) Charge-Coupled Devices (CCDs) the e2v CCD270 operated at 4 MHz. The manufacture of such large device in large quantity constitutes an unprecedented effort. To de-risk the PLATO CCD procurement and aid the mission definition process, ESA's Payload Technology Validation team is characterizing the electro-optical performance of a number of PLATO devices before and after proton irradiation.

  20. A scientific approach to Plato's Atlantis

    Directory of Open Access Journals (Sweden)

    Massimo Rapisarda

    2015-09-01

    Full Text Available The myth of Atlantis is hard to die. This attempt to use scientific evidence to give it the final smash ends up with the doubt that it might not be totally unsubstantiated. The time of the supposed existence of Atlantis (around twelve thousand years ago was, in fact, characterized by technological revolutions, acknowledged by archaeology, and abrupt climate changes, documented by geology. In principle, it cannot therefore be ruled out that some of those dramatic events left a memory, later used by Plato as a basis for its tale. The climate changes involved the majority of the northern hemisphere, thus all the ancient civilizations (Egyptian, Mesopotamian, Indian and Chinese could have preserved reminiscence, but it is clear that the events occurring closer to Greece would have been more accessible to Plato. Among the Mediterranean sites that experienced the cataclysms of the beginning of the Holocene, a good candidate to host a primordial civilization might have been the archipelago then existing in the Strait of Sicily, a natural maritime link between Tunisia and Italy, prized by the presence of an obsidian source at Pantelleria. Eleven thousand five hundred years ago, a sudden sea level rise erased the archipelago, submerging the possible settlements, but Pantelleria obsidian ores are still there and could provide a significant clue. In fact, the potential discovery of artefacts, originating from a source now submerged by the sea level rise, would imply that the collection of the mineral took place when it was still emerged, namely at the time of Atlantis. Even if such discovery would not be sufficient to prove the existence of the mythical island, it would be enough to shake up the timeline of the human occupation in the region.

  1. Intra-Socratic Polemics: The Symposia of Plato and Xenophon

    Directory of Open Access Journals (Sweden)

    Gabriel Danzig

    2010-11-01

    Full Text Available Textual relationships between the two Symposia suggest that Xenophon wrote first, prompting Plato to write Socrates' critique of Phaedrus, to which Xenophon responded by appending his ch. 8.

  2. Rationality and Motivation: Moral Psychology in Plato's Socratic Dialogues

    OpenAIRE

    Ivars Neiders

    2011-01-01

    "Rationality and Motivation: Moral Psychology in Plato's Socratic Dialogues" Annotation The dissertation "Rationality and Motivation: Moral Psychology in Plato's Socratic Dialogues" is a philosophical study of Socratic views in moral psychology. Particular attention is paid to what the author calls (1) Doxastic competence and (2) Orectic competence. It is argued that according to Socrates these two different epistemic relations are important aspects of our self-understanding. The doxast...

  3. What Plato and Murdoch Think About Love

    Directory of Open Access Journals (Sweden)

    Shadi Shakouri

    2012-07-01

    Full Text Available There are many interpretations of love and lots of scholars write and talk on love; however, what exactly is the meaning of love? Iris Murdoch’s works are an accumulation of emotional relationships and feelings of love. Her great subject is love, both sexual and non-sexual, and her characters are the portrayal of a small group of people caught up in convoluted ties of love and hate, with Eros ruling over them (Cohen 22. Murdoch was one of the most respected British writers and philosophers of the second half of the twentieth century and, of course, the postwar period. In Murdoch’s novels, love is one of the central themes—marriage, as the institution of love, more often binds than frees. Her characters are mainly ego-centric people who struggle to love and are often overwhelmed by the factor of self-obsession, jealousy, ambition, fascination with suffering and charismatic power. They are absolutely ordinary people with a consuming demand for love, and mental and physical exile. Murdoch was inspired by Plato’s ideas in many ways. Like art, here again Plato’s idea of love is more skeptical than Murdoch’s, whereas Murdoch kept it only as a way to the Good, creation, and happiness. Murdoch and Plato saw love more as a Freudian concept, the Eros, the word that comes from the name of the first Greek god of love. Both the philosophers, Plato and Murdoch, believed that this erotic longing and desires revived by Eros can led to a new direction, a way toward virtue and truth. Her protagonist or marginalized characters are usually tackling it with either vulgarity or the heavenly, which results in creation, art or salvation. Murdoch, as a major moral philosopher, usually grasps the chances to encapsulate her moral visions in her works, and created novels that should be counted as meditations on human love and goodness. Keywords: Eros, erotic love and real artwork, moral philosopher, The Black Prince

  4. Reversing Plato’s Anti-Democratism: Castoriadis’ “Quirky” Plato

    OpenAIRE

    Wendy C. Hamblet

    2008-01-01

    This paper considers the conflicting "loves" of Cornelius Castoriadis--his love for the ancients, and especially Plato, and for the common person of the demos. A detailed study of Castoriadis' analysis of Plato's Statesman exposes that Castoriadis attempts to resolve the paradox by rereading Plato as a radical democrat. I argue that this unorthodox reading is at best "quirky, " (a charge Castoriadis levels at Plato) at worst a groundless sophism. However, I conjecture that Castoriadis' readin...

  5. Eugenics concept: from Plato to present.

    Science.gov (United States)

    Güvercin, C H; Arda, B

    2008-01-01

    All prospective studies and purposes to improve cure and create a race that would be exempt of various diseases and disabilities are generally defined as eugenic procedures. They aim to create the "perfect" and "higher" human being by eliminating the "unhealthy" prospective persons. All of the supporting actions taken in order to enable the desired properties are called positive eugenic actions; the elimination of undesired properties are defined as negative eugenics. In addition, if such applications and approaches target the public as a whole, they are defined as macro-eugenics. On the other hand, if they only aim at individuals and/or families, they are called micro-eugenics. As generally acknowledged, Galton re-introduced eugenic proposals, but their roots stretch as far back as Plato. Eugenic thoughts and developments were widely accepted in many different countries beginning with the end of the 19th to the first half of the 20th centuries. Initially, the view of negative eugenics that included compulsory sterilizations of handicapped, diseased and "lower" classes, resulted in tens of thousands being exterminated especially in the period of Nazi Germany. In the 1930s, the type of micro positive eugenics movement found a place within the pro-natalist policies of a number of countries. However, it was unsuccessful since the policy was not able to become effective enough and totally disappeared in the 1960s. It was no longer a fashionable movement and left a deep impression on public opinion after the long years of war. However, developments in genetics and its related fields have now enabled eugenic thoughts to reappear under the spotlight and this is creating new moral dilemmas from an ethical perspective.

  6. Positure in Plato's Laws: An Introduction to Figuration on Civic Education

    Science.gov (United States)

    Hall, Joshua M.

    2016-01-01

    Purpose: The aim of the research was to determine the benefits of applying the new Figuration philosophy of dance, based in part on Plato, to civic education. Design/methodology: A close phenomenological reading of Plato's "The Laws," with a strategic focus on its account of the concept of posture. Findings: Plato considers posture to be…

  7. Plato's Cosmic Theology: A Rationale for a Polytheistic Astrology?

    Science.gov (United States)

    Henriques, André

    2015-05-01

    Plato's cosmology influenced classical astronomy and religion, but was in turn influenced by the polytheistic context of its time. Throughout his texts, including the cosmological treatise Timaeus, and the discussions on the soul in the Phaedrus, Plato (c.428-c.348 BC) established what can be generalised as Platonic cosmological thought. An understanding of the philosophical and mythical levels of Platonic thought can provide a rationale for polytheistic and astrological worldviews, pointing to some cosmological continuity, alongside major shifts, from ancient Greek religion to the astrological thought of ancient astronomers such as Claudius Ptolemy.

  8. ESA's CCD test bench for the PLATO mission

    Science.gov (United States)

    Beaufort, Thierry; Duvet, Ludovic; Bloemmaert, Sander; Lemmel, Frederic; Prod'homme, Thibaut; Verhoeve, Peter; Smit, Hans; Butler, Bart; van der Luijt, Cornelis; Heijnen, Jerko; Visser, Ivo

    2016-08-01

    PLATO { PLAnetary Transits and Oscillations of stars { is the third medium-class mission to be selected in the European Space Agency (ESA) Science and Robotic Exploration Cosmic Vision programme. Due for launch in 2025, the payload makes use of a large format (8 cm x 8 cm) Charge-Coupled Devices (CCDs), the e2v CCD270 operated at 4 MHz and at -70 C. To de-risk the PLATO CCD qualification programme initiated in 2014 and support the mission definition process, ESA's Payload Technology Validation section from the Future Missions Office has developed a dedicated test bench.

  9. A Data Bank Experience on the PLATO System.

    Science.gov (United States)

    Schwab, Wallace; St-Denis, Richard

    1980-01-01

    Current theories on terminology and lexicography which underlie the logical components of the terminology bank set up on the PLATO system and established standards are briefly presented. The units that were essential to developing the bank are discussed. References are listed. (Author)

  10. Plato and Play: Taking Education Seriously in Ancient Greece

    Science.gov (United States)

    D'Angour, Armand

    2013-01-01

    In this article, the author outlines Plato's notions of play in ancient Greek culture and shows how the philosopher's views on play can be best appreciated against the background of shifting meanings and evaluations of play in classical Greece. Play--in various forms such as word play, ritual, and music--proved central to the development of…

  11. Stonecutter Mills, Inc., Isothermal Community College. PLATO Evaluation Series.

    Science.gov (United States)

    Sherman, Greg

    Stonecutter Mills, Inc., is a textile manufacturing company with a major production facility in Spindale, North Carolina. In the past few years, Stonecutter Mills employees have been given an opportunity to spend up to 2 hours a week on company time to participate in PLATO-supported learning at Isothermal Community College. Employees could choose…

  12. Future development of the PLATO Observatory for Antarctic science

    Science.gov (United States)

    Ashley, Michael C. B.; Bonner, Colin S.; Everett, Jon R.; Lawrence, Jon S.; Luong-Van, Daniel; McDaid, Scott; McLaren, Campbell; Storey, John W. V.

    2010-07-01

    PLATO is a self-contained robotic observatory built into two 10-foot shipping containers. It has been successfully deployed at Dome A on the Antarctic plateau since January 2008, and has accumulated over 730 days of uptime at the time of writing. PLATO provides 0.5{1kW of continuous electrical power for a year from diesel engines running on Jet-A1, supplemented during the summertime with solar panels. One of the 10-foot shipping containers houses the power system and fuel, the other provides a warm environment for instruments. Two Iridium satellite modems allow 45 MB/day of data to be transferred across the internet. Future enhancements to PLATO, currently in development, include a more modular design, using lithium iron-phosphate batteries, higher power output, and a light-weight low-power version for eld deployment from a Twin Otter aircraft. Technologies used in PLATO include a CAN (Controller Area Network) bus, high-reliability PC/104 com- puters, ultracapacitors for starting the engines, and fault-tolerant redundant design.

  13. The CGE-PLATO Electronic Laboratory Station Structure and Operation.

    Science.gov (United States)

    Neal, J. P.

    An electronic laboratory station was designed for student use in learning electronic instrumentation and measurement by means of the computer-guided experimentation (CGE) system. The station features rack-mounted electronic laboratory equipment on a laboratory table adjacent to a PLATO IV terminal. An integrated logic system behind the laboratory…

  14. Pursuing the Good, Ethics and Metaphysics in Plato s Republic

    Institute of Scientific and Technical Information of China (English)

    Douglas; Cairns; Fritz-Gregor; Herrmann; Terry; Penner

    2008-01-01

    ‘Pursuing the good’ is an old subject in both social history of ancient Greece and Greek philosophy studies. There is hardly anything new when we talk about virtue or morality in the time of Plato and Aristotle. In the area of Greek history, many books and articles on or relevant to that

  15. Eschatological narrative in Plato: between logos and myth

    Directory of Open Access Journals (Sweden)

    Francesc Casadesús Bordoy

    2016-08-01

    Full Text Available In his dialogues, Plato frequently resorted to alternate and intertwine his dialectic expositions with images and allegories, aiming to illustrate his arguments. This paper analyses in detail his use of the opposition between logos and myth tointroduce his descriptions of Hades

  16. Go Tell Alcibiades: Tragedy, Comedy, and Rhetoric in Plato's "Symposium"

    Science.gov (United States)

    Crick, Nathan; Poulakos, John

    2008-01-01

    Plato's "Symposium" is a significant but neglected part of his elaborate and complex attitude toward rhetoric. Unlike the intellectual discussion of the "Gorgias" or the unscripted conversation of the "Phaedrus," the "Symposium" stages a feast celebrating and driven by the forces of "Eros." A luxuriously stylish performance rather than a rational…

  17. The Cost of PLATO in a University Environment.

    Science.gov (United States)

    Hofstetter, Fred T.

    1983-01-01

    This analysis of the cost-effectiveness of the University of Delaware's own PLATO system discusses the initial expense of acquiring the system, decreases in unit cost as number of users increased, capital investment in hardware, expenditures and funding sources, comparisons of actual and projected costs, and benefits of individualized instruction.…

  18. Second Summative Report of the Delaware PLATO Project.

    Science.gov (United States)

    Hofstetter, Fred T.

    Begun on an experimental basis in March 1975, the ongoing PLATO project at the University of Delaware has become an established part of the University's academic program. This descriptive report is divided into three sections: (1) project history and development, including organization, utilization, instructor and author training, and projections…

  19. Dodecahedrane—The chemical transliteration of Plato's universe (A Review)

    Science.gov (United States)

    Paquette, Leo A.

    1982-07-01

    The development of chemical interest in three of Plato's five convex polyhedra is described from an historical perspective. The successful synthesis of 1,16-dimethyldodecahedrane and its structural characteristics are outlined. Finally, an account of recent work leading to the still more aesthetically appealing and ultrasymmetric parent dodecahedrane is given.

  20. Arete and physics: The lesson of Plato's "Timaeus"

    Science.gov (United States)

    Wolfe, John R.

    Plato's Timaeus is traditionally read as a work dedicated to the sole purpose of describing the origin and nature of the cosmos, as a straightforward attempt by Plato to produce a peri phuseos treatise. In accord with this reading, the body of Timaeus' monologue is then seen as nothing more than an attempt by Plato to convey his own cosmological doctrines. I propose an alternative to the view that the Timaeus is nothing more than a textbook of Platonic physics. The Timaeus is rather squarely focused on the human being, in her moral and political dimensions, and on her relation to the natural world as a whole. Ultimately, this account of the human being is intended to provide part of the answer to the question of how society can produce good citizens and leaders, and thus serves to provide a theoretical basis for the practices of paideia. When viewed in this light many of the curious features of the Timaeus appear less strange. The various parts of the dialogue: the dramatic introduction, Critias' tale of the Ancient Athenians, and Timaeus' monologue can be seen as each contributing to an investigation of a single topic. It further allows us to understand why Plato chooses to employ Timaeus the Locrian as the principle speaker of the dialogue rather than Socrates. Finally, when read in this way, the Timaeus no longer appears as an outlier in the Platonic corpus, as a work devoted to a radically different subject matter than the rest of his writings. It can be seen as dedicated to the same issues which preoccupied Plato throughout his entire life, as about the determination of the best life and providing the tools with which to realize it.

  1. Teaching Early Mathematics with PLATO[R] Software: An Overview of the New PLATO Elementary Mathematics Curricula and How To Use Them. Technical Paper.

    Science.gov (United States)

    Quinn, Bill; Foshay, Rob; Morris, Barbara

    The "PLATO[R] Math Expeditions" and "PLATO[R] Projects for the Real World" curricula are designed to implement effective, research-based instructional practices. "Math Expeditions" is designed to give elementary grade users the mathematics skills and practice needed to solve real-life problems. Across the eight…

  2. THE JOURNEY OF TRUTH: FROM PLATO TO ZOLA

    Directory of Open Access Journals (Sweden)

    Ribut Basuki

    1999-01-01

    Full Text Available Western theater theory and criticism is generally considered to be set forth by the Greeks. Plato was "the first theater critic" with his negative comments about theater owing to his idealistic views about "the truth." Then came Aristotle who used a different viewpoint from that of Plato, saying that there is "truth" in theater. However, hostile criticism on theater came back in the Middle Ages, championed by Tertulian before Aristotelian theory was revived by the neo-classicists such as Scaliger and Castelvetro. Theater theory and criticism discourse was then made more alive by the romanticists who disagreed with the neo-classicists' rigid rules on theater. As the influence of science became dominant in the theater world, naturalism and realism emerged and became the mainstream of theater theory and criticism until well into the twentieth century.

  3. The necessity of dialectics according to Plato and Adorno

    DEFF Research Database (Denmark)

    Olsen, Anne-Marie Eggert

    2009-01-01

    The paper deals with the notion of philosophy as, on the one hand, an academic or scientific discipline and, on the other, something perhaps superior to the disciplines and in any case dealing with what is not a 'disciplinary' matter. Through an interpretation of Plato's concept of dialectics and...... and Adorno's understanding of philosophy as expression (Ausdruck) it is proposed that this two-fold nature of philosophy is what makes dialectics necessary....

  4. The Strip Module

    DEFF Research Database (Denmark)

    Pedersen, Tommy

    1996-01-01

    -ship code available at the department. It will be structured as a general preprocessor mainly to determine the hydrodynamic mass and damping. A strip processor including three different theories: A linear frequency domain strip theory, a quadratic strip theory and a nonlinear time domain strip theory...

  5. Optical and dark characterization of the PLATO CCD at ESA

    Science.gov (United States)

    Verhoeve, Peter; Prod'homme, Thibaut; Oosterbroek, Tim; Duvet, Ludovic; Beaufort, Thierry; Blommaert, Sander; Butler, Bart; Heijnen, Jerko; Lemmel, Frederic; van der Luijt, Cornelis; Smit, Hans; Visser, Ivo

    2016-07-01

    PLATO - PLAnetary Transits and Oscillations of stars - is the third medium-class mission (M3) to be selected in the European Space Agency (ESA) Science and Robotic Exploration Cosmic Vision programme. It is due for launch in 2025 with the main objective to find and study terrestrial planets in the habitable zone around solar-like stars. The payload consists of >20 cameras; with each camera comprising 4 Charge-Coupled Devices (CCDs), a large number of flight model devices procured by ESA shall ultimately be integrated on the spacecraft. The CCD270 - specially designed and manufactured by e2v for the PLATO mission - is a large format (8 cm x 8 cm) back-illuminated device operating at 4 MHz pixel rate and coming in two variants: full frame and frame transfer. In order to de-risk the PLATO CCD procurement and aid the mission definition process, ESA's Payload Technology Validation section is currently validating the PLATO CCD270. This validation consists in demonstrating that the device achieves its specified electrooptical performance in the relevant environment: operated at 4 MHz, at cold and before and after proton irradiation. As part of this validation, CCD270 devices have been characterized in the dark as well as optically with respect to performance parameters directly relevant for the photometric application of the CCDs. Dark tests comprise the measurement of gain sensitivity to bias voltages, charge injection tests, and measurement of hot and variable pixels after irradiation. In addition, the results of measurements of Quantum Efficiency for a range of angles of incidence, intra- pixel response (non-)uniformity, and response to spot illumination, before and after proton irradiation. In particular, the effect of radiation induced degradation of the charge transfer efficiency on the measured charge in a star-like spot has been studied as a function of signal level and of position on the pixel grid, Also, the effect of various levels of background light on the

  6. Approximate strip exchanging.

    Science.gov (United States)

    Roy, Swapnoneel; Thakur, Ashok Kumar

    2008-01-01

    Genome rearrangements have been modelled by a variety of primitives such as reversals, transpositions, block moves and block interchanges. We consider such a genome rearrangement primitive Strip Exchanges. Given a permutation, the challenge is to sort it by using minimum number of strip exchanges. A strip exchanging move interchanges the positions of two chosen strips so that they merge with other strips. The strip exchange problem is to sort a permutation using minimum number of strip exchanges. We present here the first non-trivial 2-approximation algorithm to this problem. We also observe that sorting by strip-exchanges is fixed-parameter-tractable. Lastly we discuss the application of strip exchanges in a different area Optical Character Recognition (OCR) with an example.

  7. The Strip Module

    DEFF Research Database (Denmark)

    Pedersen, Tommy

    1996-01-01

    When the behaviour of a ship in waves is to be predicted it is convenient to have a tool which includes different approaches to the problem.The aim of this project is to develop such a tool named the strip theory module. The strip theory module will consist of submodules dependent on the I......-ship code available at the department. It will be structured as a general preprocessor mainly to determine the hydrodynamic mass and damping. A strip processor including three different theories: A linear frequency domain strip theory, a quadratic strip theory and a nonlinear time domain strip theory...

  8. The Philosopher's Arete or theStructure of Plato's Parmenides

    Directory of Open Access Journals (Sweden)

    Raúl Gutierrez

    1998-12-01

    Full Text Available The controversy conceming the unity of Plato's Parmenides and the meaning of its first part is stillongoing. The A. proposes a solution, pointing out its structural coincidence with the Republic's simile of the line. This leads him to confine young Socrates in the segment that corresponds to óuivoux and old Parmenides in the vór¡olc; segment. As the one who "possesses insight" of truth based on his apprehension of the One-Good. Parmenides is the actual representative of the philosopher's arete.

  9. Tibial plato leveling osteotomy / Osteotomia de nivelamento do plato da tíbia

    Directory of Open Access Journals (Sweden)

    Julia Maria Matera

    2008-08-01

    Full Text Available The tibial plateau leveling osteotomy (TPLO is a relatively new and innovative surgical treatment for the cranial cruciate ligament rupture in the canine species. The real intent of the procedure is to provide functional stability to the stifle joint by eliminating or neutralizing the cranial tibial thrust during weight bearing instead to restore the cranial cruciate ligament function. The proposal of this study is to report a review of the TPLO procedure, emphasizing procedure, surgical technique, post operative care and complications. The TPLO procedure consists in a radial osteotomy in the tibial plato and rotation of the caudal plateau in order to obtain a desired angle. After the leveling of the tibial plateau, a bone plate and screws are used to stabilize the osteotomy until bone is healed up. The complications that have been associated with the procedure include tibial tuberosity fracture and patellar tendon tendinosis. This procedure has become increasingly more popular for surgical treatment of cranial cruciate ligament injuries in large breed dog. The long term clinical results have not been completely elucidated yet. It has been showed that this technique doesn’t halt the degenerative joint disease.A osteotomia do platô da tíbia (TPLO é um tratamento relativamente novo e inovador para a ruptura do ligamento cruzado cranial (RLCC na espécie canina. Ao invés de restaurar a função do ligamento, o procedimento promove estabilidade funcional para a articulação do joelho, por eliminar ou neutralizar a força tibial cranial durante a sustentação de peso. A proposta do presente estudo é revisar a técnica de TPLO, enfatizando o procedimento, técnica cirúrgica, cuidados pós-operatórios e complicações. A técnica da TPLO consiste na realização de uma osteotomia circular do platô da tíbia com rotação de sua porção caudal até a obtenção do ângulo desejado. Após o nivelamento do platô da tíbia, placa e parafusos

  10. Reversing Plato’s Anti-Democratism: Castoriadis’ “Quirky” Plato

    Directory of Open Access Journals (Sweden)

    Hamblet, Wendy C.

    2008-12-01

    Full Text Available This paper considers the conflicting "loves" of Cornelius Castoriadis--his love for the ancients, and especially Plato, and for the common person of the demos. A detailed study of Castoriadis' analysis of Plato's Statesman exposes that Castoriadis attempts to resolve the paradox by rereading Plato as a radical democrat. I argue that this unorthodox reading is at best "quirky, " (a charge Castoriadis levels at Plato at worst a groundless sophism. However, I conjecture that Castoriadis' reading may not constitute a serious attempt to describe a Platonic politics, so much as a prescriptive reading of what otherwise might have been, given certain strands of political generosity evident elsewhere in Plato's corpus.

  11. Varicose vein stripping

    Science.gov (United States)

    ... vein stripping; Venous reflux - vein stripping; Venous ulcer - veins Images Circulatory system References American Family Physician. Management of varicose veins. www.aafp.org/afp/2008/1201/p1289.html . ...

  12. Radiation, Thermal Gradient and Weight: a threefold dilemma for PLATO

    Science.gov (United States)

    Magrin, Demetrio; Ragazzoni, Roberto; Bruno, Giordano; Piazza, Daniele; Borsa, Francesco; Ghigo, Mauro; Mogulsky, Valery; Bergomi, Maria; Biondi, Federico; Chinellato, Simonetta; Dima, Marco; Farinato, Jacopo; Greggio, Davide; Gullieuszik, Marco; Marafatto, Luca; Viotto, Valentina; Munari, Matteo; Pagano, Isabella; Sicilia, Daniela; Basso, Stefano; Spiga, Daniele; Bandy, Timothy; Brändli, Mathias; Benz, Willy; De Roche, Thierry; Rieder, Martin; Brandeker, Alexis; Klebor, Maximilian; Schweitzer, Mario; Wieser, Matthias; Erikson, Anders; Rauer, Heike

    2016-07-01

    The project PLAnetary Transits and Oscillations of stars (PLATO) is one of the selected medium class (M class) missions in the framework of the ESA Cosmic Vision 2015-2025 program. The mean scientific goal of PLATO is the discovery and study of extrasolar planetary systems by means of planetary transits detection. The opto mechanical subsystem of the payload is made of 32 normal telescope optical units (N-TOUs) and 2 fast telescope optical units (FTOUs). The optical configuration of each TOU is an all refractive design based on six properly optimized lenses. In the current baseline, in front of each TOU a Suprasil window is foreseen. The main purposes of the entrance window are to shield the following lenses from possible damaging high energy radiation and to mitigate the thermal gradient that the first optical element will experience during the launch from ground to space environment. In contrast, the presence of the window increases the overall mass by a non-negligible quantity. We describe here the radiation and thermal analysis and their impact on the quality and risks assessment, summarizing the trade-off process with pro and cons on having or dropping the entrance window in the optical train.

  13. Manufacturing and alignment tolerance analysis through Montecarlo approach for PLATO

    Science.gov (United States)

    Magrin, Demetrio; Ragazzoni, Roberto; Bergomi, Maria; Biondi, Federico; Chinellato, Simonetta; Dima, Marco; Farinato, Jacopo; Greggio, Davide; Gullieuszik, Marco; Marafatto, Luca; Viotto, Valentina; Munari, Matteo; Pagano, Isabella; Sicilia, Daniela; Basso, Stefano; Borsa, Francesco; Ghigo, Mauro; Spiga, Daniele; Bandy, Timothy; Brändli, Mathias; Benz, Willy; Bruno, Giordano; De Roche, Thierry; Piazza, Daniele; Rieder, Martin; Brandeker, Alexis; Klebor, Maximilian; Mogulsky, Valery; Schweitzer, Mario; Wieser, Matthias; Erikson, Anders; Rauer, Heike

    2016-07-01

    The project PLAnetary Transits and Oscillations of stars (PLATO) is one of the selected medium class (M class) missions in the framework of the ESA Cosmic Vision 2015-2025 program. The main scientific goal of PLATO is the discovery and study of extrasolar planetary systems by means of planetary transits detection. According to the current baseline, the scientific payload consists of 34 all refractive telescopes having small aperture (120mm) and wide field of view (diameter greater than 37 degrees) observing over 0.5-1 micron wavelength band. The telescopes are mounted on a common optical bench and are divided in four families of eight telescopes with an overlapping line-of-sight in order to maximize the science return. Remaining two telescopes will be dedicated to support on-board star-tracking system and will be specialized on two different photometric bands for science purposes. The performance requirement, adopted as merit function during the analysis, is specified as 90% enclosed energy contained in a square having size 2 pixels over the whole field of view with a depth of focus of +/-20 micron. Given the complexity of the system, we have followed a Montecarlo analysis approach for manufacturing and alignment tolerances. We will describe here the tolerance method and the preliminary results, speculating on the assumed risks and expected performances.

  14. Love as an Object of Initiation in Plato's Philosophy

    Directory of Open Access Journals (Sweden)

    Euaggelia Maraggianou

    2007-07-01

    Full Text Available Initiation ( muvhsh was the first stage of the ancient mysteries celebrating Demeter, the earth-goddess, and her daughter Kore, soon identified with Persephone or Persephasa, a pre-Greek deity of the underworld. Next came the stage of contemplation ( ejpopteiva , at which worshippers were shown a vision of the goddess of Hades. This led them to identify themselves with her, thus reaching the highest form of happiness. The Eleusinian Mysteries were inseparably linked to the Orphic doctrine, which in its turn influenced the thought of Plato. Plato sees love as an object of initiation and as one of the greatest mysteries of human existence. Plato’s dialogues, Phaedrus and Symposium, contain expressions borrowed directly from the vocabulary of the Mysteries. Although neither Socrates in Phaedrus nor Diotima in Symposium make any explicit reference to the mystic ceremonies, it is certain that both allude to them in expounding the mysteries of spiritual life. The latter has to start at the stage of physical love in order to end up in the contemplation of Ideas. The mystery into which Socrates is initiated by Diotima is the following: there is a mystic stairway leading from the earth to the sky, from man to God. It is made visible by Love, and its steps are represented by different kinds of beauty. The ascent is a gradual one, with a long stop at each of the stages. In this way Love, disciplined by philosophy and spiritualised by increasing de-personalisation, ends up in the Intellectual, conceiving the latter with an intuitive insight. By this spiritual process, one is purified, led to the road of salvation and enabled to participate in the Divine.

  15. PLATO as it is : A legacy mission for Galactic archaeology

    Science.gov (United States)

    Miglio, A.; Chiappini, C.; Mosser, B.; Davies, G. R.; Freeman, K.; Girardi, L.; Jofré, P.; Kawata, D.; Rendle, B. M.; Valentini, M.; Casagrande, L.; Chaplin, W. J.; Gilmore, G.; Hawkins, K.; Holl, B.; Appourchaux, T.; Belkacem, K.; Bossini, D.; Brogaard, K.; Goupil, M.-J.; Montalbán, J.; Noels, A.; Anders, F.; Rodrigues, T.; Piotto, G.; Pollacco, D.; Rauer, H.; Prieto, C. Allende; Avelino, P. P.; Babusiaux, C.; Barban, C.; Barbuy, B.; Basu, S.; Baudin, F.; Benomar, O.; Bienaymé, O.; Binney, J.; Bland-Hawthorn, J.; Bressan, A.; Cacciari, C.; Campante, T. L.; Cassisi, S.; Christensen-Dalsgaard, J.; Combes, F.; Creevey, O.; Cunha, M. S.; Jong, R. S.; Laverny, P.; Degl'Innocenti, S.; Deheuvels, S.; Depagne, É.; Ridder, J.; Matteo, P. Di; Mauro, M. P. Di; Dupret, M.-A.; Eggenberger, P.; Elsworth, Y.; Famaey, B.; Feltzing, S.; García, R. A.; Gerhard, O.; Gibson, B. K.; Gizon, L.; Haywood, M.; Handberg, R.; Heiter, U.; Hekker, S.; Huber, D.; Ibata, R.; Katz, D.; Kawaler, S. D.; Kjeldsen, H.; Kurtz, D. W.; Lagarde, N.; Lebreton, Y.; Lund, M. N.; Majewski, S. R.; Marigo, P.; Martig, M.; Mathur, S.; Minchev, I.; Morel, T.; Ortolani, S.; Pinsonneault, M. H.; Plez, B.; Moroni, P. G. Prada; Pricopi, D.; Recio-Blanco, A.; Reylé, C.; Robin, A.; Roxburgh, I. W.; Salaris, M.; Santiago, B. X.; Schiavon, R.; Serenelli, A.; Sharma, S.; Aguirre, V. Silva; Soubiran, C.; Steinmetz, M.; Stello, D.; Strassmeier, K. G.; Ventura, P.; Ventura, R.; Walton, N. A.; Worley, C. C.

    2017-07-01

    Deciphering the assembly history of the Milky Way is a formidable task, which becomes possible only if one can produce high-resolution chrono-chemo-kinematical maps of the Galaxy. Data from large-scale astrometric and spectroscopic surveys will soon provide us with a well-defined view of the current chemo-kinematical structure of the Milky Way, but will only enable a blurred view on the temporal sequence that led to the present-day Galaxy. As demonstrated by the (ongoing) exploitation of data from the pioneering photometric missions CoRoT, Kepler, and K2, asteroseismology provides the way forward: solar-like oscillating giants are excellent evolutionary clocks thanks to the availability of seismic constraints on their mass and to the tight age-initial-mass relation they adhere to. In this paper we identify five key outstanding questions relating to the formation and evolution of the Milky Way that will need precise and accurate ages for large samples of stars to be addressed, and we identify the requirements in terms of number of targets and the precision on the stellar properties that are needed to tackle such questions. By quantifying the asteroseismic yields expected from PLATO for red-giant stars, we demonstrate that these requirements are within the capabilities of the current instrument design, provided that observations are sufficiently long to identify the evolutionary state and allow robust and precise determination of acoustic-mode frequencies. This will allow us to harvest data of sufficient quality to reach a 10% precision in age. This is a fundamental pre-requisite to then reach the more ambitious goal of a similar level of accuracy, which will only be possible if we have to hand a careful appraisal of systematic uncertainties on age deriving from our limited understanding of stellar physics, a goal which conveniently falls within the main aims of PLATO's core science.

  16. Control of Cimex lectularius using heat combined with dichlorvos resin strips.

    Science.gov (United States)

    Lehnert, M P; Pereira, R M; Koehler, P G; Walker, W; Lehnert, M S

    2011-12-01

    Successful management of the bed bug, Cimex lectularius L. (Hemiptera: Cimicidae), is difficult because of its pesticide resistance, which can allow a reduction in population, but not elimination. We evaluated the effect of heat and/or air circulation on the efficacy of dichlorvos resin strips in the control of bed bugs. Treatments were performed in unoccupied dormitory rooms and consisted of dichlorvos resin strips containing 18.6% active ingredient, the same strips + fan, and strips + fan + heat. The mortality of recently fed bed bugs and weight loss of the dichlorvos strips were evaluated over 7 days. Dichlorvos resin strips killed bed bugs and eggs in just over 7 days. The addition of a fan or a fan + heat decreased time to 100% mortality to 3 days and 36 h, respectively. Eggs located in treated rooms did not hatch. Resin strips in the strips + fan treatment and the strips + fan + heat treatment volatilized 10 and 70 times, respectively, faster than strips in the strips-only treatment. The addition of heat in treatments with dichlorvos resin strips enhances the overall efficacy of the volatile insecticide and reduces the time required to eliminate live bed bugs and eggs.

  17. Angiographic outcomes in the PLATO Trial (Platelet Inhibition and Patient Outcomes)

    National Research Council Canada - National Science Library

    Kunadian, Vijay; James, Stefan K; Wojdyla, Daniel M; Zorkun, Cafer; Wu, Jinhui; Storey, Robert F; Steg, Ph Gabriel; Katus, Hugo; Emanuelsson, Hakan; Horrow, Jay; Maya, Juan; Wallentin, Lars; Harrington, Robert A; Gibson, C Michael

    2013-01-01

    The PLATO (Platelet Inhibition and Patient Outcomes) angiographic substudy sought to compare the efficacy of ticagrelor versus clopidogrel with respect to angiographic outcomes before and after PCI in the setting of acute coronary syndrome...

  18. The Legacies of Literacy: From Plato to Freire through Harvey Graff.

    Science.gov (United States)

    Gee, James Paul

    1989-01-01

    Reviews "The Legacies of Literacy: Continuities and Contradictions in Western Culture and Society" (Harvey G. Graff). Discusses the historical role of literacy education as a tool for liberation, emphasizing the viewpoints of Plato and Freire. (FMW)

  19. Genesis 2–3 and Alcibiades's speech in Plato's Symposium : A ...

    African Journals Online (AJOL)

    Genesis 2–3 and Alcibiades's speech in Plato's Symposium : A cultural critical reading. ... interpretation can arise from the analysis of Alcibiades's speech compared to M- and LXX-Genesis ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  20. Prospects for detecting decreasing exoplanet frequency with main sequence age using PLATO

    CERN Document Server

    Veras, Dimitri; Mustill, Alexander J; Pollacco, Don

    2015-01-01

    The space mission PLATO will usher in a new era of exoplanetary science by expanding our current inventory of transiting systems and constraining host star ages, which are currently highly uncertain. This capability might allow PLATO to detect changes in planetary system architecture with time, particularly because planetary scattering due to Lagrange instability may be triggered long after the system was formed. Here, we utilize previously published instability timescale prescriptions to determine PLATO's capability to detect a trend of decreasing planet frequency with age for systems with equal-mass planets. For two-planet systems, our results demonstrate that PLATO may detect a trend for planet masses which are at least as massive as super-Earths. For systems with three or more planets, we link their initial compactness to potentially detectable frequency trends in order to aid future investigations when these populations will be better characterized.

  1. Plato's Charmides as a Political Act: Apologetics and the Promotion of Ideology

    National Research Council Canada - National Science Library

    Danzig, Gabriel

    2013-01-01

      By showing that Critias and Socrates understood the same matters differently, Plato was able to treat seriously ideas that came to be associated with the Thirty and with Socrates while shielding himself from criticism...

  2. Platerm: la banque de terminologie du systeme Platon (PLATERM: The Terminology Bank of the PLATO System).

    Science.gov (United States)

    Schwab, Wallace; St-Denis, Richard

    1980-01-01

    Describes the elements and functioning of the terminology bank of the PLATO (Programmed Loqic for Automated Teaching Operation) system. Discusses contemporary terminology and lexicography notions on which the bank is based and outlines the tasks performed through PLATERM. (MES)

  3. Platerm: la banque de terminologie du systeme Platon (PLATERM: The Terminology Bank of the PLATO System).

    Science.gov (United States)

    Schwab, Wallace; St-Denis, Richard

    1980-01-01

    Describes the elements and functioning of the terminology bank of the PLATO (Programmed Loqic for Automated Teaching Operation) system. Discusses contemporary terminology and lexicography notions on which the bank is based and outlines the tasks performed through PLATERM. (MES)

  4. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  5. Insecticide Compendium. MP-29.

    Science.gov (United States)

    Spackman, Everett W.; And Others

    This document presents information on most of the known insecticides and their general usage, toxicity, formulation, compound type, manufacturers, and the chemical, trade and common names applied to each compound. (CS)

  6. Insecticide Compendium. MP-29.

    Science.gov (United States)

    Spackman, Everett W.; And Others

    This document presents information on most of the known insecticides and their general usage, toxicity, formulation, compound type, manufacturers, and the chemical, trade and common names applied to each compound. (CS)

  7. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  8. More about Insecticides

    Directory of Open Access Journals (Sweden)

    E.K. Hartwig

    1980-09-01

    Full Text Available An insecticide is a chemical used to kill insects. Insect control can also include other materials such as repellents, oils, antifeedants and attractants. Ideally, an insecticide would effectively control any target insect exposed to it and would be harmless to man and his domestic animals. It would also be readily available in necessary quantitie s , s table chemically, noninflammable, easily prepared and applied, noncorrosive, non-staining, and would have no undesirable odour.

  9. Proteases as Insecticidal Agents

    OpenAIRE

    Robert L. Harrison; Bonning, Bryony C.

    2010-01-01

    Proteases from a variety of sources (viruses, bacteria, fungi, plants, and insects) have toxicity towards insects. Some of these insecticidal proteases evolved as venom components, herbivore resistance factors, or microbial pathogenicity factors, while other proteases play roles in insect development or digestion, but exert an insecticidal effect when over-expressed from genetically engineered plants or microbial pathogens. Many of these proteases are cysteine proteases, although insect-toxic...

  10. Anatomy Comic Strips

    Science.gov (United States)

    Park, Jin Seo; Kim, Dae Hyun; Chung, Min Suk

    2011-01-01

    Comics are powerful visual messages that convey immediate visceral meaning in ways that conventional texts often cannot. This article's authors created comic strips to teach anatomy more interestingly and effectively. Four-frame comic strips were conceptualized from a set of anatomy-related humorous stories gathered from the authors' collective…

  11. Science Comic Strips

    Science.gov (United States)

    Kim, Dae Hyun; Jang, Hae Gwon; Shin, Dong Sun; Kim, Sun-Ja; Yoo, Chang Young; Chung, Min Suk

    2012-01-01

    Science comic strips entitled Dr. Scifun were planned to promote science jobs and studies among professionals (scientists, graduate and undergraduate students) and children. To this end, the authors collected intriguing science stories as the basis of scenarios, and drew four-cut comic strips, first on paper and subsequently as computer files.…

  12. Anatomy Comic Strips

    Science.gov (United States)

    Park, Jin Seo; Kim, Dae Hyun; Chung, Min Suk

    2011-01-01

    Comics are powerful visual messages that convey immediate visceral meaning in ways that conventional texts often cannot. This article's authors created comic strips to teach anatomy more interestingly and effectively. Four-frame comic strips were conceptualized from a set of anatomy-related humorous stories gathered from the authors' collective…

  13. ALICE silicon strip module

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    This small silicon detector strip will be inserted into the inner tracking system (ITS) on the ALICE detector at CERN. This detector relies on state-of-the-art particle tracking techniques. These double-sided silicon strip modules have been designed to be as lightweight and delicate as possible as the ITS will eventually contain five square metres of these devices.

  14. Organophosphorus Insecticide Pharmacokinetics

    Energy Technology Data Exchange (ETDEWEB)

    Timchalk, Charles

    2010-01-01

    This chapter highlights a number of current and future applications of pharmacokinetics to assess organophosphate (OP) insecticide dosimetry, biological response and risk in humans exposed to these agents. Organophosphates represent a large family of pesticides where insecticidal as well as toxicological mode of action is associated with their ability to target and inhibit acetylcholinesterase (AChE). Pharmacokinetics entails the quantitative integration of physiological and metabolic processes associated with the absorption, distribution, metabolism and excretion (ADME) of drugs and xenobiotics. Pharmacokinetic studies provide important data on the amount of toxicant delivered to a target site as well as species-, age-, gender-specific and dose-dependent differences in biological response. These studies have been conducted with organophosphorus insecticides in multiple species, at various dose levels, and across different routes of exposure to understand their in vivo pharmacokinetics and how they contribute to the observed toxicological response. To access human exposure to organophosphorus insecticides, human pharmacokinetic studies have been conducted and used to develop biological monitoring strategies based on the quantitation of key metabolites in biological fluids. Pharmacokinetic studies with these insecticides are also useful to facilitate extrapolation of dosimetry and biological response from animals to humans and for the assessment of human health risk. In this regard, physiologically based pharmacokinetic and pharmacodynamic (PBPK/PD) models are being utilized to assess risk and understand the toxicological implications of known or suspected exposures to various insecticides. In this chapter a number of examples are presented that illustrate the utility and limitation of pharmacokinetic studies to address human health concerns associated with organophosphorus insecticides.

  15. Stripping with dry ice

    Science.gov (United States)

    Malavallon, Olivier

    1995-04-01

    Mechanical-type stripping using dry ice (solid CO2) consists in blasting particles of dry ice onto the painted surface. This surface can be used alone or in duplex according to type of substrate to be treated. According to operating conditions, three physical mechanisms may be involved when blasting dry ice particles onto a paint system: thermal shock, differential thermal contraction, and mechanical shock. The blast nozzle, nozzle travel speed, blast angle, stripping distance, and compressed air pressure and media flow rate influence the stripping quality and the uniformity and efficiency obtained.

  16. Resistance to Insecticides in Insects

    OpenAIRE

    2005-01-01

    In recent years, the frequent usage of insecticides in struggle aganist insects, has caused development of resistance to those chemicals in insects. The increase in dosage of insecticide used due to development of resistance in insects, causes important problems in terms of environment and human health. This study includes topics such as insecticides which are used frequently in insect struggle, insecticide resistant types, genetic changes posing resistance, enzymes of resistance and resistan...

  17. The PLATO Dome A site-testing observatory: Power generation and control systems

    Science.gov (United States)

    Lawrence, J. S.; Ashley, M. C. B.; Hengst, S.; Luong-van, D. M.; Storey, J. W. V.; Yang, H.; Zhou, X.; Zhu, Z.

    2009-06-01

    The atmospheric conditions above Dome A, a currently unmanned location at the highest point on the Antarctic plateau, are uniquely suited to astronomy. For certain types of astronomy Dome A is likely to be the best location on the planet, and this has motivated the development of the Plateau Observatory (PLATO). PLATO was deployed to Dome A in early 2008. It houses a suite of purpose-built site-testing instruments designed to quantify the benefits of Dome A site for astronomy, and science instruments designed to take advantage of the observing conditions. The PLATO power generation and control system is designed to provide continuous power and heat, and a high-reliability command and communications platform for these instruments. PLATO has run and collected data throughout the winter 2008 season completely unattended. Here we present a detailed description of the power generation, power control, thermal management, instrument interface, and communications systems for PLATO, and an overview of the system performance for 2008.

  18. Gaia and WEAVE/WxES: Supporting the PLATO Exoplanet Hunter

    Science.gov (United States)

    Walton, N. A.

    2016-10-01

    This paper briefly describes the powerful linkages between the Gaia and PLATO missions and the potential for WEAVE in the study of exoplanet populations, for instance through the proposed WxES survey. Gaia successfully launched in December 2013, and over the course of its nominal five year mission will discover, via their astrometric signatures, upwards of 20 000 massive Jupiter sized long period planets at distances out to several hundred parsecs around all star types. In addition Gaia will discover up to a thousand short period hot Jupiters around M stars. PLATO, to launch in 2024, will through precision photometry, observe in detail some million host stars, and will detect, via the transit technique, planets down to Earth masses. PLATO will observe two fields of over 2 000 square degrees for 2-3 years each. At least one of these will be in the northern hemisphere. WEAVE has the potential to provide detailed chemical characterization of the host stars of the Gaia and PLATO exoplanet systems. This will enable insights into, for instance, metallicity of the host star correlations against both massive exoplanets (perhaps confirming current relationships), and lower mass exoplanets. We note how the rapid exploitation of such a potential WEAVE survey could be achieved, utilizing the WEAVE processing systems being developed at the IoA, Cambridge, coupled with efficient interfaces to both Gaia and PLATO data products, that are also being generated at the IoA.

  19. The role of the poet in Plato's ideal cities of Callipolis and Magnesia

    Directory of Open Access Journals (Sweden)

    Gerard Naddaf

    2008-01-01

    Full Text Available Plato's attitude toward the poets and poetry has always been a flashpoint of debate, controversy and notoriety, but most scholars have failed to see their central role in the ideal cities of the Republic and the Laws, that is, Callipolis and Magnesia. In this paper, I argue that in neither dialogue does Plato "exile" the poets, but, instead, believes they must, like all citizens, exercise the expertise proper to their profession, allowing them the right to become full-fledged participants in the productive class. Moreover, attention to certain details reveals that Plato harnesses both positive and negative factors in poetry to bring his ideal cities closer to a practical realization. The status of the poet and his craft in this context has rarely to my knowledge been addressed.

  20. PLATO - the next-generation AASTINO for robotic site-testing on the Antarctic plateau

    Science.gov (United States)

    Hengst, S.; Lawrence, J.; Luong-van, D.; Everett, J.; Ashley, M. C. B.; Storey, J. W. V.; Hall, S.

    2006-08-01

    A new site-testing facility, PLATO (Plateau Observatory), is under development at UNSW for deployment to remote sites on the Antarctic Plateau including Dome A. The new facility will adopt many of the features of the AASTINO (Automated Astrophysical Site Testing InterNational Observatory) facility at Dome C. PLATO will autonomously control a flexible site testing and observing instrument suite, monitored via the Iridium satellite network. A challenging aspect of PLATO is to maximise the reliability of the power source while minimising fuel consumption. We are building a low pressure, low temperature environmental chamber to simulate operation at the highest altitudes (4,100 m at Dome A). Two types of engines will be tested: a single-cylinder diesel engine and a Stirling engine.

  1. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  2. Efficient methods for solving discrete topology design problems in the PLATO-N project

    DEFF Research Database (Denmark)

    Canh, Nam Nguyen; Stolpe, Mathias

    This paper considers the general multiple load structural topology design problems in the framework of the PLATO-N project. The problems involve a large number of discrete design variables and were modeled as a non-convex mixed 0–1 program. For the class of problems considered, a global optimizat......This paper considers the general multiple load structural topology design problems in the framework of the PLATO-N project. The problems involve a large number of discrete design variables and were modeled as a non-convex mixed 0–1 program. For the class of problems considered, a global...

  3. The quest for a poetics of goodness in plato and aristotle

    OpenAIRE

    Dairo Orozco

    2012-01-01

    The paper, which compares Plato and Aristotle’s different approaches towards artistic activity, is divided into three parts. The first part discusses Plato’s Ion on mimesis and technē, as well as the role that poetry plays in the Republic. The second section offers an account of Aristotle’s idea of happiness as the end of action. Thelast section of this study deals with an attempt to reconcile Plato and Aristotle’s attitude towards mimetic art in a treatise by a Neoplatonic renaissance thinke...

  4. A Similar Comparison between the Thought of Plato and Confucius on Social Hierarchy and Elitism

    Institute of Scientific and Technical Information of China (English)

    杨馥遥

    2014-01-01

    The spring-autumn period and warring state period of Chinese thoughts coincide strikingly with the thoughts of the Hel enic Age in the west. Plato and Confucius, the two outstanding seminal thinkers have shaped the philosophy of their respective cultures through some similar means and thoughts which definitely meet at a series of significant points. The highlight of the academic thesis lies in the comparison of the general similarities be-tween Plato and Confucius especial y in terms of social hierarchy and elitism.

  5. The PLATO End-to-End CCD Simulator -- Modelling space-based ultra-high precision CCD photometry for the assessment study of the PLATO Mission

    CERN Document Server

    Zima, W; De Ridder, J; Salmon, S; Catala, C; Kjeldsen, H; Aerts, C

    2010-01-01

    The PLATO satellite mission project is a next generation ESA Cosmic Vision satellite project dedicated to the detection of exo-planets and to asteroseismology of their host-stars using ultra-high precision photometry. The main goal of the PLATO mission is to provide a full statistical analysis of exo-planetary systems around stars that are bright and close enough for detailed follow-up studies. Many aspects concerning the design trade-off of a space-based instrument and its performance can best be tackled through realistic simulations of the expected observations. The complex interplay of various noise sources in the course of the observations made such simulations an indispensable part of the assessment study of the PLATO Payload Consortium. We created an end-to-end CCD simulation software-tool, dubbed PLATOSim, which simulates photometric time-series of CCD images by including realistic models of the CCD and its electronics, the telescope optics, the stellar field, the pointing uncertainty of the satellite ...

  6. micro strip gas chamber

    CERN Multimedia

    1998-01-01

    About 16 000 Micro Strip Gas Chambers like this one will be used in the CMS tracking detector. They will measure the tracks of charged particles to a hundredth of a millimetre precision in the region near the collision point where the density of particles is very high. Each chamber is filled with a gas mixture of argon and dimethyl ether. Charged particles passing through ionise the gas, knocking out electrons which are collected on the aluminium strips visible under the microscope. Such detectors are being used in radiography. They give higher resolution imaging and reduce the required dose of radiation.

  7. [Post-stripping telangiectasis].

    Science.gov (United States)

    Hutinel, B; Maraval, M

    1985-01-01

    These telangiectasia appear between one and six months after the operation, especially in cases of capillary fragility. The most common localizations are the antero-internal and external sides of the thighs and knees. Unnecessary strippings, of continent saphenous veins, are the most frequent cause of these. Their prevention consists of the least possible traumatising stripping, using a fine stripper, a very rigorous post-operative support, and the wearing of light varicose stockings or tights for between one and three months. The treatment using microsclerosis, often delicate, should not be undertaken before six months.

  8. ST-elevation acute coronary syndromes in the Platelet Inhibition and Patient Outcomes (PLATO) trial

    DEFF Research Database (Denmark)

    Armstrong, Paul W; Siha, Hany; Fu, Yuling;

    2012-01-01

    Ticagrelor, when compared with clopidogrel, reduced the 12-month risk of vascular death/myocardial infarction and stroke in patients with ST-elevation acute coronary syndromes intended to undergo primary percutaneous coronary intervention in the PLATelet inhibition and patient Outcomes (PLATO) tr...

  9. Democratic Freedom and the Concept of Freedom in Plato and Aristotle

    Directory of Open Access Journals (Sweden)

    Mogens Herman Hansen

    2010-11-01

    Full Text Available Among the several meanings of eleutheria used by Greeks in the classical period, democratic freedom is rejected by both Plato and Aristotle, who do not articulate a theory of political freedom but rather confine eleutheria to a social context.

  10. Freud, Plato and Irigaray: A Morpho-Logic of Teaching and Learning

    Science.gov (United States)

    Peers, Chris

    2012-01-01

    This article discusses two well-known texts that respectively describe learning and teaching, drawn from the work of Freud and Plato. These texts are considered in psychoanalytic terms using a methodology drawn from the philosophy of Luce Irigaray. In particular the article addresses Irigaray's approach to the analysis of speech and utterance as a…

  11. Dialectic of Eros and Myth of the Soul in Plato's Phaedrus

    DEFF Research Database (Denmark)

    Larsen, Jens Kristian

    2010-01-01

    In this paper, I question a widespread reading of a passage in the last part of the Phaedrus dealing with the science of dialectic. According to this reading, the passage announces a new method peculiar to the later Plato aiming at defining natural kinds. I show that the Phaedrus itself does not ...

  12. Evaluation of a Three Year Health Sciences PLATO IV Computer-Based Education Project.

    Science.gov (United States)

    Sorlie, William E.; Essex, Diane L.

    Significant findings of the comprehensive evaluation of a computer-based curriculum in the basic medical sciences using the PLATO IV computer system are presented. The study was conducted by the Office of Curriculum and Evaluation (OCE) of the School of Basic Medical Sciences (SBMS) at the University of Illinois, Urbana/Champaign (UC). It was…

  13. Cost of Initial Development of PLATO Instruction in Veterinary Medicine. CERL Report X-43.

    Science.gov (United States)

    Grimes, George M.

    An academic program instituting the PLATO system of computer-assisted instruction at the University of Illinois College of Veterinary Medicine is discussed. Procedures involved setting up an organization, establishing an administrative system, studying capabilities of the system, studying factors making a lesson suitable for programming, and…

  14. From Dialogos to Dialogue: The Use of the Term from Plato to the Second Century CE

    Directory of Open Access Journals (Sweden)

    Katarzyna Jazdzewska

    2014-02-01

    Full Text Available In Plato the verb διαλέγεσθαι is far more common than the noun, and both denote question-and-answer discussions; it was only in the Hellenistic period that διάλογος became a genre term, though its other meanings survived.

  15. Two examples of the relation between the contemporary science and Plato

    CERN Document Server

    Antonello, Elio

    2016-01-01

    The philosopher Plato is remembered even today by scientists, and his writings are still inspiring the scientific research. In the present short note (intended essentially for public outreach) two examples are briefly illustrated: 1) the European space project that bears his name, dedicated to the discovery of exoplanets; 2) the discussion about platonism in contemporary physics.

  16. Grades 1-8, Apache Junction Unified School District 43, Apache Junction, Arizona. PLATO Evaluation Series.

    Science.gov (United States)

    Quinn, David W.; Quinn, Nancy W.

    Apache Junction Unified School District, Arizona, has embarked on a 5-year program of instructional improvement using technology. PLATO Elementary reading and mathematics products were installed in the district's elementary and middle schools at the beginning of the 1999-2000 school year. This evaluation studied the use and preliminary student…

  17. Can Prior Knowledge Hurt Text Comprehension? An Answer Borrowed from Plato, Aristotle, and Descartes.

    Science.gov (United States)

    Friedman, Lawrence B.

    Taking a philosophical approach based on what Plato, Aristotle, and Descartes said about knowledge, this paper addresses some of the murkiness in the conceptual space surrounding the issue of whether prior knowledge does or does not facilitate text comprehension. Specifically, the paper first develops a non-exhaustive typology of cases in which…

  18. A Philosophical Investigation of the Role of Teachers: A Synthesis of Plato, Confucius, Buber, and Freire

    Science.gov (United States)

    Shim, Seung Hwan

    2008-01-01

    This study proposes the ideal role of teachers through the examination of Plato, Confucius, Buber, and Freire on the subject. Teachers not only contribute to the development of individuals and societies but also attain self-realization through teaching. As such, the role of teachers is important as a goal as well as a means. To examine such role,…

  19. Genesis 2–3 and Alcibiades's speech in Plato's Symposium: A ...

    African Journals Online (AJOL)

    2015-08-26

    Aug 26, 2015 ... Friedländer 1975:26f; Gauss 1958:111–117) is the last speech in Plato's ... leader (450–404/3 BCE), appears to be in a great state of intoxication .... command (Gn 2:18: 'You are free to eat of all the trees in the garden.

  20. Freud, Plato and Irigaray: A Morpho-Logic of Teaching and Learning

    Science.gov (United States)

    Peers, Chris

    2012-01-01

    This article discusses two well-known texts that respectively describe learning and teaching, drawn from the work of Freud and Plato. These texts are considered in psychoanalytic terms using a methodology drawn from the philosophy of Luce Irigaray. In particular the article addresses Irigaray's approach to the analysis of speech and utterance as a…

  1. From Plato to Erikson: How the War on "Bad Play" Has Impoverished Higher Education

    Science.gov (United States)

    Carnes, Mark C.

    2015-01-01

    For centuries, the titans of educational reform--Plato, Rousseau, Dewey, Piaget, Erikson, Csikszentmihalyi and others--have championed the educational benefits of play. Yet many professors and administrators are boggled by the idea of playing academic games in college. They instantly dismiss faculty initiatives like "Reacting to the…

  2. ALICE Silicon Strip Detector

    CERN Multimedia

    Nooren, G

    2013-01-01

    The Silicon Strip Detector (SSD) constitutes the two outermost layers of the Inner Tracking System (ITS) of the ALICE Experiment. The SSD plays a crucial role in the tracking of the particles produced in the collisions connecting the tracks from the external detectors (Time Projection Chamber) to the ITS. The SSD also contributes to the particle identification through the measurement of their energy loss.

  3. Captures in methyl eugenol and cue-lure detection traps with and without insecticides and with a Farma Tech solid lure and insecticide dispenser.

    Science.gov (United States)

    Vargas, Roger I; Burns, R E; Mau, Ronald F L; Stark, John D; Cook, Peter; Piñero, Jaime C

    2009-04-01

    Methyl eugenol (ME) and cue-lure (C-L) traps to detect tephritid flies on the U.S. mainland were tested with and without insecticides under Hawaiian weather conditions against small populations of oriental fruit fly, Bactrocera dorsalis (Hendel) and melon fly, Bactrocera cucurbitae (Coquillett), respectively. In comparative tests, standard Jackson traps with naled and the Hawaii fruit fly areawide pest management (AWPM) trap with 2,2-dichorovinyl dimethyl phosphate (DDVP) insecticidal strips outperformed traps without an insecticide. Addition of the reduced risk insecticide spinosad did not increase trap capture significantly compared with Jackson traps without an insecticide. Captures in AWPM traps with DDVP compared favorably with those for the Jackson trap with liquid naled (the Florida standard). In subsequent tests, captures with solid Farma Tech wafer dispensers with ME or C-L and DDVP placed inside Jackson and AWPM traps were equal to those for a Jackson trap with naled, currently used for detection of ME and C-L responding fruit flies in Florida. Farma Tech ME and C-L wafers with DDVP would be more convenient and safer to handle than current liquid insecticide formulations (e.g., naled) used for detection programs in Florida.

  4. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  5. Parabolic Strip Telescope

    CERN Document Server

    Chadzitaskos, Goce

    2013-01-01

    We present a proposal of a new type of telescopes using a rotating parabolic strip as the primary mirror. It is the most principal modification of the design of telescopes from the times of Galileo and Newton. In order to demonstrate the basic idea, the image of an artificial constellation observed by this kind of telescope was reconstructed using the techniques described in this article. As a working model of this new telescope, we have used an assembly of the primary mirror---a strip of acrylic glass parabolic mirror 40 cm long and 10 cm wid shaped as a parabolic cylinder of focal length 1 m---and an artificial constellation, a set of 5 apertures in a distance of 5 m illuminated from behind. In order to reconstruct the image, we made a series of snaps, each after a rotation of the constellation by 15 degrees. Using Matlab we reconstructed the image of the artificial constellation.

  6. Plato, Wilde, and Woolf: the poetics of homoerotic "intercourse" in A Room of One's Own.

    Science.gov (United States)

    Vanita, Ruth

    2010-01-01

    This article places Woolf in the context of homoerotic literary ancestry. It suggests that the overall argument in A Room of One's Own owes a debt to Wilde's 1891 pamphlet The Soul of Man under Socialism. It also examines Woolf's controversial meditation on male-female collaboration and intercourse in A Room, and suggests a homoerotic reading of this meditation, drawing on images and ideas of literary transmission and creation from Plato's Symposium.

  7. The philosopher Socrates had exophthalmos (a term coined by Plato) and probably Graves' disease.

    Science.gov (United States)

    Papapetrou, Peter D

    2015-01-01

    According to a previously published theory, Socrates was afflicted with temporal lobe epilepsy since his childhood. Plato, Xenophon, and Aristoxenus described Socrates as having exophthalmos, probably diplopia, and some symptoms compatible with hyperthyroidism. Using these data, we theorize that Socrates had Graves' disease. In order to determine a cause of his temporal lobe epilepsy, we speculate that the philosopher also had autoimmune thyroiditis and Hashimoto encephalopathy during his childhood and his epilepsy may have been a sequel to this hypothesized encephalopathy.

  8. Spray Rolling Aluminum Strip

    Energy Technology Data Exchange (ETDEWEB)

    Lavernia, E.J.; Delplanque, J-P; McHugh, K.M.

    2006-05-10

    Spray forming is a competitive low-cost alternative to ingot metallurgy for manufacturing ferrous and non-ferrous alloy shapes. It produces materials with a reduced number of processing steps, while maintaining materials properties, with the possibility of near-net-shape manufacturing. However, there are several hurdles to large-scale commercial adoption of spray forming: 1) ensuring strip is consistently flat, 2) eliminating porosity, particularly at the deposit/substrate interface, and 3) improving material yield. Through this program, a new strip/sheet casting process, termed spray rolling, has been developed, which is an innovative manufacturing technique to produce aluminum net-shape products. Spray rolling combines the benefits of twin-roll casting and conventional spray forming, showing a promising potential to overcome the above hurdles associated with spray forming. Spray rolling requires less energy and generates less scrap than conventional processes and, consequently, enables the development of materials with lower environmental impacts in both processing and final products. Spray Rolling was developed as a collaborative project between the University of California-Davis, the Colorado School of Mines, the Idaho National Engineering and Environmental Laboratory, and an industry team. The following objectives of this project were achieved: (1) Demonstration of the feasibility of the spray rolling process at the bench-scale level and evaluation of the materials properties of spray rolled aluminum strip alloys; and (2) Demonstration of 2X scalability of the process and documentation of technical hurdles to further scale up and initiate technology transfer to industry for eventual commercialization of the process.

  9. The instrument control unit of the ESA-PLATO 2.0 mission

    Science.gov (United States)

    Focardi, M.; Pezzuto, S.; Cosentino, R.; Giusi, G.; Pancrazzi, M.; Noce, V.; Ottensamer, R.; Steller, M.; Di Giorgio, A. M.; Pace, E.; Plasson, P.; Peter, G.; Pagano, I.

    2016-07-01

    PLATO 2.0 has been selected by ESA as the third medium-class Mission (M3) of the Cosmic Vision Program. Its Payload is conceived for the discovery of new transiting exoplanets on the disk of their parent stars and for the study of planetary system formation and evolution as well as to answer fundamental questions concerning the existence of other planetary systems like our own, including the presence of potentially habitable new worlds. The PLATO Payload design is based on the adoption of four sets of short focal length telescopes having a large field of view in order to exploit a large sky coverage and to reach, at the same time, the needed photometry accuracy and signalto- noise ratio (S/N) within a few tens of seconds of exposure time. The large amount of data produced by the telescope is collected and processed by means of the Payload's Data Processing System (DPS) composed by many processing electronics units. This paper gives an overview of the PLATO 2.0 DPS, mainly focusing on the architecture and processing capabilities of its Instrument Control Unit (ICU), the electronic subsystem acting as the main interface between the Payload (P/L) and the Spacecraft (S/C).

  10. Strip shape control capability of hot wide strip rolling mills

    Institute of Scientific and Technical Information of China (English)

    Renzhong Wang; Quan Yang; Anrui He; Jian Shao; Haitao Bian

    2008-01-01

    The elasticity deformation of rolls was analyzed by means of two-dimensional f'mite element method (FEM) with vari-able thickness. Three typical mills were used as objects for analysis. A thorough study was done on the control capabilities of these mills on the strip shape. Then the strip shape control capabilities of the three mills was compared synthetically.

  11. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product.

  12. Synthesis of insecticidal sucrose esters

    Institute of Scientific and Technical Information of China (English)

    Song Zi-juan; Li Shu-jun; Chen Xi; Liu Li-mei; Song Zhan-qian

    2006-01-01

    Some synthetic sucrose esters (SE) are a relatively new class of insecticidal compounds produced by reacting sugars with fatty acids, which are safe for the environment. Especially, sucrose esters composed of C6-C12 fatty acids have desirable insecticidal properties against many soft-bodied arthropod pests. In our study, sucrose octanoate which has the highest activity against a range of arthropod species was synthesized by a trans-esterification method and proved its insecticidal property. Under the condition of a homogeneous liquid, sucrose octanoate was prepared by reacting ethyl octanoate with sucrose at reduced pressure; the yield was 79.11%. Sucrose octanoate synthesized was identified and its property analyzed by IR, TLC and spectrophotometric analysis. It was shown that the ratio of monoester to polyester in sucrose octanoate was 1.48:1. The insecticidal activity of the synthetic sucrose octanoate was evaluated at a concentration of 4 and 8 mg·mL-1. The mortality of first-instar larvae ofLymantria dispar from its contact toxicity was 72.5% after 36 hours, the revision insect reduced rate of Aphis glycines reached above 80% at 4 and 8 mg·mL-1 after being treated for 5 days. Since the SE products are nontoxic to humans and higher animals, fully biodegradable and hydrolyzed to readily metabolizable sucrose and fatty acid, they are not harmful to crops and appear to be good insecticide candidates.

  13. Analysis/design of strip reinforced random composites (strip hybrids)

    Science.gov (United States)

    Chamis, C. C.; Sinclair, J. H.

    1978-01-01

    Advanced analysis methods and composite mechanics were applied to a strip-reinforced random composite square panel with fixed ends to illustrate the use of these methods for the a priori assessment of the composite panel when subjected to complex loading conditions. The panel was assumed to be of E-glass random composite. The strips were assumed to be of three advanced unidirectional composites to cover a range of low, intermediate, and high modulus stiffness. The panels were assumed to be subjected to complex loadings to assess their adequacy as load-carrying members in auto body, aircraft engine nacelle and windmill blade applications. The results show that strip hybrid panels can be several times more structurally efficient than the random composite base materials. Some of the results are presented in graphical form and procedures are described for use of these graphs as guides for preliminary design of strip hybrids.

  14. Analysis/design of strip reinforced random composites /strip hybrids/

    Science.gov (United States)

    Chamis, C. C.; Sinclair, J. H.

    1978-01-01

    Results are described which were obtained by applying advanced analysis methods and composite mechanics to a strip-reinforced random composite square panel with fixed ends. This was done in order to illustrate the use of these methods for the apriori assessment of the composite panel when subjected to complex loading conditions. The panel was assumed to be of E-Glass/Random Composite. The strips were assumed to be of three advanced unidirectional composites to cover a range of low, intermediate, and high modulus stiffness. The panels were assumed to be subjected to complex loadings to assess their adequacy as load-carrying members in auto body, aircraft engine nacelle, and windmill blade applications. The results show that strip hybrid panels can be several times more structurally efficient than the random composite base materials. Some of the results are presented in graphical form and procedures are described for use of these graphs as guides for preliminary design of strip hybrids.

  15. Aptasensors Based on Stripping Voltammetry

    Directory of Open Access Journals (Sweden)

    Wenjing Qi

    2016-07-01

    Full Text Available Aptasensors based on stripping voltammetry exhibit several advantages, such as high sensitivity and multi-target detection from stripping voltammetric technology, and high selectivity from the specific binding of apamers with targets. This review comprehensively discusses the recent accomplishments in signal amplification strategies based on nanomaterials, such as metal nanoparticles, semiconductor nanoparticles, and nanocomposite materials, which are detected by stripping voltammetry after suitable dissolution. Focus will be put in discussing multiple amplification strategies that are widely applied in aptasensors for small biomolecules, proteins, disease markers, and cancer cells.

  16. Echoes in Plato's cave : ontology of sound objects in computer music and analysis

    OpenAIRE

    Marsden, Alan

    2014-01-01

    The sonic aspects of Plato's analogy of the cave is taken as a starting point for thought experiments to investigate the objective nature of sound, and the idea of quasi-Platonic forms in music. Sounds are found to be objects in a way that sights or appearances are not, and it is only in the presence of technology that they become artificial. When recognition, control and communication about sound come into play, abstract concepts emerge, but there is no reason to give these the priority stat...

  17. Ontological Questions in Schelling’s Late Philosophy: Plato and Aristotle

    Directory of Open Access Journals (Sweden)

    Jean-François Courtine

    2010-09-01

    Full Text Available The purpose of the article is to understand the reasons and procedures employed by F. W. Schelling in his Plato and Aristotle re-appropriation, and to extract the authentically ontological thematic of it. It makes a path through the Schelling’s late writings and letters, to construct a complete view about the relation between this appropriation and the possibility of the constitution of a positive philosophy, as a particular science, in opposition to a negative philosophy, understood as metaphysics.

  18. Numbers Rule The Vexing Mathematics of Democracy, from Plato to the Present

    CERN Document Server

    Szpiro, George G

    2010-01-01

    Since the very birth of democracy in ancient Greece, the simple act of voting has given rise to mathematical paradoxes that have puzzled some of the greatest philosophers, statesmen, and mathematicians. Numbers Rule traces the epic quest by these thinkers to create a more perfect democracy and adapt to the ever-changing demands that each new generation places on our democratic institutions. In a sweeping narrative that combines history, biography, and mathematics, George Szpiro details the fascinating lives and big ideas of great minds such as Plato, Pliny the Younger, Ramon Llull, Pierre Simo

  19. Microtube strip heat exchanger

    Science.gov (United States)

    Doty, F. D.

    1991-04-01

    During the last quarter, Doty Scientific, Inc. (DSI) continued to make progress on the microtube strip (MTS) heat exchangers. The team has begun a heat exchanger stress analysis; however, they have been concentrating the bulk of their analytical energies on a computational fluid dynmaics (CFD) model to determine the location and magnitude of shell-side flow maldistribution which decreases heat exchanger effectiveness. DSI received 120 fineblanked tubestrips from Southern Fineblanking (SFB) for manufacturing process development. Both SFB and NIST provided inspection reports of the tubestrips. DSI completed the tooling required to encapsulate a tube array and press tubestrips on the array. Pressing the tubestrips on tube arrays showed design deficiencies both in the tubestrip design and the tooling design. DSI has a number of revisions in process to correct these deficiencies. The research effort has identified a more economical fusible alloy for encapsulating the tube array, and determined the parameters required to successfully encapsulate the tube array with the new alloy. A more compact MTS heat exchanger bank was designed.

  20. Magnetic stripping studies for SPL

    CERN Document Server

    Posocco, P; CERN. Geneva. BE Department

    2010-01-01

    Magnetic stripping of H- can seriously enhance the beam losses along the SPL machine. These losses depend on the beam energy, on the beam transverse distribution and on the intensity of the magnetic field. For radioprotection issues the losses must be limited to 1 W/m. In this paper we will concentrate on the stripping phenomena inside the quadrupole magnets with the aim of defining the quadrupole range for the design phase of SPL.

  1. Improved lower bound for online strip packing

    NARCIS (Netherlands)

    Harren, Rolf; Kern, Walter

    2012-01-01

    In the two-dimensional strip packing problem a number of rectangles have to be packed without rotation or overlap into a strip such that the height of the strip used is minimal. The width of the rectangles is bounded by 1 and the strip has width 1 and infinite height. We study the online version of

  2. The Dark Side of the Moebius Strip.

    Science.gov (United States)

    Schwarz, Gideon E.

    1990-01-01

    Discussed are various models proposed for the Moebius strip. Included are a discussion of a smooth flat model and two smooth flat algebraic models, some results concerning the shortest Moebius strip, the Moebius strip of least elastic energy, and some observations on real-world Moebius strips. (KR)

  3. Philosophy and Mathematics in the Teaching of Plato: the Development of Idea and Modernity

    Directory of Open Access Journals (Sweden)

    Mikhailova N. V.

    2014-01-01

    Full Text Available It is well known that the largest philosophers differently explain the origin of mathematics. This question was investigated in antiquity, a substantial and decisive role in this respect was played by the Platonic doctrine. Therefore, discussing this issue the problem of interaction of philosophy and mathematics in the teachings of Plato should be taken into consideration. Many mathematicians believe that abstract mathematical objects belong in a certain sense to the world of ideas and that consistency of objects and theories really describes mathematical reality, as Plato quite clearly expressed his views on math, according to which mathematical concepts objectively exist as distinct entities between the world of ideas and the world of material things. In the context of foundations of mathematics, so called “Gödel’s Platonism” is of particular interest. It is shown in the article how Platonic objectification of mathematical concepts contributes to the development of modern mathematics by revealing philosophical understanding of the nature of abstraction. To substantiate his point of view, the author draws the works of contemporary experts in the field of philosophy of mathematics.

  4. The PLATO Simulator: Modelling of High-Precision High-Cadence Space-Based Imaging

    CERN Document Server

    Marcos-Arenal, P; De Ridder, J; Aerts, C; Huygen, R; Samadi, R; Green, J; Piotto, G; Salmon, S; Catala, C; Rauer, H

    2014-01-01

    Many aspects of the design trade-off of a space-based instrument and its performance can best be tackled through simulations of the expected observations. The complex interplay of various noise sources in the course of the observations make such simulations an indispensable part of the assessment and design study of any space-based mission. We present a formalism to model and simulate photometric time series of CCD images by including models of the CCD and its electronics, the telescope optics, the stellar field, the jitter movements of the spacecraft, and all important natural noise sources. This formalism has been implemented in a versatile end-to-end simulation software tool, called PLATO Simulator, specifically designed for the PLATO space mission to be operated from L2, but easily adaptable to similar types of missions. We provide a detailed description of several noise sources and discuss their properties, in connection with the optical design, the allowable level of jitter, the quantum efficiency of th...

  5. Secretory function of ovarian cells and myometrial contractions in cow are affected by chlorinated insecticides (chlordane, heptachlor, mirex) in vitro.

    Science.gov (United States)

    Wrobel, Michael Hubert; Mlynarczuk, Jaroslaw

    2017-01-01

    The aim of the study was to investigate the effect of chlordane, heptachlor and mirex, on hormonal regulation of the force of myometrial contractions. Myometrial, endometrial, granulosa and luteal cells as well as strips of myometrium from non-pregnant cows were incubated with three insecticides at environmentally relevant doses (0.1, 1 or 10ng/ml). None of the insecticides affected the viability of studied cells. Chlordane stimulated, while heptachlor and mirex inhibited, secretion of testosterone and estradiol from granulosa cells as well as secretion of progesterone from luteal cells, respectively. Secretion of oxytocin (OT) from granulosa cells was increased after incubation with all studied insecticides. Only mirex stimulated OT secretion from luteal cells, while heptachlor inhibited this effect. None of them affected synthesis of OT in luteal cells and prostaglandins (PGF2 and PGE2) secretion from uterine cells, except PGE2 secretion from endometrial cells was decreased when the cells were incubated with 0.1ng/ml of chlordane. Basal and OT-stimulated myometrial contractions were increased by mirex and decreased by heptachlor. The data show that the insecticides altered secretory function of ovarian cells. Heptachlor and mirex affected also myometrial contractions in vitro, but uterine secretion of prostaglandins were not involved in the mechanism of that adverse effect of insecticides. The data indicate on potential of these insecticides to disturb fertilisation, blastocyst implantation or even the length of gestation. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. Dialectic and Dialogue in Plato: Refuting the Model of Socrates-as-Teacher in the Pursuit of Authentic "Paideia"

    Science.gov (United States)

    Magrini, James Michael

    2014-01-01

    Incorporating Gadamer and other thinkers from the continental tradition, this essay is a close and detailed hermeneutic, phenomenological, and ontological study of the dialectic practice of Plato's Socrates--it radicalizes and refutes the Socrates-as-teacher model that educators from scholar academic ideology embrace.

  7. Three Aspects of PLATO Use at Chanute AFB: CBE Production Techniques, Computer-Aided Management, Formative Development of CBE Lessons.

    Science.gov (United States)

    Klecka, Joseph A.

    This report describes various aspects of lesson production and use of the PLATO system at Chanute Air Force Base. The first chapter considers four major factors influencing lesson production: (1) implementation of the "lean approach," (2) the Instructional Systems Development (ISD) role in lesson production, (3) the transfer of…

  8. A Plan for the Evaluation of a Project to Develop Basic Medical Sciences Lessons on PLATO IV.

    Science.gov (United States)

    Jones, Les A.; And Others

    A project to introduce PLATO IV computer-assisted instruction (CAI) in medical sciences education for health professionals was implemented at the School of Basic Medical Sciences at the University of Illinois. This paper describes the plan for evaluation of the project. Using a student questionnaire and additional general questions, the…

  9. An Evaluation of the Teaching Effectiveness of PLATO in a First Level Biology Course. CERL Report X-32.

    Science.gov (United States)

    Arsenty, Richard P.; Kieffer, George H.

    This paper describes a study of the teaching effectiveness of computer-assisted instruction using the PLATO system at the University of Illinois in a first level biology course. College enrollment, class rank, final grade, and time study data of the control and experimental groups were obtained from master rosters. A questionnaire administered to…

  10. The Education of the Third Class in "The Republic": Plato and the "Locus Classicus" of Formative Justice

    Science.gov (United States)

    Mintz, Avi I.

    2016-01-01

    Background/Context: In one of the classics of educational philosophy, a key issue is remains unsettled. In Plato's "Republic," Socrates makes a case for the importance of a comprehensive education. Socrates is unclear, however, about whether the producer class is eligible for this comprehensive education. Purpose/Objective: Previous…

  11. Dialectic and Dialogue in Plato: Refuting the Model of Socrates-as-Teacher in the Pursuit of Authentic "Paideia"

    Science.gov (United States)

    Magrini, James Michael

    2014-01-01

    Incorporating Gadamer and other thinkers from the continental tradition, this essay is a close and detailed hermeneutic, phenomenological, and ontological study of the dialectic practice of Plato's Socrates--it radicalizes and refutes the Socrates-as-teacher model that educators from scholar academic ideology embrace.

  12. Restitution of enamel after interdental stripping.

    Science.gov (United States)

    Lundgren, T; Milleding, P; Mohlin, B; Nannmark, U

    1993-01-01

    This paper studies the effect of interdental stripping on the enamel surface and evaluates methods to restitute the treated surface. Extracted teeth mounted in a semielastic material were subjected to stripping by different kinds of steel strips. The treated enamel surfaces were then polished in several different ways. The effects were studied by SEM and profilometry. It was concluded that the coarsest strips produced irregularities of such a magnitude that polishing had very limited effect. Polishing starting with coarse polishing strips followed by gradually finer gave the best result. An increase in number of strokes and use of all grades of polishing strips slightly improved the result.

  13. The Theory of Argumentation within Language and its relation to Plato, Saussure and Benveniste

    Directory of Open Access Journals (Sweden)

    Cristiane Dall'Cortivo-Lebler

    2014-12-01

    Full Text Available The Theory of Argumentation within Language, developed by Oswald Ducrot, Jean-Claude Anscombre and Marion Carel, has experienced along its development different phases and forms, constantly seeking to align to what its main developer, Oswald Ducrot, called external hypotheses and internal hypotheses. This paper discusses the presence of Linguistic Theories and Philosophy in Ducrot’s work regarding concepts of Plato, Ferdinand de Saussure and Émile Benveniste, which constitute its external assumptions. The presence of these concepts culminated in the creation of different concepts that comprise the Linguistic Semantics, and gave it a specific point of view about language that emphasizes the internal relationships among language components and understands that speech is the result of a linguistic activity where an “I” speaks to a “you”.

  14. Efficient methods for solving discrete topology design problems in the PLATO-N project

    DEFF Research Database (Denmark)

    Canh, Nam Nguyen; Stolpe, Mathias

    This paper considers the general multiple load structural topology design problems in the framework of the PLATO-N project. The problems involve a large number of discrete design variables and were modeled as a non-convex mixed 0–1 program. For the class of problems considered, a global...... optimization method based on the branch-and-cut concept was developed and implemented. In the method a large number of continuous relaxations were solved. We also present an algorithm for generating cuts to strengthen the quality of the relaxations. Several heuristics were also investigated to obtain efficient...... algorithms. The branch and cut method is used to solve benchmark examples which can be used to validate other methods and heuristics....

  15. Alternative communication network designs for an operational Plato 4 CAI system

    Science.gov (United States)

    Mobley, R. E., Jr.; Eastwood, L. F., Jr.

    1975-01-01

    The cost of alternative communications networks for the dissemination of PLATO IV computer-aided instruction (CAI) was studied. Four communication techniques are compared: leased telephone lines, satellite communication, UHF TV, and low-power microwave radio. For each network design, costs per student contact hour are computed. These costs are derived as functions of student population density, a parameter which can be calculated from census data for one potential market for CAI, the public primary and secondary schools. Calculating costs in this way allows one to determine which of the four communications alternatives can serve this market least expensively for any given area in the U.S. The analysis indicates that radio distribution techniques are cost optimum over a wide range of conditions.

  16. Banishing the Poet: The Pedagogical Function of Mythology in the Dialogues of Plato

    Directory of Open Access Journals (Sweden)

    Javier Martínez

    2013-06-01

    Full Text Available This text attempts to develop a sound justification for Plato’s pedagogical use of myth in the dialogues. In particular, I seek to resolve a seeming contradiction: why Plato personally made use of myths in spite of his many statements that seem to contradict such a pedagogical approach, especially his edict that poets and myth-makers be banished from his republic for the danger their works pose to the attainment of true philosophical wisdom. An analysis of the centrality of myths to the dialogues is carried out, followed by a discussion of the place of muthos in its Ionian historical context. This establishes the basis for resolving the contradiction through the division of muthos into two distinct modes: the fantastic and the eikastic.

  17. Arete and Gender-Differentiation in Socrates/Plato and Aristotle

    Directory of Open Access Journals (Sweden)

    Thomas Robinson

    1998-12-01

    Full Text Available The article grapples with the question whether Plato believed that, in the matter of arete, the female psyche had a built-in inclination to immorality in a way that the male psyche did not, and was therefore assuch signiticantly different from the male psyche. It is argued that the evidence of the Timaeus ( and, to some lesser degree, of the Laws suggests very strongly that he did, though fortunately the political consequence she drew from this (in the Laws tum out to be positive rather than negative. Aristotle, by contrast,it is argued, while still holding to the lamentable theory of the inferiority of woman, talks of ditl'eringquanta of (one and the same arete in male and female souls, rather than a difference in their very arete.

  18. Platón y el silogismo Plato and the syllogism

    Directory of Open Access Journals (Sweden)

    Manuel Correia Machuca

    2010-03-01

    Full Text Available La cuestión de si Platón pudo ser el autor de una primera noción de deducción silogística (un método que Aristóteles hizo conocido a través de una definición y un progreso teórico en los Analíticos Primeros fue discutida en la antigüedad y, desde entonces, debatida por varios comentaristas. En este artículo, comento dos pasajes de la literatura post-aristotélica, uno atestiguado por Boecio (que se remonta a Alejandro de Afrodisia y el otro presente en Juan Filópono, en su comentario a los Analíticos Primeros. El artículo intenta mostrar que estos pasajes contienen información suficiente para favorecer a Platón como conocedor de la técnica deductiva silogística, aunque no para conferirle el desarrollo de la metodología silogística.The question of whether Plato could be the author of a first concept of syllogistic deduction (a method that Aristotle made known by means of a definition and a theoretical improvement in his Prior Analytics was known in the antiquity and from that time, the question has usually examined by several commentators. In this article, I comment on two passages of post-Aristotelian tradition; one is given by Boethius (which stems from Alexander of Aphrodisias and the other was given by Johannes Philoponus in his commentary on Prior Analytics. The article intends to show that these passages contain information that is sufficient to come to an opinion favoring Plato, although it does not imply that they are sufficient to confer him the syllogistic method.

  19. Hardy spaces for the strip

    Science.gov (United States)

    Bakan, Andrew; Kaijser, Sten

    2007-09-01

    In this paper we shall study Hardy spaces of analytic functions in a strip . Our main result is on one hand an intrinsic characterization of the spaces and on the second that polynomials are dense. We also present an orthogonal (in ) basis of polynomials.

  20. Intraply Hybrid Composites Would Contain Control Strips

    Science.gov (United States)

    Chamis, Christos C.; Shiao, Chi-Yu

    1996-01-01

    "Smart" structural components with sensors and/or actuators distributed throughout their volumes made of intraply hybrid composite materials, according to proposal. Strips of hybrid control material interspersed with strips of ordinary (passive) composite material in some layers, providing distributed control capability. For example, near and far edges of plate bent upward by commanding bottom control strips to expand and simultaneously commanding upper control strips to contract.

  1. Simulation results for PLATO: a prototype hybrid X-ray photon counting detector with a low energy threshold for fusion plasma diagnostics

    Science.gov (United States)

    Habib, A.; Menouni, M.; Pangaud, P.; Fenzi, C.; Colledani, G.; Moureau, G.; Escarguel, A.; Morel, C.

    2017-01-01

    PLATO is a prototype hybrid X-ray photon counting detector that has been designed to meet the specifications for plasma diagnostics for the WEST tokamak platform (Tungsten (W) Environment in Steady-state Tokamak) in southern France, with potential perspectives for ITER. PLATO represents a customized solution that fulfills high sensitivity, low dispersion and high photon counting rate. The PLATO prototype matrix is composed of 16 × 18 pixels with a 70 μm pixel pitch. New techniques have been used in analog sensitive blocks to minimize noise coupling through supply rails and substrate, and to suppress threshold dispersion across the matrix. The PLATO ASIC is designed in CMOS 0.13 μm technology and was submitted for a fabrication run in June 2016. The chip is designed to be bump-bonded to a silicon sensor. This paper presents pixel architecture as well as simulation results while highlighting novel solutions.

  2. Using Comic Strips in Language Classes

    Science.gov (United States)

    Csabay, Noémi

    2006-01-01

    The author believes that using comic strips in language-learning classes has three main benefits. First, comic strips motivate younger learners. Second, they provide a context and logically connected sentences to help language learning. Third, their visual information is helpful for comprehension. The author argues that comic strips can be used in…

  3. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  4. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  5. Fast variation method for elastic strip calculation.

    Science.gov (United States)

    Biryukov, Sergey V

    2002-05-01

    A new, fast, variation method (FVM) for determining an elastic strip response to stresses arbitrarily distributed on the flat side of the strip is proposed. The remaining surface of the strip may have an arbitrary form, and it is free of stresses. The FVM, as well as the well-known finite element method (FEM), starts with the variational principle. However, it does not use the meshing of the strip. A comparison of FVM results with the exact analytical solution in the special case of shear stresses and a rectangular strip demonstrates an excellent agreement.

  6. Organophosphorus and carbamate insecticide poisoning.

    Science.gov (United States)

    Vale, Allister; Lotti, Marcello

    2015-01-01

    Both organophosphorus (OP) and carbamate insecticides inhibit acetylcholinesterase (AChE), which results in accumulation of acetylcholine (ACh) at autonomic and some central synapses and at autonomic postganglionic and neuromuscular junctions. As a consequence, ACh binds to, and stimulates, muscarinic and nicotinic receptors, thereby producing characteristic features. With OP insecticides (but not carbamates), "aging" may also occur by partial dealkylation of the serine group at the active site of AChE; recovery of AChE activity requires synthesis of new enzyme in the liver. Relapse after apparent resolution of cholinergic symptoms has been reported with OP insecticides and is termed the intermediate syndrome. This involves the onset of muscle paralysis affecting particularly upper-limb muscles, neck flexors, and cranial nerves some 24-96 hours after OP exposure and is often associated with the development of respiratory failure. OP-induced delayed neuropathy results from phosphorylation and subsequent aging of at least 70% of neuropathy target esterase. Cramping muscle pain in the lower limbs, distal numbness, and paresthesiae are followed by progressive weakness, depression of deep tendon reflexes in the lower limbs and, in severe cases, in the upper limbs. The therapeutic combination of oxime, atropine, and diazepam is well established experimentally in the treatment of OP pesticide poisoning. However, there has been controversy as to whether oximes improve morbidity and mortality in human poisoning. The explanation may be that the solvents in many formulations are primarily responsible for the high morbidity and mortality; oximes would not be expected to reduce toxicity in these circumstances. even if given in appropriate dose. © 2015 Elsevier B.V. All rights reserved.

  7. Pharmacophore model for neonicotinoid insecticides

    Institute of Scientific and Technical Information of China (English)

    Jian Li; Xiu Lian Ju; Feng Chao Jiang

    2008-01-01

    An effective prediction pharmacophore model (RMS = 0.634, Correl = 0.893, Weight = 1.463, Config = 11.940) was success-fully obtained by 3D-QSAR based on a series of nAChR (nicotinic acetylcholine receptors) agonists, which consists of a hydrogen-bonding acceptor, a hydrogen-bond donor, a hydrophobic aliphatic and a hydrophobic aromatic centre. This pharmacophore modelmay provide theoretical basis for designation and development of higher active insecticides.2008 Xiu Lian Ju. Published by Elsevier B.V. on behalf of Chinese Chemical Society. All rights reserved.

  8. Antenna structure with distributed strip

    Science.gov (United States)

    Rodenbeck, Christopher T.

    2008-03-18

    An antenna comprises electrical conductors arranged to form a radiating element including a folded line configuration and a distributed strip configuration, where the radiating element is in proximity to a ground conductor. The folded line and the distributed strip can be electrically interconnected and substantially coplanar. The ground conductor can be spaced from, and coplanar to, the radiating element, or can alternatively lie in a plane set at an angle to the radiating element. Embodiments of the antenna include conductor patterns formed on a printed wiring board, having a ground plane, spacedly adjacent to and coplanar with the radiating element. Other embodiments of the antenna comprise a ground plane and radiating element on opposed sides of a printed wiring board. Other embodiments of the antenna comprise conductors that can be arranged as free standing "foils". Other embodiments include antennas that are encapsulated into a package containing the antenna.

  9. Insecticide Recommendations for Arkansas. MP 144.

    Science.gov (United States)

    Jones, Bill F.; Barnes, Gordon

    This publication gives, in chart form, insecticides for use on animals, field crops, fruits, flowers, trees and shrubs, household pests, recreation areas, lawn and turf grass, pecans, stored grain, and vegetables. Included in the charts are the insecticides recommended for each insect, formulation to be used, amount, time to apply, and other…

  10. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  11. Insecticide Recommendations for Arkansas. MP 144.

    Science.gov (United States)

    Jones, Bill F.; Barnes, Gordon

    This publication gives, in chart form, insecticides for use on animals, field crops, fruits, flowers, trees and shrubs, household pests, recreation areas, lawn and turf grass, pecans, stored grain, and vegetables. Included in the charts are the insecticides recommended for each insect, formulation to be used, amount, time to apply, and other…

  12. From Pericles to Plato – from democratic political praxis to totalitarian political philosophy

    Directory of Open Access Journals (Sweden)

    Øjvind Larsen

    2012-03-01

    Full Text Available Plato is normally taken as one of the founders of Western political philosophy, not at least with his Republic. Here, he constructs a hierarchy of forms of governments, beginning with aristocracy at the top as a critical standard for the other forms of governments, and proceeding through timocracy and oligarchy to democracy and tyranny at the bottom. Following Karl Popper, the paper argues that Plato’s is a totalitarian philosophy that emphasizes the similarities between democracy and tyranny, which it considers to be the two worst forms of government. Plato’s denigration of democracy has dominated the tradition of political philosophy until recent times. This paper, however, shows that political philosophy in fact originates in democracy, especially as developed by the sophists and that philosophy is only a form of sophism with a similar origin in ancient Greek democracy. A discussion of Pericles’ funeral oration is used to show that Pericles presented a democratic political philosophy that can serve as a counterpoint to Plato’s political philosophy in the Republic.

  13. Plato's Concept of Justice%论柏拉图的正义观

    Institute of Scientific and Technical Information of China (English)

    刘欣如

    2015-01-01

    本文以柏拉图的作品《申辩》、《斐多》、《理想国》为切入点,论述了正义是在应在的位置上做应做之事、正义的本质是灵魂的一种属性以及正义的产生,并通过作品提供的背景和对话讨论了正义之人和不义之人的区别、正义的种类、正义行为的动机、正义的各种不同状态等问题.%In this paper, the works of Plato,"defense","Phaedo","Utopia"as the starting point, discusses the justice should be done is to do things in a position to be in, the nature of justice is an attribute of the soul, and justice generation, background and dialogue and through providing discussed works of justice and the unrighteous man of distinction, just the kind of moti-vation act of justice, justice of various states and other issues.

  14. Buffer strips in composites at elevated temperature

    Science.gov (United States)

    Bigelow, C. A.

    1983-01-01

    The composite material 'buffer strip' concept is presently investigated at elevated temperatures for the case of graphite/polyimide buffer strip panels using a (45/0/45/90)2S layup, where the buffer strip material was 0-deg S-glass/polyimide. Each panel was loaded in tension until it failed, and radiographs and crack opening displacements were recorded during the tests to determine fracture onset, fracture arrest, and the extent of damage in the buffer strip after crack arrest. At 177 + or - 3 C, the buffer strips increased the panel strength by at least 40 percent in comparison with panels without buffer strips. Compared to similar panels tested at room temperature, those tested at elevated temperature had lower residual strengths, but higher failure strains.

  15. Stripping, Sex, and Popular Culture

    OpenAIRE

    Roach, Catherine M.

    2007-01-01

    At the heart of Stripping, Sex, and Popular Culture lies a very personal story, of author Catherine Roach's response to the decision of her life-long best friend to become an exotic dancer. Catherine and Marie grew up together in Canada and moved to the USA to enroll in PhD programs at prestigious universities. For various reasons, Marie left her program and instead chose to work as a stripper. The author, at first troubled and yet fascinated by her friend's decision, follows Marie's journey ...

  16. 3D silicon strip detectors

    Energy Technology Data Exchange (ETDEWEB)

    Parzefall, Ulrich [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany)], E-mail: ulrich.parzefall@physik.uni-freiburg.de; Bates, Richard [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Boscardin, Maurizio [FBK-irst, Center for Materials and Microsystems, via Sommarive 18, 38050 Povo di Trento (Italy); Dalla Betta, Gian-Franco [INFN and Universita' di Trento, via Sommarive 14, 38050 Povo di Trento (Italy); Eckert, Simon [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Eklund, Lars; Fleta, Celeste [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Jakobs, Karl; Kuehn, Susanne [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Lozano, Manuel [Instituto de Microelectronica de Barcelona, IMB-CNM, CSIC, Barcelona (Spain); Pahn, Gregor [Physikalisches Institut, Universitaet Freiburg, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Parkes, Chris [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Pellegrini, Giulio [Instituto de Microelectronica de Barcelona, IMB-CNM, CSIC, Barcelona (Spain); Pennicard, David [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Piemonte, Claudio; Ronchin, Sabina [FBK-irst, Center for Materials and Microsystems, via Sommarive 18, 38050 Povo di Trento (Italy); Szumlak, Tomasz [University of Glasgow, Department of Physics and Astronomy, Glasgow G12 8QQ (United Kingdom); Zoboli, Andrea [INFN and Universita' di Trento, via Sommarive 14, 38050 Povo di Trento (Italy); Zorzi, Nicola [FBK-irst, Center for Materials and Microsystems, via Sommarive 18, 38050 Povo di Trento (Italy)

    2009-06-01

    While the Large Hadron Collider (LHC) at CERN has started operation in autumn 2008, plans for a luminosity upgrade to the Super-LHC (sLHC) have already been developed for several years. This projected luminosity increase by an order of magnitude gives rise to a challenging radiation environment for tracking detectors at the LHC experiments. Significant improvements in radiation hardness are required with respect to the LHC. Using a strawman layout for the new tracker of the ATLAS experiment as an example, silicon strip detectors (SSDs) with short strips of 2-3 cm length are foreseen to cover the region from 28 to 60 cm distance to the beam. These SSD will be exposed to radiation levels up to 10{sup 15}N{sub eq}/cm{sup 2}, which makes radiation resistance a major concern for the upgraded ATLAS tracker. Several approaches to increasing the radiation hardness of silicon detectors exist. In this article, it is proposed to combine the radiation hard 3D-design originally conceived for pixel-style applications with the benefits of the established planar technology for strip detectors by using SSDs that have regularly spaced doped columns extending into the silicon bulk under the detector strips. The first 3D SSDs to become available for testing were made in the Single Type Column (STC) design, a technological simplification of the original 3D design. With such 3D SSDs, a small number of prototype sLHC detector modules with LHC-speed front-end electronics as used in the semiconductor tracking systems of present LHC experiments were built. Modules were tested before and after irradiation to fluences of 10{sup 15}N{sub eq}/cm{sup 2}. The tests were performed with three systems: a highly focused IR-laser with 5{mu}m spot size to make position-resolved scans of the charge collection efficiency, an Sr{sup 90}{beta}-source set-up to measure the signal levels for a minimum ionizing particle (MIP), and a beam test with 180 GeV pions at CERN. This article gives a brief overview of

  17. An Indigenously Developed Insecticidal Aerosol

    Directory of Open Access Journals (Sweden)

    R. N. Varma

    1969-10-01

    Full Text Available A total of 6 "Test" insecticidal aerosols (TA-I to VI indigenously produced were tested during the years 1966-67 as suitable replacements for imported aerosols.TA-I produced deep yellow staining and a yellowish spray mist. Its capacity was only 120 ml fluid. TA-III types II and III containing modified aerosol formulation with "Esso solvent 3245" and mineral turpentine oil (Burmah Shelland Freon 12 11 (all indigenouswere comparable to he "SRA" in insecticidial efficacy. The container was also manufactured in the country and it compared well with the "SRA" in construction, resistance against rough usage and mechanical function. They were both finally approved for introduction in the services as replacement for imported aerosols. TA-IV performed well in inscticidial assessment, but the aerosols formulation. TA-V and VI were similar to TA-III types II and III respectively.

  18. Lost in follow-up rates in TRACER, ATLAS ACS 2, TRITON and TRA 2P trials: challenging PLATO mortality rates.

    Science.gov (United States)

    DiNicolantonio, James J; Can, Mehmet Mustafa; Serebruany, Victor L

    2013-04-15

    Extreme rates of vascular and all-cause mortality especially in the clopidogrel arm of the Platelet Inhibition and Patient Outcomes (PLATO) non-USA cohort raise concerns of data integrity, and call for independent verification of vital records in the national death registries. Four recent acute coronary syndrome (ACS) trials: Thrombin Receptor Antagonist for Clinical Event Reduction in Acute Coronary Syndrome (TRACER), Anti-Xa therapy to lower cardiovascular events in addition to standard therapy in subjects with acute coronary syndrome (ATLAS-ACS 2), Trial to Assess Improvement in Therapeutic Outcomes by Optimizing Platelet Inhibition with Prasugrel (TRITON), and the Thrombin Receptor Antagonist in Secondary Prevention of Atherothrombotic Ischemic Events (TRA 2P), provide a valuable opportunity to match lost in follow-up (LIFU) with mortality rates among similar ACS studies. To compare the LIFU from PLATO, TRACER, ATLAS-ACS 2, TRITON-TIMI 38 and TRA 2P trials. The disturbingly high (8.9%-14.7%) LIFU in PLATO was no match to LIFU in TRACER (0.1%), ATLAS ACS 2 (0.3%), TRITON (0.1%) and TRA 2P (0.1%). In fact, such an astronomical (49-147 fold higher) PLATO LIFU rate should result in less mortality compared to the other ACS trials since no event can be reported or adjudicated if the patient has been lost. Adjusting LIFU rate revealed that vascular (5.55%) and all cause (6.05%) mortality in PLATO was even more disparate than in TRACER (3.2% and 4.9%), ATLAS-ACS 2 (4.1% and 4.5%), TRITON-TIMI 38 (2.4% and 3.2%) and TRA 2P (3.0% and 5.3%) control arms, respectfully. Moreover, the incomplete CV follow-up in the ATLAS ACS 2 trial was later revealed to be around 12%, which lead to the rejection of rivaroxaban for the treatment of ACS. PLATO's LIFU rate was just as high, if not higher, than seen in ATLAS ACS 2. The chance to die in PLATO far exceeds the mortality risks observed in the clopidogrel arms of four recent ACS trials, which becomes especially evident after

  19. Optimizing the Stripping Procedure for LHCb

    CERN Document Server

    Richardson, Rachel

    2017-01-01

    The LHCb experiment faces a major challenge from the large amounts of data received while the LHC is running. The ability to sort this information in a useful manner is important for working groups to perform physics analyses. Both hardware and software triggers are used to decrease the data rate and then the stripping process is used to sort the data into streams and further into stripping lines. This project studies the hundreds of stripping lines to look for overlaps between them in order to make the stripping process more efficient.

  20. Solidification Structure of Low Carbon Steel Strips with Different Phosphorus Contents Produced by Strip Casting

    Institute of Scientific and Technical Information of China (English)

    Na LI; Zhenyu LIU; Yiqing QIU; Zhaosen LIN; Xianghua LIU; Guodong WANG

    2006-01-01

    In the present paper, low carbon steel strips with different phosphorus contents were produced using a twin roll strip casting process. The solidification structure was studied and its features were analyzed in detail. It was found that the strips possessed a fine microstructure compared with the mould cast steels. With increasing phosphorus content more ferrite has been formed with finer grains.

  1. (AJST) INSECTICIDAL ACTIVITY OF EXTRACTS DERIVED FROM ...

    African Journals Online (AJOL)

    opiyo

    of the brine shrimp Artemia salina (Leach). Antifeedant ... The pool of plants possessing insecticidal substances is enormous ... The most economically important of the natural plant ... processing and application of the product inexpensive. In.

  2. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the phen

  3. Preliminary assessment of insecticidal activity of Moroccan ...

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-11

    Mar 11, 2015 ... capitata, and the most important pupation reduction was obtained for isolates 37 ... Key words: Moroccan actinobacteria, insecticidal activity, biological screening, ..... extracts against culex tritaeniorhynchus and culex gelidus.

  4. Fitness costs associated with insecticide resistance.

    Science.gov (United States)

    Kliot, Adi; Ghanim, Murad

    2012-11-01

    Insects are exposed to a variety of stress factors in their environment, and, in many cases for insect pests to agriculture, those factors include toxic chemical insecticides. Coping with the toxicity of insecticides can be costly and requires energy and resource allocation for adaptation and survival. Several behavioural, physiological and genetic mechanisms are used by insects to handle toxic insecticides, sometimes leading to resistance by constitutive overexpression of detoxification enzymes or inducing mutations in the target sites. Such actions are costly and may affect reproduction, impair dispersal ability and have several other effects on the insect's fitness. Fitness costs resulting from resistance to insecticides has been reported in many insects from different orders, and several examples are given in this mini-review.

  5. DESCRIPTIVE ANALYSIS OF HOUSEHOLD INSECTICIDE IN COMMUNITY

    Directory of Open Access Journals (Sweden)

    Aram Sih Joharina

    2014-06-01

    Full Text Available The most popular and effective vector control is the use of insecticides. Surveywas done in the houses and some supermarket to know many kind of insecticides usedby people. The formulation, active ingredients, and concentration were recorded andanalyzed. Based on the results of the survey, household insecticides formulated invarious formulations such as liquid, mosquito coils, aerosol, mat and liquid vaporizer,chalk and paper burn. In addition to formulation, active ingredients and concentrationalso vary. Almost all household insecticide products on the market using the syntheticpyrethroid. Selection of household insecticides should be adapted to the type of insectpests because each type of active ingredients and formulations have advantages anddisadvantages. Efficacy of various active ingredients in various formulations has beenstudied and the results vary widely. Insecticide efficacy is influenced by the type ofactive ingredient, dosage, concentration, formulation, and the susceptibility of insectspecies, temperature, sunlight, wind, and application method.Key word: household insecticide, insecticides formulation, active ingredientsABSTRAKPengendalian serangga vektor penyakit yang paling efektif dan populer adalahpenggunaan insektisida. Survei dilakukan di masyarakat dan supermarket untuk mengetahuijcnis-jenis insektisida yang digunakan oleh masyarakat. Berdasarkan hasil survei, insektisidarumah tangga terkemas dalam berbagai formulasi antara lain liquid, mosquito coil, aerosol, mat& liquid vaporizer, kapur serangga dan kertas bakar. Disamping formulasi, bahan aktif dankonsentrasi yang digunakan juga bermacam-macam. Hampir semua produk insektisida rumahtangga di pasaran menggunakan bahan aktif golongan piretroid sintetik. Pemilihan insektisidarumah tangga hendaknya disesuaikan dengan jenis serangga sasaran karena tiap jenis bahan aktifdan formulasi memiliki kelcbihan dan kekurangan. Efikasi berbagai bahan aktif dalam berbagaiformulasi telah

  6. Preparation of colloidal gold immunochromatography strip for detection of methamidophos residue

    Institute of Scientific and Technical Information of China (English)

    SHI Chenggang; ZHAO Suqing; ZHANG Kun; HONG Guobao; ZHU Zhenyu

    2008-01-01

    Methamidophos (Met) is a broad spectrum organophosphorus insecticide and acaricide. Even a trace of its residue is harmful to humans and many animals. In this study, the synthesis and identification of colloidal gold particles and antibody-colloidal gold conjugates were performed, and the preparation of colloidal gold immunochromatography strip was conducted for detection of Met residue. The size of colloidal gold particles was checked using a transmission electron microscope (TEM). The formation of antibody-colloidal gold conjugates was monitored by UV/Vis spectroscopy. The preparation of colloidal gold immunochromatography strips,analysis of Met standard solutions, and other four pesticides and vegetable samples were operated with common methods and principals.The TEM images showed the average diameter of colloidal gold particles was almost the same size: approximately 40.0 nm in diameter.For the conjugation of colloidal gold and monoclonal antibody (MAb), 0.03 mg/ml of MAb was confirmed to be the minimum amount for stabilization of colloidal gold. With the prepared colloidal gold immunochromatography test strip to determine the standard Met solution, the results demonstrated a detection limit of approximately 1.0 μg/ml. Cross-reaction indicated that the strip had a high specificity to Met. The results of 10 green vegetable sample tests confirmed that one sample was positive by HPLC analysis. There was evidence to suggest that colloidal gold particles and antibody-colloidal gold conjugates were synthesized successfully. The prepared colloidal gold immunochromatography strip was applicable for preliminary screening of Met residue.

  7. Dosimetric evaluation of PLATO and Oncentra treatment planning systems for High Dose Rate (HDR) brachytherapy gynecological treatments

    Science.gov (United States)

    Singh, Hardev; Herman, Tania De La Fuente; Showalter, Barry; Thompson, Spencer J.; Syzek, Elizabeth J.; Herman, Terence; Ahmad, Salahuddin

    2012-10-01

    This study compares the dosimetric differences in HDR brachytherapy treatment plans calculated with Nucletron's PLATO and Oncentra MasterPlan treatment planning systems (TPS). Ten patients (1 T1b, 1 T2a, 6 T2b, 2 T4) having cervical carcinoma, median age of 43.5 years (range, 34-79 years) treated with tandem & ring applicator in our institution were selected retrospectively for this study. For both Plato and Oncentra TPS, the same orthogonal films anterior-posterior (AP) and lateral were used to manually draw the prescription and anatomical points using definitions from the Manchester system and recommendations from the ICRU report 38. Data input for PLATO was done using a digitizer and Epson Expression 10000XL scanner was used for Oncentra where the points were selected on the images in the screen. The prescription doses for these patients were 30 Gy to points right A (RA) and left A (LA) delivered in 5 fractions with Ir-192 HDR source. Two arrangements: one dwell position and two dwell positions on the tandem were used for dose calculation. The doses to the patient points right B (RB) and left B (LB), and to the organs at risk (OAR), bladder and rectum for each patient were calculated. The mean dose and the mean percentage difference in dose calculated by the two treatment planning systems were compared. Paired t-tests were used for statistical analysis. No significant differences in mean RB, LB, bladder and rectum doses were found with p-values > 0.14. The mean percent difference of doses in RB, LB, bladder and rectum are found to be less than 2.2%, 1.8%, 1.3% and 2.2%, respectively. Dose calculations based on the two different treatment planning systems were found to be consistent and the treatment plans can be made with either system in our department without any concern.

  8. Dosimetric evaluation of PLATO and Oncentra treatment planning systems for High Dose Rate (HDR) brachytherapy gynecological treatments

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hardev; De La Fuente Herman, Tania; Showalter, Barry; Thompson, Spencer J.; Syzek, Elizabeth J.; Herman, Terence; Ahmad, Salahuddin [Department of Radiation Oncology, Peggy and Charles Stephenson Oklahoma Cancer Center, University of Oklahoma Health Sciences Center, Oklahoma City, OK 73104 (United States)

    2012-10-23

    This study compares the dosimetric differences in HDR brachytherapy treatment plans calculated with Nucletron's PLATO and Oncentra MasterPlan treatment planning systems (TPS). Ten patients (1 T1b, 1 T2a, 6 T2b, 2 T4) having cervical carcinoma, median age of 43.5 years (range, 34-79 years) treated with tandem and ring applicator in our institution were selected retrospectively for this study. For both Plato and Oncentra TPS, the same orthogonal films anterior-posterior (AP) and lateral were used to manually draw the prescription and anatomical points using definitions from the Manchester system and recommendations from the ICRU report 38. Data input for PLATO was done using a digitizer and Epson Expression 10000XL scanner was used for Oncentra where the points were selected on the images in the screen. The prescription doses for these patients were 30 Gy to points right A (RA) and left A (LA) delivered in 5 fractions with Ir-192 HDR source. Two arrangements: one dwell position and two dwell positions on the tandem were used for dose calculation. The doses to the patient points right B (RB) and left B (LB), and to the organs at risk (OAR), bladder and rectum for each patient were calculated. The mean dose and the mean percentage difference in dose calculated by the two treatment planning systems were compared. Paired t-tests were used for statistical analysis. No significant differences in mean RB, LB, bladder and rectum doses were found with p-values > 0.14. The mean percent difference of doses in RB, LB, bladder and rectum are found to be less than 2.2%, 1.8%, 1.3% and 2.2%, respectively. Dose calculations based on the two different treatment planning systems were found to be consistent and the treatment plans can be made with either system in our department without any concern.

  9. Hardy inequalities in strips on ruled surfaces

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available We consider the Dirichlet Laplacian in infinite two-dimensional strips defined as uniform tubular neighbourhoods of curves on ruled surfaces. We show that the negative Gauss curvature of the ambient surface gives rise to a Hardy inequality and we use this to prove certain stability of spectrum in the case of asymptotically straight strips about mildly perturbed geodesics.

  10. Tactual Strip Maps as Navigational Aids.

    Science.gov (United States)

    Golledge, R. G.

    1991-01-01

    This article reviews the history and use of tactual maps by blind and visually impaired travelers. It discusses textual patterns, symbols, and graphics; differences between conventional geographic-cartographic maps and strip maps used as navigational aids; and current advances, including disposable, quick-to-produce, and easy-to-update strip maps.…

  11. 33 CFR 157.128 - Stripping system.

    Science.gov (United States)

    2010-07-01

    ... of the following devices for stripping oil from each cargo tank: (1) A positive displacement pump. (2) A self-priming centrifugal pump. (3) An eductor (4) Any other device accepted by the Commandant. (d... positive displacement pump or a self-priming centrifugal pump, the stripping system must have the...

  12. Water problems in Gaza Strip,Palestine

    Institute of Scientific and Technical Information of China (English)

    Ismail ALGHALBAN

    2001-01-01

    The only source for water in Gaza strip, southern Palestine, is the groundwater aquifer. The Pliocene - Pleistocene aquifer has two serious problems: quantity and quality. This study is an attempt to identify the problems and to suggest solutions for water problems in Gaza strip. In addition, some rules for rehabilitation of the aquifers were suggested.

  13. 7 CFR 29.6041 - Strips.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Strips. 29.6041 Section 29.6041 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Standards Definitions § 29.6041 Strips. The sides of a tobacco leaf from which the stem has...

  14. Ancient philosophical ideas of the soul (Plato-Aristotelian tradition and Stoicism as a source of Patristic Thought

    Directory of Open Access Journals (Sweden)

    Zaitsev Cornelius

    2014-10-01

    Full Text Available The article discusses the ancient idea of the soul that in the patristic era has been enriched by the perception of the methodology of ancient philosophy. Greek and Roman thinkers considered some properties of the soul, its immortality, revealed its “levels and strata” (Plato, Aristotle, expressed first guesses about the nature of sinful passions (the Stoics. But some aspects still remained unresolved so far. This is the issue of materiality or immateriality, of the soul, which "raised" in the Russian Empire in the 19th century (the dispute saints Theophan the Recluse and Ignatius Brianchaninov and remains relevant today.

  15. Toward a Poeticognosis: Re-reading Plato's The Republic via Wallace Stevens' "An Ordinary Evening in New Haven"

    Directory of Open Access Journals (Sweden)

    Dan Disney

    2008-01-01

    Full Text Available This article is a language-based re-reading of Plato's exile of the poets via Wallace Stevens' poem-manifesto, "An Ordinary Evening in New Haven." I examine how philosophy and poetry use language differently in order to deconstruct an origin of the speech-acts -- wonder -- that I then identify as a phenomenological difference between philosophers and poets. I contend that the thinking-into-language of philosophers is based in theoria, comprehension, and a resulting closure of wonder. I contrast this with the processes of poets, who I show to be moving thought into language via gnosis, apprehension, and a phenomenology opening onto inexhaustible wonder.

  16. Love and/in psychoanalysis: a commentary on Lacan's reading of Plato's Symposium in Seminar VIII: Transference.

    Science.gov (United States)

    Fink, Bruce

    2015-02-01

    What is love and what part does it play in psychoanalysis? Where are the analyst and the analysand situated in relation to the roles defined as those of the "lover" and the "beloved"? Jacques Lacan explores these and other questions in his soon-to-be-published Seminar VIII: Transference by providing an extensive commentary on Plato's most famous dialogue on love, the Symposium. This paper outlines some of the major points about love that grow out of Lacan's reading of the dialogue and examines their relevance to the analytic setting. Can the analyst be characterized as a sort of modern-day Socrates?

  17. ¿Solamente platos? Cerámicas de barniz rojo en el depósito ibérico del Zacatín (Granada)

    OpenAIRE

    Sánchez Moreno, Amparo; Niveau de Villedary y Mariñas, Ana María; Adroher Auroux, Andrés María

    2015-01-01

    Se presenta un conjunto homogéneo de platos de barniz rojo indígena con un perfil muy particular y sin paralelos conocidos por el momento. Dicho conjunto formaba parte del depósito ritual hallado en la granadina calle del Zacatín, una fosa junto al río Darro que se rellenó con los resultantes de un festín sagrado posiblemente en relación con el propio río. En este trabajo planteamos que estos platos fueron fabricados ex profeso para el ritual que tuvo lugar fuera de las murallas de Iliberri e...

  18. Circuit realization microwave antennas-oscillator on strip antennas

    OpenAIRE

    Golynskyy, V. D.; Prudyus, I. N.

    2009-01-01

    Showing special feature of development circuitries microwave transistors antennasoscillator on strip dielectric-resonator-antennas. Showing circuitries and technical characteristics of developed microwave antennasoscillator on strip.

  19. The micro-fascism of Plato's good citizen: producing (dis)order through the construction of risk.

    Science.gov (United States)

    O'Byrne, Patrick; Holmes, Dave

    2007-04-01

    The human body has come to be seen as forever susceptible to both external and internal hazards, which in many circumstances require immediate, heroic, and expensive intervention. In response to this, there has been a shift from a treatment-based healthcare model to one of prevention wherein nurses play an integral role by identifying and assessing risks for individuals, communities, and populations. This paper uses Deborah Lupton's outline of the spectrum of risk and applies the theoretical works of Foucault and Plato to demonstrate the means by which nurses maintain social order by identifying and counselling risk takers. It also utilizes the work of Deleuze and Guattari to illustrate how Plato's framework for creating social order through the creation of the good citizen can be viewed as a micro-fascist system, which has been adopted wholeheartedly by preventative health professionals. The goal of this paper is to present an alternate understanding of risk to provide nurses and other healthcare professionals with a non-traditional appreciation of certain aspects of their practice as researchers and clinicians.

  20. Negação e diferença em Platão Negation and diference in Plato

    Directory of Open Access Journals (Sweden)

    Eliane Christina de Souza

    2010-01-01

    Full Text Available Platão, ao tratar da negação no diálogo Sofista, afirma que sempre que enunciamos o que não é, não enunciamos algo contrário ao que é, mas algo diferente. A negação significa cada parte da natureza da diferença em antítese ao que é. Tal tratamento da negação resulta da necessidade de resolver alguns problemas colocados pelo eleatismo. Propõe-se indicar esses problemas e examinar o tratamento que Platão dá ao não-ser como diferença.Plato, in dealing with negation in the dialogue Sophist, says that when we say what is not, we speak not of something that is the opposite of being, but of something different. Negation means each part of the nature of the difference in antithesis to what is. This treatment of negation results from the need to solve some problems posed by eleatism. It is proposed to indicate these problems and examine the treatment that Plato gives to non-being as difference.

  1. Comparative Study of Meanings and Status of Imagination in Mathnavi and Plato’s Ideas

    Directory of Open Access Journals (Sweden)

    sh alyari

    2013-02-01

    Full Text Available Describing and explaining the nature of imagination and its function with regard to human being and ontology has always been one of the preoccupations of philosophers and thinkers. Plato is the first philosopher who considered an epistemological status for imagination and, by dividing the world into the world of reason and world of senses, he ascribed the knowledge of imagination to the world of senses. In different parts of Mathnavi, Molavi, the great Muslim-Iranian mystic, has paid much attention to imagination, its types, its status in the Knowledge of Man (both physical and metaphysical affairs and its various influences on the body, soul and mental states of any individual. Thus, the present article aims to compare the concept of imagination in the view of the two thinkers. For reaching such aim, while using a descriptive-comparative method, first, the definitions of imagination in Mathnavi and Plato’s ideas are investigated and, then, the similarities and differences of the two views are shown. The conclusion is that their ideas are similar with regard to unreality and shadowiness of the world and phenomena, the relation between imitation and imagination, deficiency and restrictions of imagination for understanding the reality, whereas their ideas are different regarding the power of imagination, its epistemological status and the meaning and influence of it.

  2. Transfusion and blood donation in comic strips.

    Science.gov (United States)

    Lefrère, Jean-Jacques; Danic, Bruno

    2013-07-01

    The representation of blood transfusion and donation of blood in the comic strip has never been studied. The comic strip, which is a relatively recent art, emerged in the 19th century before becoming a mass medium during the 20th century. We have sought, by calling on collectors and using the resources of Internet, comic strips devoted, wholly or in part, to the themes of transfusion and blood donation. We present some of them here in chronologic order, indicating the title, country of origin, year of publication, and names of authors. The theme of the superhero using transfusion to transmit his virtues or his powers is repeated throughout the 20th century in North American comic strips. More recently, comic strips have been conceived from the outset with a promotional aim. They perpetuate positive images and are directed toward a young readership, wielding humor to reduce the fear of venipuncture. Few comic strips denounce the abuse of the commercialization of products derived from the human body. The image of transfusion and blood donation given by the comic strips is not to be underestimated because their readership is primarily children, some of whom will become blood donors. Furthermore, if some readers are transfused during their lives, the impact of a memory more or less conscious of these childhood readings may resurface, both in hopes and in fears.

  3. A Strip Cell in Pyroelectric Devices

    Directory of Open Access Journals (Sweden)

    An-Shen Siao

    2016-03-01

    Full Text Available The pyroelectric effect affords the opportunity to convert temporal temperature fluctuations into usable electrical energy in order to develop abundantly available waste heat. A strip pyroelectric cell, used to enhance temperature variation rates by lateral temperature gradients and to reduce cell capacitance to further promote the induced voltage, is described as a means of improving pyroelectric energy transformation. A precision dicing saw was successfully applied in fabricating the pyroelectric cell with a strip form. The strip pyroelectric cell with a high-narrow cross section is able to greatly absorb thermal energy via the side walls of the strips, thereby inducing lateral temperature gradients and increasing temperature variation rates in a thicker pyroelectric cell. Both simulation and experimentation show that the strip pyroelectric cell improves the electrical outputs of pyroelectric cells and enhances the efficiency of pyroelectric harvesters. The strip-type pyroelectric cell has a larger temperature variation when compared to the trenched electrode and the original type, by about 1.9 and 2.4 times, respectively. The measured electrical output of the strip type demonstrates a conspicuous increase in stored energy as compared to the trenched electrode and the original type, by of about 15.6 and 19.8 times, respectively.

  4. High energy H- ion transport and stripping

    Energy Technology Data Exchange (ETDEWEB)

    Chou, W.; /Fermilab

    2005-05-01

    During the Proton Driver design study based on an 8 GeV superconducting RF H{sup -} linac, a major concern is the feasibility of transport and injection of high energy H{sup -} ions because the energy of H{sup -} beam would be an order of magnitude higher than the existing ones. This paper will focus on two key technical issues: (1) stripping losses during transport (including stripping by blackbody radiation, magnetic field and residual gases); (2) stripping efficiency of carbon foil during injection.

  5. THE DEVELOPMENT OF FCC STRIPPING TECHNOLOGY

    Institute of Scientific and Technical Information of China (English)

    ZHANGZhen-qian

    2003-01-01

    This article briefly describes the major patents domestic and the abroad,and the current situation and achievements of FCC stripping technology in China.The develping trend of FCC stripping technology is presented,including further developments of FCC stripper to improve unit performance,combination of the stripper and pre-stripper within disengager to from a complete high-efficiency FCC stripping system.In addition to high efficiency,simple structure and easiness of installation and maintenance for a new FCC stripper are all of consideration.

  6. Saving Energy Through Advanced Power Strips (Poster)

    Energy Technology Data Exchange (ETDEWEB)

    Christensen, D.

    2013-10-01

    Advanced Power Strips (APS) look just like ordinary power strips, except that they have built-in features that are designed to reduce the amount of energy used by many consumer electronics. There are several different types of APSs on the market, but they all operate on the same basic principle of shutting off the supply power to devices that are not in use. By replacing your standard power strip with an APS, you can signifcantly cut the amount of electricity used by your home office and entertainment center devices, and save money on your electric bill. This illustration summarizes the different options.

  7. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Matowo Pc

    al., 1999). The occurrence of insecticide resistant Culex mosquitoes has also been reported in Wete, ... Emerged pupae were sucked from the larval containers .... Key: aWHO criteria for assessing susceptibility to insecticides of mosquitoes; ...

  8. Evaluation of the Repellent and Insecticidal Activities of the Leaf ...

    African Journals Online (AJOL)

    ADOWIE PERE

    high repellent and insecticidal activities demonstrated by the root powder ... generally low as a result of serious insect pest attacks ..... to have clear insecticidal properties (DeGeyter, 2012) ... nematicidal ingredients from neem leaves, siam.

  9. Potency of Traditional Insecticide Materials against Stored Bean ...

    African Journals Online (AJOL)

    Potency of Traditional Insecticide Materials against Stored Bean Weevil, ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING AJOL ... apply traditional insecticide materials in the protection of bean from insect pests.

  10. Electronic structure of pesticides: 1. Organochlorine insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Novak, Igor, E-mail: inovak@csu.edu.au [Charles Sturt University, POB 883, Orange, NSW 2800 (Australia); Kovac, Branka [Physical Chemistry Division, ' R. Boskovic' Institute, HR-10000 Zagreb (Croatia)

    2011-11-15

    Highlights: {yields} Electronic structure of several organochlorine insecticides has been determined by UV photoelectron spectroscopy and high-level ab initio calculations. {yields} The electronic structure obtained from spectra has been related to their biological activity. {yields} The molecular modes of binding to appropriate receptors are rationalized in view of the molecule's electronic structure and conformational flexibility. - Abstract: The electronic structures of six organochlorine insecticides: {gamma}-lindane (I), aldrin (II), dieldrin (III), DDD (IV), DDE (V) and DDT (VI) have been investigated by UV photoelectron spectroscopy (UPS), quantum chemical calculations and comparison with molecular modelling studies. Their electronic and molecular structures are discussed in order to rationalize their biological activity. In this work we relate the biological activity of these insecticides to their experimentally observed electronic and molecular structures.

  11. Inapproximability of maximal strip recovery

    CERN Document Server

    Jiang, Minghui

    2009-01-01

    In comparative genomic, the first step of sequence analysis is usually to decompose two or more genomes into syntenic blocks that are segments of homologous chromosomes. For the reliable recovery of syntenic blocks, noise and ambiguities in the genomic maps need to be removed first. Maximal Strip Recovery (MSR) is an optimization problem proposed by Zheng, Zhu, and Sankoff for reliably recovering syntenic blocks from genomic maps in the midst of noise and ambiguities. Given $d$ genomic maps as sequences of gene markers, the objective of \\msr{d} is to find $d$ subsequences, one subsequence of each genomic map, such that the total length of syntenic blocks in these subsequences is maximized. For any constant $d \\ge 2$, a polynomial-time 2d-approximation for \\msr{d} was previously known. In this paper, we show that for any $d \\ge 2$, \\msr{d} is APX-hard, even for the most basic version of the problem in which all gene markers are distinct and appear in positive orientation in each genomic map. Moreover, we provi...

  12. A video strip chart program

    Energy Technology Data Exchange (ETDEWEB)

    Jones, N.L. [Oak Ridge National Lab., TN (United States). Accelerator-Based Atomic Physics

    1994-12-31

    A strip chart recorder has been utilized for trend analysis of the Oak Ridge National Laboratory EN tandem since 1987. At the EN, the author could not afford the nice eight channel thermal pen recorder that was used at the 25 URC. He had to suffice with two channel fiber tip or capillary pen type recorders retrieved from salvage and maintained with parts from other salvaged recorders. After cycling through several machines that eventually became completely unserviceable, a search for a new thermal recorder was begun. As much as he hates to write computer code, he decided to try his hand at getting an old data acquisition unit, that had been retrieved several years ago from salvage, to meet his needs. A BASIC language compiler was used because time was not available to learn a more advanced language. While attempting to increase acquisition and scroll speed on the 6 MHz 80286 that the code was first developed on, it became apparent that scrolling only the first small portion of the screen at high speed and then averaging that region and histogramming the average provided both the speed necessary for capturing fairly short duration events, and a trend record without use of back scrolling and disk storage routines. This turned out to be quite sufficient.

  13. The Case against the Arts from Plato to Tolstoy and Its Implications for Why and How the Arts Should Be Taught in Schools

    Science.gov (United States)

    Tate, Nicholas

    2016-01-01

    From Plato onwards many of the great Western thinkers have explored the nature of the arts, their contribution to society and their role in education. This has often involved a discussion of the potentially negative impact of the arts. The recurring message has been that the arts can warp judgment, elevate emotion at the expense of reason,…

  14. Why Did Socrates Deny That He Was a Teacher? Locating Socrates among the New Educators and the Traditional Education in Plato's "Apology of Socrates"

    Science.gov (United States)

    Mintz, Avi I.

    2014-01-01

    Plato's "Apology of Socrates" contains a spirited account of Socrates' relationship with the city of Athens and its citizens. As Socrates stands on trial for corrupting the youth, surprisingly, he does not defend the substance and the methods of his teaching. Instead, he simply denies that he is a teacher. Many scholars have…

  15. Cardiovascular events in acute coronary syndrome patients with peripheral arterial disease treated with ticagrelor compared to clopidogrel: Data from the PLATO trials

    DEFF Research Database (Denmark)

    Patel, Manesh R.; Becker, Richard C.; Wojdyla, Daniel M.;

    Abstract 14299: Cardiovascular Events in Acute Coronary Syndrome Patients With Peripheral Arterial Disease Treated With Ticagrelor Compared to Clopidogrel: Data From the PLATO Trial Manesh R Patel1; Richard C Becker1; Daniel M Wojdyla2; Håkan Emanuelsson3; William Hiatt4; Jay Horrow5; Steen Husted6...

  16. Cytochromes P450 and insecticide resistance.

    Science.gov (United States)

    Scott, J G

    1999-09-01

    The cytochrome P450-dependent monooxygenases (monooxygenases) are an extremely important metabolic system involved in the catabolism and anabolism of xenobiotics and endogenous compounds. Monooxygenase-mediated metabolism is a common mechanism by which insects become resistant to insecticides as evidenced by the numerous insect species and insecticides affected. This review begins by presenting background information about P450s, the role of monooxygenases in insects, and the different techniques that have been used to isolate individual insect P450s. Next, insecticide resistance is briefly described, and then historical information about monooxygenase-mediated insecticide resistance is reviewed. For any case of monooxygenase-mediated resistance, identification of the P450(s) involved, out of the dozens that are present in an insect, has proven very challenging. Therefore, the next section of the review focuses on the minimal criteria for establishing that a P450 is involved in resistance. This is followed by a comprehensive examination of the literature concerning the individual P450s that have been isolated from insecticide resistant strains. In each case, the history of the strain and the evidence for monooxygenase-mediated resistance are reviewed. The isolation and characterization of the P450(s) from the strain are then described, and the evidence of whether or not the isolated P450(s) is involved in resistance is summarized. The remainder of the review summarizes our current knowledge of the molecular basis of monooxygenase-mediated resistance and the implications for the future. The importance of these studies for development of effective insecticide resistance management strategies is discussed.

  17. Plaque accumulations caused by interdental stripping.

    Science.gov (United States)

    Radlanski, R J; Jäger, A; Schwestka, R; Bertzbach, F

    1988-11-01

    Human enamel surfaces were stripped with orthodontic grinding and finishing materials, and evaluated with the scanning electron microscope (SEM). Even under in vitro conditions with the finest finishing strips, it was not possible to produce an enamel surface free of the furrows that result from the initial abrasion caused by the coarse strip. Enamel surfaces stripped gradually from coarse to superfine were left in the mouths of patients for 12 weeks and evaluated with the SEM. The edges of the furrows were found to be smoother but the furrows remained wide and deep enough to facilitate more plaque accumulations than those on untreated surfaces. The use of dental floss did not result in prevention of plaque accumulations along the bottom of the furrows.

  18. Finite element modeling of corneal strip extensometry

    CSIR Research Space (South Africa)

    Botha, N

    2012-12-01

    Full Text Available numerically modelled in several studies, this study focusses on accurately modelling the strip extensiometry test. Two methods were considered to simulate the experimental conditions namely, a single phase and a two phase method. A finite element model...

  19. Strip Casting of High Performance Structural Alloys

    Institute of Scientific and Technical Information of China (English)

    S S Park; J G Lee; Nack J Kim

    2004-01-01

    There exists a great need for the development of high performance alloys due to increasing demands for energy conservation and environmental protection. Application of strip casting shows a strong potential for the improvement of properties of existing alloys and also for the development of novel alloy systems with superior properties. The present paper reviews our Center's activities in the development of high performance alloys by strip casting. Examples include (1) Al alloys, (2) wrought Mg alloys, and (3) bulk metallic glass (BMG) alloys.

  20. Speed Control and Coiling Temperature Control of Strip

    Institute of Scientific and Technical Information of China (English)

    CAI Xiao-hui; ZHANG Dian-hua; WANG Guo-dong; LIU Xiang-hua; FAN Lei

    2004-01-01

    Considering the strip speed during controlled laminar cooling on Baosteel 1580 hot strip mill in China, the influence of strip speed fluctuation on coiling temperature control for the tail and "neck" of the strip was analyzed. The optimization strategies were put forward and proved effective in operation.

  1. Excess Production Capacity Squeezes Profits of Brass Strip Enterprises

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    <正>Between 2003 and 2006,under the backdrop of rapid growth of domestic demand for brass strip and soaring copper price,brass strip manufacturers made a fortune.And brass strip manufacturers mushroomed in Zhejiang,Anhui and Jiangsu.Large brass strip manufacturers

  2. Process development of thin strip steel casting

    Energy Technology Data Exchange (ETDEWEB)

    Sussman, R.C.; Williams, R.S.

    1990-12-01

    An important new frontier is being opened in steel processing with the emergence of thin strip casting. Casting steel directly to thin strip has enormous benefits in energy savings by potentially eliminating the need for hot reduction in a hot strip mill. This has been the driving force for numerous current research efforts into the direct strip casting of steel. The US Department of Energy initiated a program to evaluate the development of thin strip casting in the steel industry. In earlier phases of this program, planar flow casting on an experimental caster was studied by a team of engineers from Westinghouse Electric corporation and Armco Inc. A subsequent research program was designed as a fundamental and developmental study of both planar and melt overflow casting processes. This study was arranged as several separate and distinct tasks which were often completed by different teams of researchers. An early task was to design and build a water model to study fluid flow through different designs of planar flow casting nozzles. Another important task was mathematically modeling of melt overflow casting process. A mathematical solidification model for the formation of the strip in the melt overflow process was written. A study of the material and conditioning of casting substrates was made on the small wheel caster using the melt overflow casting process. This report discusses work on the development of thin steel casting.

  3. Process development of thin strip steel casting

    Energy Technology Data Exchange (ETDEWEB)

    Sussman, R.C.; Williams, R.S.

    1990-12-01

    An important new frontier is being opened in steel processing with the emergence of thin strip casting. Casting steel directly to thin strip has enormous benefits in energy savings by potentially eliminating the need for hot reduction in a hot strip mill. This has been the driving force for numerous current research efforts into the direct strip casting of steel. The US Department of Energy initiated a program to evaluate the development of thin strip casting in the steel industry. In earlier phases of this program, planar flow casting on an experimental caster was studied by a team of engineers from Westinghouse Electric corporation and Armco Inc. A subsequent research program was designed as a fundamental and developmental study of both planar and melt overflow casting processes. This study was arranged as several separate and distinct tasks which were often completed by different teams of researchers. An early task was to design and build a water model to study fluid flow through different designs of planar flow casting nozzles. Another important task was mathematically modeling of melt overflow casting process. A mathematical solidification model for the formation of the strip in the melt overflow process was written. A study of the material and conditioning of casting substrates was made on the small wheel caster using the melt overflow casting process. This report discusses work on the development of thin steel casting.

  4. Novel photoresist stripping technology using steam-water mixture*

    Institute of Scientific and Technical Information of China (English)

    Wang Lei; Hui Yu; Gao Chaoqun; Jing Yupeng

    2011-01-01

    A novel wet vapor photoresist stripping technology is developed as an alternative to dry plasma ashing and wet stripping. Experiments using this technology to strip hard baked SU-8 photoresist, aurum and chromium film are carried out. Then the images of stripping results are shown and the mechanism is analyzed and discussed.The most striking result of this experiment is that the spraying mixture of steam and water droplets can strip photoresist and even metal film with ease.

  5. Insecticide Resistance: Challenge to Pest Management and Basic Research

    Science.gov (United States)

    Brattsten, L. B.; Holyoke, C. W.; Leeper, J. R.; Raffa, K. F.

    1986-03-01

    The agricultural use of synthetic insecticides usually protects crops but imposes strong selection pressures that can result in the development of resistance. The most important resistance mechanisms are enhancement of the capacity to metabolically detoxify insecticides and alterations in target sites that prevent insecticides from binding to them. Insect control methods must incorporate strategies to minimize resistance development and preserve the utility of the insecticides. The most promising approach, integrated pest management, includes the use of chemical insecticides in combination with improved cultural and biologically based techniques.

  6. Insecticide resistance selection in rice planthoppers

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ Brown planthopper (BPH, Nilaparvata lugens Stal) and white backed planthopper (WBPH, Sogatella furcifera Horvath) are the main insects on rice in China. The insecticide resistance of the two planthoppers have often been reported. Availability of the resistant population is a prerequisite for studying the resistance mechanism. In this paper, one method to select methamidophos resistance of the two planthoppers was recommended.

  7. Fungicide and insecticide residues in rice grains

    Directory of Open Access Journals (Sweden)

    Gustavo Mack Teló

    2017-01-01

    Full Text Available The objective of this study was to analyse residues of fungicides and insecticides in rice grains that were subjected to different forms of processing. Field work was conducted during three crop seasons, and fungicides and insecticides were applied at different crop growth stages on the aerial portion of the rice plants. Azoxystrobin, difenoconazole, propiconazole, tebuconazole, and trifloxystrobin fungicides were sprayed only once at the R2 growth stage or twice at the R2 and R4 growth stages; cypermethrin, lambda-cyhalothrin, permethrin, and thiamethoxam insecticides were sprayed at the R2 growth stage; and permethrin was sprayed at 5-day intervals from the R4 growth stage up to one day prior to harvest. Pesticide residues were analysed in uncooked, cooked, parboiled, polished and brown rice grains as well as rice hulls during the three crop seasons, for a total of 1458 samples. The samples were analysed by gas chromatography with electron capture detection (GC-ECD using modified QuEChERS as the extraction method. No fungicide or insecticide residues were detected in rice grain samples; however, azoxystrobin and cypermethrin residues were detected in rice hull samples.

  8. The 1975 Insecticide, Herbicide, Fungicide Quick Guide.

    Science.gov (United States)

    Page, Bill G.; Thomson, W. T.

    This is a quick guide for choosing a chemical to use to control a certain pest on a specific crop. Information in the book was obtained from manufacturers' labels and from the USDA and FDA pesticide summary. The book is divided into four parts: (1) insecticides, (2) herbicides, (3) fungicides, and (4) conversion tables. Each of the first three…

  9. Insecticides for Suppression of Nylanderia fulva

    Directory of Open Access Journals (Sweden)

    Dawn Calibeo

    2017-08-01

    Full Text Available Nylanderia fulva (Mayr is an invasive ant that is a serious pest in the southern United States. Pest control operators and homeowners are challenged to manage pest populations below acceptable thresholds. Contact and bait insecticides are key components of an Integrated Pest Management (IPM strategy, however, little is known about their efficacy. In repellency and efficacy bioassays, N. fulva were not completely repelled by any insecticide tested, although fewer ants crossed a surface treated with Temprid®. Few insecticides provided rapid control. Termidor® and Temprid® were the best performing with mean mortality of 100% in 13.4 and 19.0 days, respectively. In no-choice bait acceptance studies, it was shown that N. fulva generally had greater acceptance of carbohydrate-based ant baits (Advion®, InTiceTM (gel, and InTiceTM (granular. However, mortality was low for the InTiceTM baits in a 7-day bioassay. Maxforce® Ant Killer Bait Gel and Advance® 375A in the spring and Maxforce® Complete in the summer and fall required the fewest days to reach 100% mortality. Bait active ingredients that resulted in the highest mortality were hydramethylnon and fipronil. These data on the efficacy of commercially available contact and bait insecticides provide valuable information to manage this invasive pest.

  10. [Drugs and pharmaceutical episodes in "Sazae-San": Japanese comic strips in 1940s-1970s].

    Science.gov (United States)

    Goino, Masahiko

    2009-01-01

    This is a report on episodes with references to drugs and pharmaceuticals in one of the most famous Japanese comic strips, "Sazae-san", in the period from 1945 to 1974. There were 111 episodes of "Sazae-san" including references to drugs and pharmaceuticals in this period. In the period from 1945 to 1954, there were some references to pharmacists and pharmacies but only a small number of references in the period from 1965 to 1974. In the period from 1945 to 1954, there were references to disinfectants and insecticides in the hygienic chemistry field. However, in the period from 1965 to 1974, there were references to environmental problems, food additives and agricultural chemicals. As drug development has progressed, the number of references to practical drugs in "Sazae-san" has decreased over the period from 1945-1974.

  11. Oviposition and olfaction responses of Aedes aegypti mosquitoes to insecticides.

    Science.gov (United States)

    Canyon, D V; Muller, R

    2013-12-01

    Insecticide applications are not particularly effective on Aedes aegypti mosquitoes which has been attributed to their 'closet' behaviour, or ability to rest in places that remain unexposed to insecticides. Some researchers have suggested that insecticides repel mosquitoes, which would result in less exposure and increased dispersal. If repellence due to insecticides is a fact, acquiring a vector-borne disease, such as dengue, could legitimately be attributed to local vector control efforts and this would lead to restitution claims. This study thus investigated the effect of insecticide presence on mosquito behaviour indirectly via oviposition and directly via olfactory response. In all experiments, oviposition in each insecticide compared to its water and ethanol controls was not significantly different. This indicates that Ae. aegypti mosquitoes are not affected by insecticide presence and that increased dispersal is unlikely to be caused by vector control spraying.

  12. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas.

  13. Depletive stripping chronopotentiometry : a major step forward in electrochemical stripping techniques for metal ion speciation analysis

    NARCIS (Netherlands)

    Town, R.M.; Leeuwen, van H.P.

    2004-01-01

    A comparative evaluation of the utility of the various modes of stripping chronopotentiometry (SCP) for trace metal speciation analysis is presented in the broad context of stripping voltammetric techniques. The remarkable fundamental advantages of depletive SCP at scanned deposition potential (SSCP

  14. Effect of Load Distribution on Strip Crown in Hot Strip Rolling

    Institute of Scientific and Technical Information of China (English)

    Hongshuang DI; Jianzhong XU; Dianyao GONG; Xianghua LIU; Guodong WANG; Xiaoming HE; Liying BA

    2004-01-01

    In order to establish precision model, a software to calculate the strip crown of four-high hot rolling mill was developed by using affecting function method according to the strip crown calculation theory. The effect of work roll diameter, unit width rolling load, roll bending force, work roll crown, initial strip crown and reduction, etc, on load distribution effect rate was simulated by using the software. The results show that the load distribution effect rate increases with the increase of strip width, work roll diameter, unit width rolling load, roll bending force, work roll crown, initial strip crown and reduction. Based on the simulation results, base value of load distribution effect rate and fitting coefficients of six power polynomial of load distribution effect rate modification coefficient were determined considering all of the above parameters. A simplified mathematical model for calculating load distribution effect rate was established.

  15. Anodic stripping voltammetry of silver nanoparticles: aggregation leads to incomplete stripping.

    Science.gov (United States)

    Cloake, Samantha J; Toh, Her Shuang; Lee, Patricia T; Salter, Chris; Johnston, Colin; Compton, Richard G

    2015-02-01

    The influence of nanoparticle aggregation on anodic stripping voltammetry is reported. Dopamine-capped silver nanoparticles were chosen as a model system, and melamine was used to induce aggregation in the nanoparticles. Through the anodic stripping of the silver nanoparticles that were aggregated to different extents, it was found that the peak area of the oxidative signal corresponding to the stripping of silver to silver(I) ions decreases with increasing aggregation. Aggregation causes incomplete stripping of the silver nanoparticles. Two possible mechanisms of 'partial oxidation' and 'inactivation' of the nanoparticles are proposed to account for this finding. Aggregation effects must be considered when anodic stripping voltammetry is used for nanoparticle detection and quantification. Hence, drop casting, which is known to lead to aggregation, is not encouraged for preparing electrodes for analytical purposes.

  16. Development of floating strip micromegas detectors

    Energy Technology Data Exchange (ETDEWEB)

    Bortfeldt, Jonathan

    2014-04-28

    Micromegas are high-rate capable, high-resolution micro-pattern gaseous detectors. Square meter sized resistive strip Micromegas are foreseen as replacement of the currently used precision tracking detectors in the Small Wheel, which is part of the forward region of the ATLAS muon spectrometer. The replacement is necessary to ensure tracking and triggering performance of the muon spectrometer after the luminosity increase of the Large Hadron Collider beyond its design value of 10{sup 34} cm{sup -2}s{sup -1} around 2020. In this thesis a novel discharge tolerant floating strip Micromegas detector is presented and described. By individually powering copper anode strips, the effects of a discharge are confined to a small region of the detector. This reduces the impact of discharges on the efficiency by three orders of magnitude, compared to a standard Micromegas. The physics of the detector is studied and discussed in detail. Several detectors are developed: A 6.4 x 6.4 cm{sup 2} floating strip Micromegas with exchangeable SMD capacitors and resistors allows for an optimization of the floating strip principle. The discharge behavior is investigated on this device in depth. The microscopic structure of discharges is quantitatively explained by a detailed detector simulation. A 48 x 50 cm{sup 2} floating strip Micromegas is studied in high energy pion beams. Its homogeneity with respect to pulse height, efficiency and spatial resolution is investigated. The good performance in high-rate background environments is demonstrated in cosmic muon tracking measurements with a 6.4 x 6.4 cm{sup 2} floating strip Micromegas under lateral irradiation with 550 kHz 20 MeV proton beams. A floating strip Micromegas doublet with low material budget is developed for ion tracking without limitations from multiple scattering in imaging applications during medical ion therapy. Highly efficient tracking of 20 MeV protons at particle rates of 550 kHz is possible. The reconstruction of the

  17. Area specific stripping factors for AGS. A method for extracting stripping factors from survey data

    Energy Technology Data Exchange (ETDEWEB)

    Aage, H.K.; Korsbech, U. [Technical Univ. of Denmark (Denmark)

    2006-04-15

    In order to use Airborne Gamma-ray Spectrometry (AGS) for contamination mapping, for source search etc. one must to be able to eliminate the contribution to the spectra from natural radioactivity. This in general is done by a stripping technique. The parameters for performing a stripping have until recently been measured by recording gamma spectra at special calibration sites (pads). This may be cumbersome and the parameters may not be correct when used at low gamma energies for environmental spectra. During 2000-2001 DTU tested with success a new technique for Carborne Gamma-ray Spectrometry (CGS) where the spectra from the surveyed area (or from a similar area) were used for calculating the stripping parameters. It was possible to calculate usable stripping ratios for a number of low energy windows - and weak source signals not detectable by other means were discovered with the ASS technique. In this report it is shown that the ASS technique also works for AGS data, and it has been used for recent Danish AGS tests with point sources. (Check of calibration of AGS parameters.) By using the ASS technique with the Boden data (Barents Rescue) an exercise source was detected that has not been detected by any of the teams during the exercise. The ASS technique therefore seems to be better for search for radiation anomalies than any other method known presently. The experiences also tell that although the stripping can be performed correctly at any altitude there is a variation of the stripping parameters with altitude that has not yet been quite understood. However, even with the oddly variations the stripping worked as expected. It was also observed that one might calculate a single common set of usable stripping factors for all altitudes from the entire data set i.e. some average a, b and c values. When those stripping factors were used the stripping technique still worked well. (au)

  18. Modeling of continuous strip production by rheocasting

    Science.gov (United States)

    Matsumiya, T.; Flemings, M. C.

    1981-03-01

    A process was experimentally and mathematically modeled for continuous and direct production of metal strip from its molten state by the use of Rheocasting. The process comprises 1) continuous production of a Rheocast semisolid alloy, and 2) direct shaping of the semisolid into strip. Sn-15 pct Pb was used as the modeling alloy. Crack formation and surface quality of the strip produced depend on fraction solid and deformation force. Continuous, sound strip could be obtained with good surface quality when fraction solid was between 0.50 and 0.70 and deformation force did not exceed a given maximum. Sheet thickness depends on deformation force, fraction solid, rotor rate of Rheocaster and production line speed. At constant deformation force, sheet thickness increases as fraction solid increases, rotor rate decreases and line speed is reduced. Sheet thickness is larger in the center than in the edge, but the difference is reduced by applying edgers. Some segregation of lead toward the edges is observed, and the segregation increases as amount of deformation is increased. A mathematical model for heat flow, solidification and deformation was constructed. The model predicts the point of completion of solidification in the strip and sheet thickness as a function of deformation force and line speed. Calculations are in good agreement with experimental results.

  19. Modeling of continuous strip production by rheocasting

    Energy Technology Data Exchange (ETDEWEB)

    Matsumiya, T.; Flemings, M.C.

    1981-03-01

    A process was experimentally and mathematically modeled for continuous and direct production of metal strip from its molten state by the use of Rheocasting. The process comprises 1) continuous production of a Rheocast semisolid alloy, and 2) direct shaping of the semisolid into strip. Sn-15 pct Pb was used as the modeling alloy. Crack formation and surface quality of the strip produced depend on fraction solid and deformation force. Continuous, sound strip could be obtained with good surface quality when fraction solid was between 0.50 and 0.70 and deformation force did not exceed a given maximum. Sheet thickness depends on deformation force, fraction solid, rotor rate of Rheocaster and production line speed. At constant deformation force, sheet thickness increases as fraction solid increases, rotor rate decreases and line speed is reduced. Sheet thickness is larger in the center than in the edge, but the difference is reduced by applying edgers. Some segregation of lead toward the edges is observed, ad the segregation increases as amount of deformation is increased. A mathematical model for heat flow, solidification and deformation was constructed. The model predicts the point of completion of solidification in the strip and sheet thickness as a function of deformation force and line speed. Calculations are in good agreement with experimental results.

  20. Beam stripping extraction from the VINCY cyclotron

    Directory of Open Access Journals (Sweden)

    Ristić-Đurović Jasna L.

    2006-01-01

    Full Text Available The extraction system of a cyclotron guides an ion beam from a spiral acceleration orbit, through an extraction trajectory, into a high energy transport line. The two methods commonly used to direct an ion into the extraction path are deflection, by the electric field of an electrostatic deflector, and ion stripping, by a thin carbon foil. Compared to the electrostatic deflector system, the stripping extraction provides a fast and easy change of the extracted ion energy and is easier to manufacture operate, and maintain. However, the extraction trajectory and dynamics of an ion beam after stripping are highly dependant on the ion energy and specific charge. Thus, when a multipurpose machine such as the VINCY Cyclotron is concerned, it is far from easy to deliver a variety of ion beams into the same high energy transport line and at the same time preserve a reasonable compactness of the extraction system. The front side stripping extraction system of the VINCY Cyclotron provides high (~70 MeV and mid (~30 MeV energy protons, as well as a number of heavy ions in broad energy ranges. The back side stripping extraction system extracts low energy protons (~18 MeV and enables their simultaneous use with high energy protons at the front side of the machine.

  1. Effect of Initial Crown on Shape of Hot Rolled Strip

    Institute of Scientific and Technical Information of China (English)

    HU Yu; GONG Dian-yao; JIANG Zheng-yi; XU Jian-zhong; ZHANG Dian-hua; LIU Xiang-hua

    2009-01-01

    Based on the influence coefficient method, the effect of entry strip crown on the shape of hot rolled strip was analyzed using the software of roll elastic deformation simulation. According to the practical condition of a domestic hot roiled strip plant, the unit strip crown change from the first stand to the last stand was calculated when the entry crown of hot strip varies. The calculated result shows that the entry strip crown does not significantly affect the target strip crown at the exit of the last finishing stand in respect to a fixed strip shape control reference (such as bending force). The calculation was analyzed, and the research is helpful in modeling strip shape setup and shape control.

  2. Ram pressure stripping of tilted galaxies

    CERN Document Server

    Jachym, P; Palous, J; Combes, F

    2009-01-01

    Ram pressure stripping of galaxies in clusters can yield gas deficient disks. Previous numerical simulations based on various approaches suggested that, except for near edge-on disk orientations, the amount of stripping depends very little on the inclination angle. Following our previous study of face-on stripping, we extend the set of parameters with the disk tilt angle and explore in detail the effects of the ram pressure on the interstellar content (ISM) of tilted galaxies that orbit in various environments of clusters, with compact or extended distributions of the intra-cluster medium (ICM). We further study how results of numerical simulations could be estimated analytically. A grid of numerical simulations with varying parameters is produced using the tree/SPH code GADGET with a modified method for calculating the ISM-ICM interaction. These SPH calculations extend the set of existing results obtained from different codes using various numerical techniques. The simulations confirm the general trend of le...

  3. Asset Stripping in a Mature Market Economy

    DEFF Research Database (Denmark)

    Klarskov Jeppesen, Kim; Møller, Ulrik Gorm

    2011-01-01

    indicates that asset stripping may take place in mature market economies to the extent that perpetrators are able to circumvent the corporate governance system by giving lawyers, public accountants and banks incentives to act less critically towards dubious business transactions. Research limitations......Purpose – The purpose of this paper is to document a Danish fraud scheme, in which a large number of limited companies were stripped of their assets leaving them with nothing but tax debt, eventually causing the Danish Tax and Customs Administration to lose large sums. Furthermore, the purpose...... is to analyse why the asset-stripping schemes occurred in a mature market economy with a strong corporate governance system and a low level of corruption. Design/methodology/approach – The research is conducted as a longitudinal single case study based on documentary research. Findings – The Danish case...

  4. Rapid diagnosis of meningitis using reagent strips

    Directory of Open Access Journals (Sweden)

    Parmar Ramesh

    2004-02-01

    Full Text Available OBJECTIVES: Identification of causative agent with estimation of cerebrospinal fluid (CSF glucose, protein, cells is necessary for accurate diagnosis of meningitis. Unfortunately, even these facilities are not available in many areas. Reagent strips that measure glucose and protein in blood and urine can serve this task but have been used with varying results in the past. This study was carried out to evaluate the utility and efficacy of Combur 10 strips in the diagnosis of meningitis. DESIGN, SETTINGS AND METHODS: A prospective clinical single blinded study of 63 children suspected to have meningitis undergoing CSF analysis. Each CSF sample was divided in to two and was utilised for reagent strip analysis in addition to standard laboratory evaluation and a correlation analysis were made. Statistical Method used: Results were analysed using standard statistical tests. Accuracy of the reagent strips as a screening tool was established using Godyn′s test. RESULTS: The sensitivity, specificity of the reagent strips for the diagnosis of meningitis was 97.14%, 96.42%. The sensitivity, specificity for tuberculous meningitis and bacterial meningitis were 100%, and 96.55%. That for the aseptic meningitis was 70% and 96.55%. Accuracy for the diagnosis of meningitis as a whole, bacterial meningitis, tuberculous meningitis, and aseptic meningitis were 96.78%, 98.2%, 98.27% and 83.0% respectively. CONCLUSION: Combur10 strips thus can be used for the rapid CSF analysis and screening with good accuracy. In situations where facilities of routine laboratory testing are not available this can be of an immense help.

  5. Lubrication in strip cold rolling process

    Institute of Scientific and Technical Information of China (English)

    Jianlin Sun; Yonglin Kang; Tianguo Xiao; Jianze Wang

    2004-01-01

    A lubrication model was developed for explaining how to form an oil film in the deformation zone, predicting the film thickness and determining the characteristics of lubrication in the strip rolling process, combined with the knowledge of hydrodythicknesses in the strip cold rolling. Results from the experiment and calculation show that the oil film forming in hydrodynamic lubrication is up to the bit angle and a higher rolling speed or a higher rolling oil viscosity. The mechanism of mechanical entrainment always affects the film thickness that increases with the rolling oil viscosity increasing or the reduction rate decreasing in rolling.

  6. Potential profile in a conducting polymer strip

    DEFF Research Database (Denmark)

    Bay, Lasse; West, Keld; Vlachopoulos, Nikolaos

    2002-01-01

    and complicate measurements on free-standing films. A model of the potential profile in a free-standing strip is derived. It is found that the active length (the length with a given potential change) of the polymer will scale as square root (d sigma /i/sub d/). (d is the thickness, sigma the conductivity...... of the film, and i/sub d/ the diffusion limited current density for oxygen reduction). The active length is typically of the order of millimeters. The model is compared with measurements on a strip of polypyrrole doped with dodecylbenzene sulfonate...

  7. Validation of the Hot Strip Mill Model

    Energy Technology Data Exchange (ETDEWEB)

    Richard Shulkosky; David Rosberg; Jerrud Chapman

    2005-03-30

    The Hot Strip Mill Model (HSMM) is an off-line, PC based software originally developed by the University of British Columbia (UBC) and the National Institute of Standards and Technology (NIST) under the AISI/DOE Advanced Process Control Program. The HSMM was developed to predict the temperatures, deformations, microstructure evolution and mechanical properties of steel strip or plate rolled in a hot mill. INTEG process group inc. undertook the current task of enhancing and validating the technology. With the support of 5 North American steel producers, INTEG process group tested and validated the model using actual operating data from the steel plants and enhanced the model to improve prediction results.

  8. Multi-twist optical Mobius strips

    CERN Document Server

    Freund, Isaac

    2009-01-01

    Circularly polarized Gauss-Laguerre GL(0,0) and GL(0,1) laser beams that cross at their waists at a small angle are shown to generate a quasi-paraxial field that contains an axial line of circular polarization, a C line, surrounded by polarization ellipses whose major and minor axes generate multi-twist Mobius strips with twist numbers that increase with distance from the C point. These Mobius strips are interpreted in terms of Berry's phase for parallel transport of the ellipse axes around the C point.

  9. slice of LEP beamtube with getter strip

    CERN Multimedia

    1989-01-01

    A section of the LEP beam pipe. This is the chamber in which LEP's counter-rotating electron and positron beams travel. It is made of lead-clad aluminium. The beams circulate in the oval cross-section part of the chamber. In the rectangular cross-section part, LEP's innovative getter-strip vacuum pump is installed. After heating to purify the surface of the getter, the strip acts like molecular sticky tape, trapping any stray molecules left behind after the accelerator's traditional vacuum pumps have done their job.

  10. Wokker. Notes on a Surrealist comic strip

    Directory of Open Access Journals (Sweden)

    Roger Sabin

    2012-05-01

    Full Text Available This essay explores the creation and development of a British comic strip, Wokker (1971-1999, and its connections with the surrealist movement. Although the strip is remarkable for its content and formalist properties, it remains obscure both because of its publishing circumstances, and because it does not fit easily into a history of comics. Rather it can be argued that its conceptual roots can be traced to the artistic ferment that happened in Paris in the 1920s (with Breton as a key reference point, and that it represents a very English, and late-flowering, example of the surrealist idea.

  11. Stage- vs. Channel-strip Metaphor

    DEFF Research Database (Denmark)

    Gelineck, Steven; Korsgaard, Dannie Michael; Büchert, Morten

    2015-01-01

    This study compares the stage metaphor and the channel strip metaphor in terms of performance. Traditionally, music mixing consoles employ a channels strip control metaphor for adjusting parameters such as volume and panning of each track. An alternative control metaphor, the so-called stage...... metaphor lets the user adjust volume and panning by positioning tracks relative to a virtual listening position. In this study test participants are given the task to adjust volume and panning of one channel (in mixes consisting of three channels) in order to replicate a series of simple pre-rendered mixes...

  12. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  13. Resmethrin, the first modern pyrethroid insecticide.

    Science.gov (United States)

    Soderlund, David M

    2015-06-01

    The discovery of resmethrin almost five decades ago was the seminal event in the development of pyrethroid insecticides as important pest management tools, the value of which endures to this day. This brief review considers the development of pyrethroids from the perspective of the discovery of resmethrin. I describe the pathway to the discovery of resmethrin and the unique properties that differentiated it from the pyrethrins and earlier synthetic pyrethroids is described. I also summarize information on metabolic fate and mechanisms of selective toxicity, first elucidated with resmethrin, that have shaped our understanding of pyrethroid toxicology since that time. Finally, I review the discovery pathway that led from resmethrin to the development of the first photostable, agriculturally useful pyrethroids that established the importance of this insecticide class.

  14. Neem (Azadirachta indica): towards the ideal insecticide?

    Science.gov (United States)

    Benelli, Giovanni; Canale, Angelo; Toniolo, Chiara; Higuchi, Akon; Murugan, Kadarkarai; Pavela, Roman; Nicoletti, Marcello

    2017-02-01

    Pesticide resistance is going to change rapidly our antibiotics and insecticides arsenal. In this scenario, plant-derived natural products are considered valuable candidates to reverse this negative trend. Growing research attention is focused on neem (Azadirachta indica, Meliaceae), exploring the utility of its products as insecticides and antibiotics. In this review, we summarised the knowledge on neem oil and neem cake by-products in arthropod pest control, with special reference to mosquito vectors of public health importance. To the best of our knowledge, neem-borne products currently showed effective and eco-friendly features, including little non-target effects, multiple mechanisms of action, low cost, easy production in countries with limited industrial facilities. In particular, the potentiality of neem cake as ideal and affordable source of mosquitocidal compounds in anopheline and aedine control programmes is outlined. Overall, we propose the employ of neem-based products as an advantageous alternative to build newer and safer arthropod control tools.

  15. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  16. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    OpenAIRE

    E. V. Matseliukh; N. A. Nidialkova; V. V. Krout'; L. D. Varbanets; A. V. Kalinichenko; V. F. Patyka

    2015-01-01

    The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kh...

  17. Insecticide control in a Dengue epidemics model

    CERN Document Server

    Rodrigues, Helena Sofia; Torres, Delfim F M

    2010-01-01

    A model for the transmission of dengue disease is presented. It consists of eight mutually-exclusive compartments representing the human and vector dynamics. It also includes a control parameter (insecticide) in order to fight the mosquitoes. The main goal of this work is to investigate the best way to apply the control in order to effectively reduce the number of infected humans and mosquitoes. A case study, using data of the outbreak that occurred in 2009 in Cape Verde, is presented.

  18. Effects of Different Surfaces and Insecticide Carriers on Residual Insecticide Bioassays Against Bed Bugs, Cimex spp. (Hemiptera: Cimicidae).

    Science.gov (United States)

    Dang, Kai; Singham, G Veera; Doggett, Stephen L; Lilly, David G; Lee, Chow-Yang

    2017-04-01

    The performance of five insecticides (bendiocarb, deltamethrin, DDT, malathion, and imidacloprid) using three application methods (oil-based insecticide films on filter paper, and acetone-based insecticide deposits on two substrates: filter paper and glass) was assessed against a susceptible strain of Cimex lectularius (L.) and two resistant strains of Cimex hemipterus (F.). Substrate type significantly affected (P < 0.05) the insecticide knockdown response of the susceptible strain in acetone-based insecticide bioassays, with longer survival time on filter paper than on the glass surface. With the exception of deltamethrin, the different diluents (oil and acetone) also significantly affected (P < 0.05) the insecticide knockdown response of the susceptible strain in the filter paper-based insecticide bioassays, with longer survival time with acetone as the diluent. For both strains of C. hemipterus, there were no significant effects with the different surfaces and diluents for all insecticides except for malathion and imidacloprid, which was largely due to high levels of resistance. The lower effectiveness for the insecticide acetone-based treatment on filter paper may be due to crystal bloom. This occurs when an insecticide, dissolved in a volatile solvent, is applied onto absorptive surfaces. The effect is reduced on nonabsorptive surfaces and slowed down with oil-based insecticides, whereby the oil forms a film on absorptive surfaces. These findings suggest that nonabsorptive surfaces should be used in bioassays to monitor insecticide resistance. If absorptive surfaces are used in bioassays for testing active ingredients, then oil-based insecticides should be preferably used. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Insecticide resistance in Bemisia tabaci from Cyprus

    Institute of Scientific and Technical Information of China (English)

    Vassilis Vassiliou; Maria Emmanouilidou; Andreas Perrakis; Evangelia Morou; John Vontas; Anastasia Tsagkarakou; Emmanouil Roditakis

    2011-01-01

    A comprehensive study on the Bemisia tabaci(biotype B)resistance to neonicotinoid insecticides imidacloprid,acetamiprid and thiamethoxam,and pyrethroid bifenthrin was conducted in Cyprus.The resistance level to eight field-collected B.tabaci populations was investigated.The activities of enzymes involved in metabolic detoxification and the frequencies of pyrethroid and organophosphates target site resistance mutations were determined.Moderate to high levels of resistance were detected for imidacloprid(resistance factor[RF]77-392)and thiamethoxam(RF 50-164)while low resistance levels were observed for acetamiprid(RF 7-12).Uniform responses by the Cypriot whiteflies could be observed against all neonicotinoid insecticides.No cross-resistance between the neonicotinoids was detected as well as no association with the activity of the P450 microsomal oxidases.Only imidacloprid resistance correlated with carboxylesterase activity.Low to extremely high resistance was observed for insecticide bifenthrin(RF 49-1 243)which was associated with the frequency of the resistant allele in the sodium channel gene but not with the activity of the detoxification enzymes.Finally,the F331W mutation in the acetylcholinesterase enzyme ace1 gene was fixed in all B.tabaci populations from Cyprus.

  20. Insecticide Resistance and Management Strategies in Urban Ecosystems

    Directory of Open Access Journals (Sweden)

    Fang Zhu

    2016-01-01

    Full Text Available The increased urbanization of a growing global population makes imperative the development of sustainable integrated pest management (IPM strategies for urban pest control. This emphasizes pests that are closely associated with the health and wellbeing of humans and domesticated animals. Concurrently there are regulatory requirements enforced to minimize inadvertent exposures to insecticides in the urban environment. Development of insecticide resistance management (IRM strategies in urban ecosystems involves understanding the status and mechanisms of insecticide resistance and reducing insecticide selection pressure by combining multiple chemical and non-chemical approaches. In this review, we will focus on the commonly used insecticides and molecular and physiological mechanisms underlying insecticide resistance in six major urban insect pests: house fly, German cockroach, mosquitoes, red flour beetle, bed bugs and head louse. We will also discuss several strategies that may prove promising for future urban IPM programs.

  1. Comparative evaluation of scanned stripping techniques: SSCP vs. SSV

    NARCIS (Netherlands)

    Town, R.M.; Leeuwen, van H.P.

    2006-01-01

    The characteristic features of scanned deposition potential curves constructed from stripping chronopotentiometry (SSCP) and various modes of stripping voltammetry (SSV) are critically evaluated. The strengths and weaknesses of each method for identification of metal ion speciation features and susc

  2. Topics in Chemical Instrumentation: CII. Automated Anodic Stripping Voltammetry.

    Science.gov (United States)

    Stock, John T.; Ewing, Galen W., Ed.

    1980-01-01

    Presents details of anodic stripping analysis (ASV) in college chemistry laboratory experiments. Provides block diagrams of the analyzer system, circuitry and power supplies of the automated stripping analyzer, and instructions for implementing microcomputer control of the ASV. (CS)

  3. Propulsion by Helical Strips in Circular Channels

    Science.gov (United States)

    Yesilyurt, Serhat; Demir, Ebru

    2016-11-01

    Progress in manufacturing techniques avails the production of artificial micro swimmers (AMS) in various shapes and sizes. There are numerous studies on the generation of efficient locomotion by means of helical tails with circular cross-sections. This work focuses on locomotion with helical strips in circular channels. A CFD model is used to analyze the effects of geometric parameters and the radius of the channel on swimming velocity of infinite helical-strips in circular channels. Results show that there is an optimum wavelength that depends on thickness to channel radius ratio, suggesting that these parameters need to be optimized simultaneously. With constant torque, thinner strips swim faster, whereas under constant angular velocity application, thicker strips (in radial direction) prevail. As width approaches the wavelength, velocity decreases under both conditions, unless a magnetically coated tail is simulated, for which width has an optimum value. Increasing channel radius to helix amplitude ratio increases the velocity up to a maximum and after a slight drop, saturation occurs as bulk swimming conditions are approached.

  4. Nanoscale Test Strips for Multiplexed Blood Analysis

    Science.gov (United States)

    Chan, Eugene

    2015-01-01

    A critical component of the DNA Medicine Institute's Reusable Handheld Electrolyte and Lab Technology for Humans (rHEALTH) sensor are nanoscale test strips, or nanostrips, that enable multiplexed blood analysis. Nanostrips are conceptually similar to the standard urinalysis test strip, but the strips are shrunk down a billionfold to the microscale. Each nanostrip can have several sensor pads that fluoresce in response to different targets in a sample. The strips carry identification tags that permit differentiation of a specific panel from hundreds of other nanostrip panels during a single measurement session. In Phase I of the project, the company fabricated, tested, and demonstrated functional parathyroid hormone and vitamin D nanostrips for bone metabolism, and thrombin aptamer and immunoglobulin G antibody nanostrips. In Phase II, numerous nanostrips were developed to address key space flight-based medical needs: assessment of bone metabolism, immune response, cardiac status, liver metabolism, and lipid profiles. This unique approach holds genuine promise for space-based portable biodiagnostics and for point-of-care (POC) health monitoring and diagnostics here on Earth.

  5. Comic Strips to Accompany Science Museum Exhibits

    Science.gov (United States)

    Chung, Beom Sun; Park, Eun-mi; Kim, Sang-Hee; Cho, Sook-kyoung; Chung, Min Suk

    2016-01-01

    Science museums make the effort to create exhibits with amusing explanations. However, existing explanation signs with lengthy text are not appealing, and as such, visitors do not pay attention to them. In contrast, conspicuous comic strips composed of simple drawings and humors can attract science museum visitors. This study attempted to reveal…

  6. Improved Lower Bound for Online Strip Packing

    NARCIS (Netherlands)

    Harren, Rolf; Kern, Walter

    We study the online strip packing problem and derive an improved lower bound of Ͽ ≥ 2.589... for the competitive ratio of this problem. The construction is based on modified “Brown-Baker-Katseff sequences‿ (Brown et al. in Acta Inform. 18:207–225, 1982) using only two types of rectangles. In

  7. Polymer Inclusion Membranes with Strip Dispersion

    Directory of Open Access Journals (Sweden)

    Yueh-Hsien Li

    2017-06-01

    Full Text Available The present work investigated the permeation of indium ions through a polymer inclusion membrane (PIM, prepared with cellulose triacetate (CTA as the base polymer, tris(2-butoxyethyl phosphate (TBEP as the plasticizer and di-(2-ethylhexylphosphoric acid (D2EHPA as the extractant. With 5 M HCl aqueous solution as the strip solution, we observed an initial indium permeability of 2.4 × 10−4 m/min. However, the permeability decreases with time, dropping to about 3.4 × 10−5 m/min after 200 min of operation. Evidence was obtained showing that hydrolysis of CTA occurred, causing a dramatic decrease in the feed pH (protons transported from strip to feed solutions and a loss of extractant and plasticizer from the membrane, and then leading to the loss of indium permeability. To alleviate the problem of hydrolysis, we proposed an operation scheme called polymer inclusion membranes with strip dispersion: dispersing the strip solution in extractant-containing oil and then bringing the dispersion to contact with the polymer membrane. Since the strong acid was dispersed in oil, the membrane did not directly contact the strong acid at all times, and membrane hydrolysis was thus alleviated and the loss of indium permeability was effectively prevented. With the proposed scheme, a stable indium permeability of 2.5 × 10−4 m/min was obtained during the whole time period of the permeation experiment.

  8. Inadvertent femoral artery "stripping": surgical management.

    Science.gov (United States)

    Liddicoat, J E; Bekassy, S M; Daniell, M B; De Bakey, M E

    1975-02-01

    Following "vein stripping" for varicosities, two patients were referred to our service for evaluation of arterial insufficiency of the lower extremities. Both patients had had surgical interruption of the femoral arterial system which required reconstruction. This paper emphasizes the importance of understanding surgical anatomy and presents the techniques of successful surgical management of both cases.

  9. ME1/1 Cathode Strip Chambers

    CERN Document Server

    Erchov, Yu V; Kamenev, Alexey; Karjavin, Vladimir; Khabarov, Serguei; Moissenz, P V; Moissenz, K P; Movchan, Sergey; Perelygin, Victor; Vassiliev, S E; Zarubin, Anatoli; Tchekhovski, V A

    2008-01-01

    The 76 innermost ME1/1 cathode strip chambers (CSC) of the CMS Experiment were designed and produced in Dubna. The chambers have been installed in the detector and commissioning has been completed. This paper describes the design of the CSCs, their main mechanical parameters and read-out electronics, and the results of tests with cosmic-ray muons.

  10. Cardiac Muscle Studies with Rat Ventricular Strips

    Science.gov (United States)

    Whitten, Bert K.; Faleschini, Richard J.

    1977-01-01

    Details undergraduate physiology laboratory experiments that demonstrate mechanical properties of cardiac muscle, using strips from the ventricle of a rat heart. Includes procedures for obtaining length-tension curves, demonstrating the role of calcium in excitation-contraction coupling, and showing effects of several cardiovascular drugs…

  11. Anodic Stripping Voltammetry: An Instrumental Analysis Experiment.

    Science.gov (United States)

    Wang, Joseph

    1983-01-01

    Describes an experiment designed to acquaint students with the theory and applications of anodic stripping voltammetry (ASV) as well as such ASV problems as contamination associated with trace analysis. The experimental procedure, instrumentation, and materials discussed are designed to minimize cost and keep procedures as simple as possible. (JM)

  12. Hardness of approximation for strip packing

    DEFF Research Database (Denmark)

    Adamaszek, Anna Maria; Kociumaka, Tomasz; Pilipczuk, Marcin

    2017-01-01

    [SODA 2016] have recently proposed a (1.4 + ϵ)-approximation algorithm for this variant, thus showing that strip packing with polynomially bounded data can be approximated better than when exponentially large values are allowed in the input. Their result has subsequently been improved to a (4/3 + ϵ...

  13. Refuges, flower strips, biodiversity and agronomic interest.

    Science.gov (United States)

    Roy, Grégory; Wateau, Karine; Legrand, Mickaël; Oste, Sandrine

    2008-01-01

    Several arthropods are natural predators of pests, and they are able to reduce and control their population development. FREDON Nord Pas-de-Calais (Federation Regionate de Defense contre les Organismes Nuisibles = Regional Federation for Pest Control) has begun for a long time to form farmers to the recognition of beneficial arthropods and to show them their usefulness. These beneficial insects or arachnids are present everywhere, in orchards and even in fields which are areas relatively poor in biodiversity. Adults feed in the flower strips instead larvae and some adults feed on preys such as aphids or caterpillars. Most of the time, beneficial insects can regulate pest but sometimes, in agricultural area, they can't make it early enough and efficiently. Their action begin too late and there biodiversity and number are too low. It's possible to enhance their action by manipulating the ecological infrastructures, like sewing flower strips or installing refuges. Flower strips increase the density of natural enemies and make them be present earlier in the field in order to control pests. Refuges permit beneficial's to spend winter on the spot. So they're able to be active and to grow in number earlier. From 2004 to 2007, on the one hand, FREDON Nord Pas-de-Calais has developed a research program. Its purpose was to inventory practices and also tools and means available and to judge the advisability of using such or such beneficial refuge in orchards. On the second hand, it studied the impact in orchard of refuges on population of beneficial's and the difference there were between manufactured refuges and homemade refuges. Interesting prospects were obtained with some of them. Otherwise, since 2003, FREDON has studied flower strips influence on beneficial population and their impact on pest control. In cabbage fields, results of trials have shown that flower strips lead to a reduction of aphid number under acceptable economic level, up to 50 meters from flower strips

  14. Republican Utopia:from Plato to Moore%共和主义乌托邦:从柏拉图到莫尔

    Institute of Scientific and Technical Information of China (English)

    徐百军

    2012-01-01

    通过对柏拉图的《理想国》和莫尔的《乌托邦》的文本分析,我们发现他们的乌托邦思想中潜藏着共和主义叙事,实质上柏拉图和莫尔都希图建构一种共和主义乌托邦,由此也可以说乌托邦思想与共和主义之间原本就存在着一种共生的却被遗忘的历史关系,因而我们试图恢复以柏拉图和莫尔为代表的乌托邦思想家在共和主义政治光谱中的理论地位也并非一种主观冲动。%Through making a text analysis of Plato's Republic and Moore's Utopia,we find that a republican narrative has been hidden in their Utopian thought.Essencially,Plato and Moore both hoped to construct a republican utopia.It also can be said that there is a symbiotic and forgotten historical relation between the utopian thought and republicanism.So it is not a subjective impulse that we try to give the theoretical status in the republican political spectrum back to the utopian thinkers whose representatives are Plato and Moore.

  15. Multiple insecticide resistance: an impediment to insecticide-based malaria vector control program.

    Directory of Open Access Journals (Sweden)

    Delenasaw Yewhalaw

    Full Text Available BACKGROUND: Indoor Residual Spraying (IRS, insecticide-treated nets (ITNs and long-lasting insecticidal nets (LLINs are key components in malaria prevention and control strategy. However, the development of resistance by mosquitoes to insecticides recommended for IRS and/or ITNs/LLINs would affect insecticide-based malaria vector control. We assessed the susceptibility levels of Anopheles arabiensis to insecticides used in malaria control, characterized basic mechanisms underlying resistance, and evaluated the role of public health use of insecticides in resistance selection. METHODOLOGY/PRINCIPAL FINDINGS: Susceptibility status of An. arabiensis was assessed using WHO bioassay tests to DDT, permethrin, deltamethrin, malathion and propoxur in Ethiopia from August to September 2009. Mosquito specimens were screened for knockdown resistance (kdr and insensitive acetylcholinesterase (ace-1(R mutations using AS-PCR and PCR-RFLP, respectively. DDT residues level in soil from human dwellings and the surrounding environment were determined by Gas Chromatography with Electron Capture Detector. An. arabiensis was resistant to DDT, permethrin, deltamethrin and malathion, but susceptible to propoxur. The West African kdr allele was found in 280 specimens out of 284 with a frequency ranged from 95% to 100%. Ace-1(R mutation was not detected in all specimens scored for the allele. Moreover, DDT residues were found in soil samples from human dwellings but not in the surrounding environment. CONCLUSION: The observed multiple-resistance coupled with the occurrence of high kdr frequency in populations of An. arabiensis could profoundly affect the malaria vector control programme in Ethiopia. This needs an urgent call for implementing rational resistance management strategies and integrated vector control intervention.

  16. Dual Strip-Excited Dielectric Resonator Antenna with Parasitic Strips for Radiation Pattern Reconfigurability

    Directory of Open Access Journals (Sweden)

    M. Kamran Saleem

    2014-01-01

    Full Text Available A novel pattern reconfigurable antenna concept utilizing rectangular dielectric resonator antenna (DRA placed over dielectric substrate backed by a ground plane is presented. A dual strip excitation scheme is utilized and both excitation strips are connected together by means of a 50 Ω microstrip feed network placed over the substrate. The four vertical metallic parasitic strips are placed at corner of DRA each having a corresponding ground pad to provide a short/open circuit between the parasitic strip and antenna ground plane, through which a shift of 90° in antenna radiation pattern in elevation plane is achieved. A fractional bandwidth of approximately 40% at center frequency of 1.6 GHz is achieved. The DRA peak realized gain in whole frequency band of operation is found to be above 4 dB. The antenna configuration along with simulation and measured results are presented.

  17. Strip reduction testing of lubricants developed during ENFORM project

    DEFF Research Database (Denmark)

    Gazvoda, S.; Andreasen, Jan Lasson; Olsson, David Dam

    Strip reduction testing of lubricants developed during ENFORM project. Experiments were conducted with the strip reduction test [1] in order to classify experimental lubricants, developed during concerned project. One reference lubricant was used during testing.......Strip reduction testing of lubricants developed during ENFORM project. Experiments were conducted with the strip reduction test [1] in order to classify experimental lubricants, developed during concerned project. One reference lubricant was used during testing....

  18. The use of insecticides to control insect pests

    Directory of Open Access Journals (Sweden)

    M Wojciechowska

    2016-07-01

    Full Text Available Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resistance of insects to these insecticides. In order to prevent occurrence of negative effects of insecticides on surroundings, the effects of these compounds should be studied

  19. Comparative toxicity of insecticides to Choristoneura species (Lepidoptera: Tortricidae)

    Science.gov (United States)

    Jacqueline L. Robertson; Nancy L. Gillette; Barbara A. Lucas; Robert M. Russell; N.E. Savin

    1978-01-01

    Selected carbamate, chlorinated hydrocarbon, organophosphorous, and pyrethroid insecticides were tested on six Choristoneura species: conflictana (Walker), fumiferana (Clemens), lambertiana ponderosana Obraztsov, occidentalis Freeman, pinus Freeman, and...

  20. The great Lisbon earthquake and tsunami of 1755: lessons from the recent Sumatra earthquakes and possible link to Plato's Atlantis

    Science.gov (United States)

    Gutscher, M.-A.

    2006-05-01

    Great earthquakes and tsunami can have a tremendous societal impact. The Lisbon earthquake and tsunami of 1755 caused tens of thousands of deaths in Portugal, Spain and NW Morocco. Felt as far as Hamburg and the Azores islands, its magnitude is estimated to be 8.5 9. However, because of the complex tectonics in Southern Iberia, the fault that produced the earthquake has not yet been clearly identified. Recently acquired data from the Gulf of Cadiz area (tomography, seismic profiles, high-resolution bathymetry, sampled active mud volcanoes) provide strong evidence for an active east dipping subduction zone beneath Gibraltar. Eleven out of 12 of the strongest earthquakes (M>8.5) of the past 100 years occurred along subduction zone megathrusts (including the December 2004 and March 2005 Sumatra earthquakes). Thus, it appears likely that the 1755 earthquake and tsunami were generated in a similar fashion, along the shallow east-dipping subduction fault plane. This implies that the Cadiz subduction zone is locked (like the Cascadia and Nankai/Japan subduction zones), with great earthquakes occurring over long return periods. Indeed, the regional paleoseismic record (contained in deep-water turbidites and shallow lagoon deposits) suggests great earthquakes off South West Iberia every 1500 2000 years. Tsunami deposits indicate an earlier great earthquake struck SW Iberia around 200 BC, as noted by Roman records from Cadiz. A written record of even older events may also exist. According to Plato's dialogues The Critias and The Timaeus, Atlantis was destroyed by ‘strong earthquakes and floods … in a single day and night’ at a date given as 11,600 BP. A 1 m thick turbidite deposit, containing coarse grained sediments from underwater avalanches, has been dated at 12,000 BP and may correspond to the destructive earthquake and tsunami described by Plato. The effects on a paleo-island (Spartel) in the straits of Gibraltar would have been devastating, if inhabited, and may

  1. Podophyllotoxin-derived insecticidal agents: part XIII--evaluation of insecticidal activity of podophyllotoxin derivatives against Brontispa longissima.

    Science.gov (United States)

    Liu, Ying-Qian; Feng, Gang; Yang, Liu; Jing-Zhang; Li, Hong-Yu

    2011-09-01

    In an attempt to find the biorational insecticides for Brontispa longissima control, 12 podophyllotoxin (PPT) analogues were tested for their insecticidal activity against the fifth-instar larvae of B. longissima in vivo for the first time. Among all the tested compounds, especially compounds 6 and 8 showed more promising and pronounced insecticidal activity than toosendanin, a commercial insecticide derived from Melia azedarach. The different insecticidal activity range of compounds 1-12 indicated that the variation of chemical structures in the PPT skeleton markedly affected the activity profiles of this compound class, and some important structure-activity relationship information has been revealed. Together, these preliminary results may be useful in guiding further modification of PPTs in the development of potential new insecticides.

  2. TOMOGRAPHIC MEASUREMENT OF LONGITUDINAL EMITTANCE GROWTH DUE TO STRIPPING FOILS.

    Energy Technology Data Exchange (ETDEWEB)

    MONTAG, C.; AHRENS, L.; THIEBERGER, P.

    2005-05-16

    During beam acceleration in the Brookhaven accelerator complex, heavy ions are stripped of their electrons in several steps. Depending on the properties of the stripping foils, this process results in an increased energy spread and longitudinal emittance growth. A tomographic phase space reconstruction technique has been applied to measure the associated emittance growth for different stripping foil materials.

  3. Bird community response to filter strips in Maryland

    Science.gov (United States)

    Blank, P.J.; Dively, G.P.; Gill, D.E.; Rewa, C.A.

    2011-01-01

    Filter strips are strips of herbaceous vegetation planted along agricultural field margins adjacent to streams or wetlands and are designed to intercept sediment, nutrients, and agrichemicals. Roughly 16,000 ha of filter strips have been established in Maryland through the United States Department of Agriculture's Conservation Reserve Enhancement Program. Filter strips often represent the only uncultivated herbaceous areas on farmland in Maryland and therefore may be important habitat for early-successional bird species. Most filter strips in Maryland are planted to either native warm-season grasses or cool-season grasses and range in width from 10.7 m to 91.4 m. From 2004 to 2007 we studied the breeding and wintering bird communities in filter strips adjacent to wooded edges and non-buffered field edges and the effect that grass type and width of filter strips had on bird community composition. We used 5 bird community metrics (total bird density, species richness, scrub-shrub bird density, grassland bird density, and total avian conservation value), species-specific densities, nest densities, and nest survival estimates to assess the habitat value of filter strips for birds. Breeding and wintering bird community metrics were greater in filter strips than in non-buffered field edges but did not differ between cool-season and warm-season grass filter strips. Most breeding bird community metrics were negatively related to the percent cover of orchardgrass (Dactylis glomerata) in ???1 yr. Breeding bird density was greater in narrow (60 m) filter strips. Our results suggest that narrow filter strips adjacent to wooded edges can provide habitat for many bird species but that wide filter strips provide better habitat for grassland birds, particularly obligate grassland species. If bird conservation is an objective, avoid planting orchardgrass in filter strips and reduce or eliminate orchardgrass from filter strips through management practices. Copyright ?? 2011 The

  4. Improving Thin Strip Profile Using Work Roll Cross and Work Roll Shifting Methods in Cold Strip Rolling

    Directory of Open Access Journals (Sweden)

    Hasan Tibar

    2017-01-01

    Full Text Available The optimization of rolling parameters in order to achieve better strip shape and to reduce rolling force is a challenge in rolling practice. In this paper, thin strip asymmetrical rolling of aluminum at various speed ratios under lubricated condition has been investigated at various combinations of work rolls cross (WRC angles and work rolls shifting (WRS values. The effects of strip width, reduction, and rolling speed on strip shape taking WRC and WRS into consideration are discussed. Results show that strip profile improves significantly when the WRC angle is increased from 0° to 1°, with an associated reduction in rolling force. Increasing WRS value from 0 to 8 mm improves the strip profile as well but not as significantly as when WRC angle is increased. No significant improvement was found in strip shape when the strip width was increased. At higher reduction, the strip shape was improved; a decrease in the rolling force was also observed. A higher speed ratio was found to be effective only at a higher WRC angle. The effect of lubrication on the strip profile was significant. Results indicate that an optimum combination of WRC, WRS, reduction, width, and speed ratio under lubricated conditions can ensure an improved exit strip profile, reduce rolling force, and obtain a better quality strip.

  5. A dialogical exploration of the grey zone of health and illness: medical science, anthropology, and Plato on alcohol consumption.

    Science.gov (United States)

    Bonner, Kieran

    2009-01-01

    This paper takes a phenomenological hermeneutic orientation to explicate and explore the notion of the grey zone of health and illness and seeks to develop the concept through an examination of the case of alcohol consumption. The grey zone is an interpretive area referring to the irremediable zone of ambiguity that haunts even the most apparently resolute discourse. This idea points to an ontological indeterminacy, in the face of which decisions have to be made with regard to the health of a person (e.g., an alcoholic), a system (e.g., the health system), or a society. The fundamental character of this notion will be developed in relation to the discourse on health and the limitations of different disciplinary practices. The case of alcohol consumption will be used to tease out the grey zone embedded in the different kinds of knowledge made available through the disciplinary traditions of medical science, with its emphasis on somatic well-being, and anthropology, with its focus on communal well-being. This tension or grey zone embedded in different knowledge outcomes will be shown to have a discursive parallel with the dialogue between the Athenian, the Spartan, and the Cretan in Plato's Laws. Making use of the dialogical approach as described by Gadamer, the Athenian's particular resolution of the tension will be explored as a case study to demonstrate the necessarily particular analysis involved in a grey zone resolution.

  6. Shape Setup System for 1700 Hot Strip Mill

    Institute of Scientific and Technical Information of China (English)

    GUO Zhong-feng; XU Jian-zhong; LI Chang-sheng; LIU Xiang-hua

    2007-01-01

    Shape setup (SSU) system is the core technology for hot strip mill (HSM). A precise SSU system was used to improve the strip quality for HSM. The function of SSU, setup, and feedback was introduced. The main mathematical models of roll gap profile and longitudinal strain difference are set up. Strip profile allocation strategy was researched according to the SSU system of a domestic 1 700 mm HSM. The SSU system was put into practical use and the measurement results showed that strip flatness variation and strip profile variation could be controlled in target scope.

  7. The Formation and Evolution of Stripped Dark Matter Halos

    Science.gov (United States)

    Zhu, Jessica; Tuan, Austin Zong; Lee, Christoph; Primack, Joel R.

    2016-01-01

    We implement a model to describe the density profiles of stripped dark matter halos. Our model generalizes the Navarro-Frenk-White (NFW) distribution to allow for more flexibility in the slope of the outer halo. We find that the density distributions of stripped halos tend to have outer slopes steeper than assumed by the NFW distribution. We also examine the relationship between severity of stripping and halo shape, spin parameter and concentration, and find that highly stripped halos are more spheroidal, have lower spin parameters, and have higher concentrations compared to less stripped halos.

  8. Mesoionic insecticides: a novel class of insecticides that modulate nicotinic acetylcholine receptors.

    Science.gov (United States)

    Holyoke, Caleb W; Cordova, Daniel; Zhang, Wenming; Barry, James D; Leighty, Robert M; Dietrich, Robert F; Rauh, James J; Pahutski, Thomas F; Lahm, George P; Tong, My-Hanh Thi; Benner, Eric A; Andreassi, John L; Smith, Rejane M; Vincent, Daniel R; Christianson, Laurie A; Teixeira, Luis A; Singh, Vineet; Hughes, Kenneth A

    2017-04-01

    As the world population grows towards 9 billion by 2050, it is projected that food production will need to increase by 60%. A critical part of this growth includes the safe and effective use of insecticides to reduce the estimated 20-49% loss of global crop yields owing to pests. The development of new insecticides will help to sustain this protection and overcome insecticide resistance. A novel class of mesoionic compounds has been discovered, with exceptional insecticidal activity on a range of Hemiptera and Lepidoptera. These compounds bind to the orthosteric site of the nicotinic acetylcholine receptor and result in a highly potent inhibitory action at the receptor with minimal agonism. The synthesis, biological activity, optimization and mode of action will be discussed. Triflumezopyrim insect control will provide a powerful tool for control of hopper species in rice throughout Asia. Dicloromezotiaz can provide a useful control tool for lepidopteran pests, with an underexploited mode of action among these pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  9. The insecticide resistance in two planthoppers from three areas to three insecticides

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    @@ Migrating insects brown planthopper (BPH), Nilaparata lugens Stal and white-backed planthopper (WBPH), Sogatellafurcifera Horvath are both most harmful insects on rice in China. Chemical control is thought to be the best way to manage them, but it may cause insecticide resistance.

  10. Insecticide-Treated Nets and Protection against Insecticide-Resistant Malaria Vectors in Western Kenya.

    Science.gov (United States)

    Ochomo, Eric; Chahilu, Mercy; Cook, Jackie; Kinyari, Teresa; Bayoh, Nabie M; West, Philippa; Kamau, Luna; Osangale, Aggrey; Ombok, Maurice; Njagi, Kiambo; Mathenge, Evan; Muthami, Lawrence; Subramaniam, Krishanthi; Knox, Tessa; Mnavaza, Abraham; Donnelly, Martin James; Kleinschmidt, Immo; Mbogo, Charles

    2017-05-01

    Insecticide resistance might reduce the efficacy of malaria vector control. In 2013 and 2014, malaria vectors from 50 villages, of varying pyrethroid resistance, in western Kenya were assayed for resistance to deltamethrin. Long-lasting insecticide-treated nets (LLIN) were distributed to households at universal coverage. Children were recruited into 2 cohorts, cleared of malaria-causing parasites, and tested every 2 weeks for reinfection. Infection incidence rates for the 2 cohorts were 2.2 (95% CI 1.9-2.5) infections/person-year and 2.8 (95% CI 2.5-3.0) infections/person-year. LLIN users had lower infection rates than non-LLIN users in both low-resistance (rate ratio 0.61, 95% CI 0.42-0.88) and high-resistance (rate ratio 0.55, 95% CI 0.35-0.87) villages (p = 0.63). The association between insecticide resistance and infection incidence was not significant (p = 0.99). Although the incidence of infection was high among net users, LLINs provided significant protection (p = 0.01) against infection with malaria parasite regardless of vector insecticide resistance.

  11. What is good sport: Plato's view Co je to dobrý sport: Platónův pohled

    Directory of Open Access Journals (Sweden)

    Jernej Pisk

    2006-02-01

    Full Text Available One of Plato's most common questions found in his dialogues is "What is something?" By asking this question Plato usually brought his co-speakers to the recognition that in fact they do not have a full comprehension of what something is, although they have a partial comprehension of it. The awareness of one's incomplete cognition is the first step to be made on the philosophic way to truth. As in ancient times also today Plato asks us – the modern philosophers of sport – "What is sport?" or more precisely "What is good sport?" Probably the best of Plato's answers to this question can be found in the basic concepts of his philosophy regarding his hierarchical division of the state and human soul into three parts. Since sport is derived from human being also the goodness of sport can be divided into three stages. The lowest stage of sport corresponds to the first part of the soul – the appetite soul. On this stage sport is based on the gaining of material goods through prizes won at competitions. In the philosophic view, this is the lowest possible stage of goodness of sport. The second stage of sport corresponds to the second part of the soul – the emotional soul. Sport at this stage is based on the elementary ancient agon, which seeks fulfilment in the winning of honour and glory. The greatest and the most superior is the third part of the soul – the reasonable soul. According to this, also the sport corresponding to the third part of the soul is the best. For this kind of sport it is no longer necessary to compete with other contestants, since it can achieve it's fulfilment in perfect execution of movement or exercise, in which the perfect cooperation between reason (soul and body is attained. At this stage of sport it is the most important to compete and win over one's self, and this can be achieved by everyone, without regard to his/her physical abilities in comparison with others. In Plato's view, good sport is the sport directed

  12. Carbamate Insecticides Target Human Melatonin Receptors.

    Science.gov (United States)

    Popovska-Gorevski, Marina; Dubocovich, Margarita L; Rajnarayanan, Rajendram V

    2017-02-20

    Carbaryl (1-naphthyl methylcarbamate) and carbofuran (2,3-dihydro-2,2-dimethyl-7-benzofuranyl methylcarbamate) are among the most toxic insecticides, implicated in a variety of diseases including diabetes and cancer among others. Using an integrated pharmacoinformatics based screening approach, we have identified these insecticides to be structural mimics of the neurohormone melatonin and were able to bind to the putative melatonin binding sites in MT1 and MT2 melatonin receptors in silico. Carbaryl and carbofuran then were tested for competition with 2-[(125)I]-iodomelatonin (300 pM) binding to hMT1 or hMT2 receptors stably expressed in CHO cells. Carbaryl and carbofuran showed higher affinity for competition with 2-[(125)I]-iodomelatonin binding to the hMT2 compared to the hMT1 melatonin receptor (33 and 35-fold difference, respectively) as predicted by the molecular modeling. In the presence of GTP (100 μM), which decouples the G-protein linked receptors to modulate signaling, the apparent efficacy of carbaryl and carbofuran for 2-[(125)I]-iodomelatonin binding for the hMT1 melatonin receptor was not affected but significantly decreased for the hMT2 melatonin receptor compatible with receptor antagonist/inverse agonist and agonist efficacy, respectively. Altogether, our data points to a potentially new mechanism through which carbamate insecticides carbaryl and carbofuran could impact human health by altering the homeostatic balance of key regulatory processes by directly binding to melatonin receptors.

  13. Wash resistance of insecticide-treated materials.

    Science.gov (United States)

    Ordóñez González, José; Kroeger, Axel; Aviña, Ana Isabel; Pabón, Eulides

    2002-01-01

    The effectiveness of insecticide-treated materials (ITMs) for malaria control is reduced by washing them. This research in Colombia and Bolivia investigated the resistance of different insecticide formulations and, in particular, a commercially available impregnated bednet (PermaNet) which provides chemical protection for the insecticide. The fabrics studied were all polyester; the pyrethroids used for impregnation were deltamethrin (tablet and suspension concentrate both at 25 mg/m2 target dose), lambdacyhalothrin (capsule suspension at 15 mg/m2; laboratory study only), alphacypermethrin (suspension concentrate at 40 mg/m2) and, in the case of PermaNet, deltamethrin (55 mg/m2). The indicator of wash resistance was Anopheles spp. mortality (using the bioassay cone method) before and after different numbers and intensities of washing. When the fabrics were washed under controlled conditions, gently with water and a bar of soap, the wash resistance of all formulations was good (100% Anopheles mortality after 3 washes). However, when the impregnated nets were soaked for 30-60 min and washed with soap powder and tap water by local women in the usual way, the mortality after 4 washes declined considerably (43.5% and 41.3% for deltamethrin tablets and liquid respectively when washing every second day). Alphacypermethrin showed slightly better results after 3 washes every 7th day compared to deltamethrin tablets (63.8% and 43.3% mortality, respectively). The wash resistance offered by PermaNet was much better and longer lasting: Anopheles mortality after 4 washes was 92.6%, after 10 washes 83.7% and after 20 washes 87.1%. The limitations of commercially available wash-resistant nets are, however, their limited accessibility and the difficulty of replacing all existing bednets with a new product.

  14. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  15. Mechanics of Thin Strip Steering in Hot Rolling

    Science.gov (United States)

    Jiang, Zhengyi; Tieu, Kiet A.

    2004-06-01

    The hot rolling of thin strip can result in several problems in hot rolling, for instance, the control of strip steering, strip shape and flatness and surface roughness etc. Therefore, the hot rolling of thin strip brings out a requirement of innovative technologies such as the extended control of shape and flatness, steering control and reduction of load by roll gap lubrication. In this paper, the authors focus on the analysis of thin strip snaking movement, as well as solve the related problems such as the shape and flatness due to a larger reduction applied when the strip is thinner. A finite element method was used to simulate this nonsymmetricity rolling considering the non-uniform reduction along the strip width. The calculated spread is compared with the measured values obtained from the rolling mill in laboratory and the friction effect is also discussed.

  16. Antenna with distributed strip and integrated electronic components

    Science.gov (United States)

    Rodenbeck, Christopher T.; Payne, Jason A.; Ottesen, Cory W.

    2008-08-05

    An antenna comprises electrical conductors arranged to form a radiating element including a folded line configuration and a distributed strip configuration, where the radiating element can be in proximity to a ground conductor and/or arranged as a dipole. Embodiments of the antenna include conductor patterns formed on a printed wiring board, having a ground plane, spacedly adjacent to and coplanar with the radiating element. An antenna can comprise a distributed strip patterned on a printed wiring board, integrated with electronic components mounted on top of or below the distributed strip, and substantially within the extents of the distributed strip. Mounting of electronic components on top of or below the distributed strip has little effect on the performance of the antenna, and allows for realizing the combination of the antenna and integrated components in a compact form. An embodiment of the invention comprises an antenna including a distributed strip, integrated with a battery mounted on the distributed strip.

  17. PRESUPPOSITIONS AND IMPLICATURES IN COMIC STRIPS

    Directory of Open Access Journals (Sweden)

    Ienneke Indra Dewi

    2008-05-01

    Full Text Available Article aimed to find out the role of presuppositions, implicatures, as well as to see the maxims violated or flouted in the comic strips i.e. to whether there is a miscommunication among the characters in the comic strips. Data were taken from the three comics, those are Peanuts, Andy, and Tintin, and were analysed based on the pattern that the sender made a presupposition before transferring information and the receiver would try to get the implied message. The results show that presuppositions and implicatures are much influenced by the background knowledge. The more the speaker and hearer know each other’s background, the better presuppositions and implicatures they make and finally, the less miscommunication occurred.

  18. Operation of a Batch Stripping Distillation Column

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A stripping batch distillation column is preferred when the amount of the light component in the feed is small and the products are to be recovered at high purity. The operation modes of a batch stripping are believed to be the same as those of a rectifier. However, the control system of a stripper is different. In this paper, we explore three different control methods with Hysys (Hyprotech Ltd. 1997) for a batch stripper. The main difference is the control scheme for reboiler liquid level: (a) controlled by reflux flow; (b) controlled by reboiler heat duty; (c) controlled by bottom product flow. The main characteristics of operating a batch stripper with different control scheme are presented in this paper. Guidelines are provided for the startup of a batch stripper, the effects of somecontrol tuning parameters on the column performance are discussed.

  19. L-strip proximity fed ga

    Directory of Open Access Journals (Sweden)

    Ashish Singh

    2014-03-01

    Full Text Available In this article, the analysis of dualband L-strip fed compact semi-circular disk microstrip patch antenna has been presented using circuit theory concept. The antenna parameters such as return loss, VSWR and radiation pattern are calculated. The effect of geometric dimensions of the proposed antenna such as length of vertical and horizontal portion of L-strip is investigated. It is found that antenna resonate at two distinct modes i.e. 1.3 GHz and 6.13 GHz for lower and upper resonance frequencies respectively. The bandwidth of the proposed antenna at lower resonance frequency is 6.61% (simulated and 10.64% (theoretical whereas at upper resonance frequency, it is 6.02% (simulated and 9.06 % (theoretical. The theoretical results are compared with IE3D simulation results as well as experimental results and they are in close agreement.

  20. Frequency dependent magnetization of superconductor strip

    Energy Technology Data Exchange (ETDEWEB)

    Thakur, Kailash Prasad [Landcare Research, Palmerston North (New Zealand); Raj, Ashish [Computer Science in Radiology, Weill Medical College, Cornell University, NY (United States); Brandt, Ernst Helmut [Max-Planck-Institut fuer Metallforschung, POB 800665, D-70506 Stuttgart (Germany); Sastry, Pamidi V P S S, E-mail: thakurk@landcareresearch.co.nz, E-mail: asr2004@med.cornell.edu, E-mail: ehb@mf.mpg.de, E-mail: pamidi@caps.fsu.edu [Center for Advanced Power Systems, Florida State University, Tallahassee, FL 32310 (United States)

    2011-04-15

    The frequency dependence of magnetic ac loss of thin superconductor strip subjected to an ac magnetic field perpendicular to the surface of the strip is investigated by incorporating a flux creep model into the critical state model of Brandt and Indenbom. It is found that the reduced ac loss exhibits a maximum value at a frequency f{sub m}, which is a rapidly varying function of the applied ac magnetic field. At low magnetic field, f{sub m} becomes zero, and ac loss decreases with frequency as a power law ({approx}f{sup -2/n}). Whereas at high magnetic field f{sub m} becomes infinite and ac loss increases with frequency, still following the power law ({approx}f{sup 1/n}). The analytical results are substantiated with experimental data and the results of a 2D finite element simulation.

  1. The Extent of the Stop Coannihilation Strip

    CERN Document Server

    Ellis, John; Zheng, Jiaming

    2014-01-01

    Many supersymmetric models such as the CMSSM feature a strip in parameter space where the lightest neutralino \\chi is identified as the lightest supersymmetric particle (LSP), the lighter stop squark \\tilde t_1 is the next-to-lightest supersymmetric particle (NLSP), and the relic \\chi cold dark matter density is brought into the range allowed by astrophysics and cosmology by coannihilation with the lighter stop squark \\tilde t_1 NLSP. We calculate the stop coannihilation strip in the CMSSM, incorporating Sommerfeld enhancement effects, and explore the relevant phenomenological constraints and phenomenological signatures. In particular, we show that the \\tilde t_1 may weigh several TeV, and its lifetime may be in the nanosecond range, features that are more general than the specific CMSSM scenarios that we study in this paper.

  2. Coiling Temperature Control in Hot Strip Mill

    Science.gov (United States)

    Imanari, Hiroyuki; Fujiyama, Hiroaki

    Coiling temperature is one of the most significant factors in products of hot strip mill to determine material properties such as strength, toughness of steel, so it is very important to achieve accurate coiling temperature control (CTC). Usually there are a few pyrometers on the run out table in hot strip mill, therefore temperature model and its adapting system have large influences on the accuracy of CTC. Also unscheduled change of rolling speed has a bad effect to keep coiling temperature as its target. Newly developed CTC system is able to get very accurate coiling temperature against uncertain factors and disturbances by adopting easily identified temperature model, learning method and dynamic set up function. The features of the CTC system are discussed with actual data, and the effectiveness of the system is shown by actual control results.

  3. ITCS Test Strip Development and Certification

    Science.gov (United States)

    Carrigan, Caitlin; Adam, Niklas; Pickering, Karen; Gazda, Daniel; Piowaty, Hailey

    2011-01-01

    Internal coolant loops used for International Space Station thermal control must be periodically monitored for system health, including pH, biocide levels and any indication of ammonia. The presence of ammonia, possible via a microleak in the interface between the internal and external thermal control systems, could be a danger to the crew. The Internal Thermal Control System (ITCS) Sampling Kit uses test strips as a colorimetric indicator of pH and concentrations of biocide and free ammonia. This paper describes the challenges in designing an ammonia colorimetric indicator in a variable pH environment, as well as lessons learned, ultimately resulting in a robust test strip to indicate a hazardous ammonia leak.

  4. Cytotoxic and Insecticidal Activities of Derivatives of Harmine, a Natural Insecticidal Component Isolated from Peganum harmala

    Directory of Open Access Journals (Sweden)

    Guohua Zhong

    2010-11-01

    Full Text Available In a continuing effort to develop novel β-carbolines endowed with better insecticidal activity, a simple high-yielding method for the synthesis of harmine compounds starting from L-tryptophan has been developed and a series of 1,3-substituted β-carboline derivatives have been synthesized and evaluated for their cytotoxicity against insect cultured Sf9 cell line in vitro and insecticidal activities against 4th instar larvae of mosquitos, Culex pipiens quinquefasciatus and mustard aphid, Lipaphis erysimi. The results demonstrated that 1-phenyl-1,2,3,4-tetrahydro-β-carboline-3-carboxylic acid (compound 2 and methyl 1-phenyl-β-carboline-3-carboxylate (compound 13 represented the best potential compounds, with Sf9 cells inhibition rates of 71.55% and 60.21% after 24 h treatment at concentrations of 50–200 mg/L, respectively. Both compounds 2 and 13 also showed strong insecticidal activity towards 4th instar larvae of mosquitos with LC50 values of 20.82 mg/L and 23.98 mg/L, and their LC90 values were 88.29 mg/L and 295.13 mg/L, respectively. Furthermore, the LC50 values of compounds 2 and 13 against mustard aphids were 53.16 mg/L and 68.05 mg/L, and their LC90 values were 240.10 mg/L and 418.63 mg/L after 48 h treatment. The in vitro cytotoxicity of these compounds was consistent with the insecticidal activity in vivo. The results indicated that the 1- and 3-positions of the β-carboline ring deserve further investigation to develop biorational insecticides based on the natural compound harmine as a lead compound.

  5. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  6. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  7. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  8. A Spinning Particle in a Mobius Strip

    CERN Document Server

    Nieto, J A

    2011-01-01

    We develop the classical and quantum theory of a spinning particle moving in a Mobius strip. We first propose a Lagrangian for such a system and then we proceed to quantize the system via the constraint Hamiltonian system formalism. Our results may be of particular interest in several physical scenarios, including solid state physics and optics. In fact, the present work may shed some new light on the recent discoveries on condensed matter concerning topological insulators.

  9. Hot Strip Laminar Cooling Control Model

    Institute of Scientific and Technical Information of China (English)

    WANG Jun; WANG Guo-dong; LIU Xiang-hua

    2004-01-01

    The control model of laminar cooling system for hot strip, including air-cooling model, water-cooling model, temperature distribution model along thickness direction, feedforward control model, feedback control model and self-learning model, was introduced. PID arithmetic and Smith predictor controller were applied to feedback control. The sample of model parameter classification was given. The calculation process was shown by flow chart. The model has been proved to be simple, effective and of high precision.

  10. Mastering Interproximal Stripping: With Innovations in Slenderization

    OpenAIRE

    Sharma, Narendra Shriram; Shrivastav, Sunita S; Hazarey, Pushpa V

    2012-01-01

    ABSTRACT Crowding and irregularity remain a consistent problem for children. Management of space problems continues to play an important role in a dental practice. It also represents an area of major interaction between the primary provider and the specialists. Proximal stripping is routinely carried out to avoid extraction in borderline cases where space discrepancy is less and in cases where there is a discrepancy between the mesio- distal width of maxillary and mandibular teeth to satisfy ...

  11. Development of Silicon Multi-strip Detector

    Institute of Scientific and Technical Information of China (English)

    TanJilian; JinGenming; WangHongwei; YuanXiaohua; DuanLiming; LiSonglin; LuZiwei; XuHushan; NingBaojun; TianDayu; WangWei; ZhangLu

    2003-01-01

    Position sensitive detector is very important for nuclear physics experiment. There several techniques can be used to fabricate position sensitive detector, for example, Si-surface barrier method, diffusion method, ion implantation and planar process etc. Among all the techniques mentioned above planar process is the best one. We have developed batch of position sensitive detector -- silicon multi-strip detector by using planar process.

  12. Multitwist optical Möbius strips.

    Science.gov (United States)

    Freund, Isaac

    2010-01-15

    Circularly polarized Gauss-Laguerre GL00 and GL01 laser beams that cross at their waists at a small angle are shown to generate a quasi-paraxial field that contains a line of circular polarization, a C line, surrounded by polarization ellipses whose major and minor axes generate multitwist Möbius strips with twist numbers that increase with the distance from the C point.

  13. Sustainable Water and Energy in Gaza Strip

    Science.gov (United States)

    Hamdan, L.; Zarei, M.; Chianelli, R.; Gardner, E.

    2007-12-01

    Shortage of fresh water is a common problem in different areas of the world including the Middle East. Desalination of seawater and brackish water is the cheapest way to obtain fresh water in many regions. This research focuses on the situation in Gaza Strip where there is a severe shortage in the energy and water supply. The depletion of fresh water supplies and lack of wastewater treatments result in environmental problems. A solar powered cogeneration plant producing water and energy is proposed to be a suitable solution for Gaza Strip. Solar energy, using Concentrating Solar thermal Power (CSP) technologies, is used to produce electricity by a steam cycle power plant. Then the steam is directed to a desalination plant where it is used to heat the seawater to obtain freshwater. The main objective of this research is to outline a solution for the water problems in Gaza Strip, which includes a cogeneration (power and water) solar powered plant. The research includes four specific objectives: 1- an environmental and economic comparison between solar and fossil fuel energies; 2- technical details for the cogeneration plant; 3- cost and funding, 4- the benefits.

  14. High-Rate Capable Floating Strip Micromegas

    CERN Document Server

    Bortfeldt, Jonathan; Biebel, Otmar; Danger, Helge; Flierl, Bernhard; Hertenberger, Ralf; Lösel, Philipp; Moll, Samuel; Parodi, Katia; Rinaldi, Ilaria; Ruschke, Alexander; Zibell, André

    2015-01-01

    We report on the optimization of discharge insensitive floating strip Micromegas (MICRO-MEsh GASeous) detectors, fit for use in high-energy muon spectrometers. The suitability of these detectors for particle tracking is shown in high-background environments and at very high particle fluxes up to 60MHz/cm$^2$. Measurement and simulation of the microscopic discharge behavior have demonstrated the excellent discharge tolerance. A floating strip Micromegas with an active area of 48cm$\\times$50cm with 1920 copper anode strips exhibits in 120GeV pion beams a spatial resolution of 50$\\mu$m at detection efficiencies above 95%. Pulse height, spatial resolution and detection efficiency are homogeneous over the detector. Reconstruction of particle track inclination in a single detector plane is discussed, optimum angular resolutions below $5^\\circ$ are observed. Systematic deviations of this $\\mu$TPC-method are fully understood. The reconstruction capabilities for minimum ionizing muons are investigated in a 6.4cm$\\time...

  15. Wakes of ram pressure stripped disc galaxies

    CERN Document Server

    Roediger, E; Hoeft, M

    2006-01-01

    Spiral galaxies that move through the intracluster medium lose a substantial amount of their gas discs due to ram pressure stripping. The recent observations of NGC 4388 by Oosterloo & van Gorkom 2005 reveal a tail of stripped gas of ~ 100 kpc behind the source galaxy. We present first 3D hydrodynamical simulations of the evolution of such ram pressure stripped tails. We find that if the ICM wind does not vary significantly over a period of a few 100 Myr, subsonic galaxies produce a tail with regular features similar to a von-Karman vortex street. In this case, the tail widens systematically by about 45 kpc per 100 kpc distance behind the source galaxy. The widening rate is independent of the galaxy's inclination for a large range of inclinations. For supersonic galaxies, the tail is more irregular than for subsonic ones. The tail observed for NGC 4388 is narrower than the tails in our simulations. Reasons for this difference may be additional physical processes such as heat conduction or viscosity. In ad...

  16. Anodic stripping voltammetry enhancement by redox magnetohydrodynamics.

    Science.gov (United States)

    Clark, Emily A; Fritsch, Ingrid

    2004-04-15

    The effect of an external magnetic field on linear scan anodic stripping voltammetry (ASV) in solutions of 10(-6)-10(-7) M concentrations of lead, cadmium, and copper at mercury films on glassy carbon electrodes has been investigated. A high concentration of Hg(2+) was added to the analyte solution to induce a large cathodic current during the deposition step. Therefore, a large Lorentz force from the net flux of charge through the magnetic field resulted in convection due to magnetohydrodynamics. The faster delivery of analytes to the mercury film electrode during deposition caused an increase in the anodic stripping peaks. The effect of varying Hg(2+) concentrations (0-60 mM) and magnetic field strengths (0-1.77 T) on the enhancement of the stripping peaks was investigated. Enhancements as large as 129% for peak currents and 167% for peak areas were observed. An enhancement of approximately 100% was observed when 60 mM Fe(3+) replaced high concentrations of Hg(2+). This method of convection exhibits promise for small-volume ASV analysis with possible improved limits of detection and decreased preconcentration times.

  17. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  18. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  19. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides.

  20. Averting a malaria disaster: will insecticide resistance derail malaria control?

    Science.gov (United States)

    Hemingway, Janet; Ranson, Hilary; Magill, Alan; Kolaczinski, Jan; Fornadel, Christen; Gimnig, John; Coetzee, Maureen; Simard, Frederic; Roch, Dabiré K; Hinzoumbe, Clément Kerah; Pickett, John; Schellenberg, David; Gething, Peter; Hoppé, Mark; Hamon, Nicholas

    2016-04-23

    World Malaria Day 2015 highlighted the progress made in the development of new methods of prevention (vaccines and insecticides) and treatment (single dose drugs) of the disease. However, increasing drug and insecticide resistance threatens the successes made with existing methods. Insecticide resistance has decreased the efficacy of the most commonly used insecticide class of pyrethroids. This decreased efficacy has increased mosquito survival, which is a prelude to rising incidence of malaria and fatalities. Despite intensive research efforts, new insecticides will not reach the market for at least 5 years. Elimination of malaria is not possible without effective mosquito control. Therefore, to combat the threat of resistance, key stakeholders need to rapidly embrace a multifaceted approach including a reduction in the cost of bringing new resistance management methods to market and the streamlining of associated development, policy, and implementation pathways to counter this looming public health catastrophe.

  1. Fipronil insecticide toxicology: oxidative stress and metabolism.

    Science.gov (United States)

    Wang, Xu; Martínez, María Aránzazu; Wu, Qinghua; Ares, Irma; Martínez-Larrañaga, María Rosa; Anadón, Arturo; Yuan, Zonghui

    2016-11-01

    Fipronil (FIP) is widely used across the world as a broad-spectrum phenylpyrazole insecticide and veterinary drug. FIP was the insecticide to act by targeting the γ-aminobutyric acid (GABA) receptor and has favorable selective toxicity towards insects rather than mammals. However, because of accidental exposure, incorrect use of FIP or widespread FIP use leading to the contamination of water and soil, there is increasing evidence that FIP could cause a variety of toxic effects on animals and humans, such as neurotoxic, hepatotoxic, nephrotoxic, reproductive, and cytotoxic effects on vertebrate and invertebrates. In the last decade, oxidative stress has been suggested to be involved in the various toxicities induced by FIP. To date, few reviews have addressed the toxicity of FIP in relation to oxidative stress. The focus of this article is primarily intended to summarize the progress in research associated with oxidative stress as a possible mechanism for FIP-induced toxicity as well as metabolism. The present review reports that studies have been conducted to reveal the generation of reactive oxygen species (ROS) and oxidative stress as a result of FIP treatment and have correlated them with various types of toxicity. Furthermore, the metabolism of FIP was also reviewed, and during this process, various CYP450 enzymes were involved and oxidative stress might occur. The roles of various compounds in protecting against FIP-induced toxicity based on their anti-oxidative effects were also summarized to further understand the role of oxidative stress in FIP-induced toxicity.

  2. Risks of neonicotinoid insecticides to honeybees.

    Science.gov (United States)

    Fairbrother, Anne; Purdy, John; Anderson, Troy; Fell, Richard

    2014-04-01

    The European honeybee, Apis mellifera, is an important pollinator of agricultural crops. Since 2006, when unexpectedly high colony losses were first reported, articles have proliferated in the popular press suggesting a range of possible causes and raising alarm over the general decline of bees. Suggested causes include pesticides, genetically modified crops, habitat fragmentation, and introduced diseases and parasites. Scientists have concluded that multiple factors in various combinations-including mites, fungi, viruses, and pesticides, as well as other factors such as reduction in forage, poor nutrition, and queen failure-are the most probable cause of elevated colony loss rates. Investigators and regulators continue to focus on the possible role that insecticides, particularly the neonicotinoids, may play in honeybee health. Neonicotinoid insecticides are insect neurotoxicants with desirable features such as broad-spectrum activity, low application rates, low mammalian toxicity, upward systemic movement in plants, and versatile application methods. Their distribution throughout the plant, including pollen, nectar, and guttation fluids, poses particular concern for exposure to pollinators. The authors describe how neonicotinoids interact with the nervous system of honeybees and affect individual honeybees in laboratory situations. Because honeybees are social insects, colony effects in semifield and field studies are discussed. The authors conclude with a review of current and proposed guidance in the United States and Europe for assessing the risks of pesticides to honeybees.

  3. Effect of boron on hot strips of low carbon steel produced by compact strip production

    Institute of Scientific and Technical Information of China (English)

    Hao Yu; Yonglin Kang

    2008-01-01

    The effect of boron on hot strips of low carbon steel produced by compact strip production (CSP) to reduce the strength to a certain degree was investigated, which is quite different from that of high-strength low alloy steel. The mechanical properties and microstructural evolution of the hot strip were studied using optical microscopy and tensile tests. By means of an electrolytic disso- lution technique and Thermo-Cal calculation, the precipitates containing boron were analyzed and detected. From the electron back- scattered diffraction analysis, it can be deciphered whether the microstructure has recrystallized or not. Furthermore, the effect of boron segregation on the recrystallization or non-recrystallization conditions can be distinguished. The segregation behavior of boron was investigated in boron-containing steel. The nonequilibrium segregation of boron during processing was discussed on the basis of the forming complexes with vacancies that migrate to the boundaries prior to annihilation, which was confirmed by the subsequent cold rolling with annealing experiments.

  4. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  5. The influence of Plato, Aristotle, and the ancient Polis on a programme for congenital cardiac surgery: the virtuous partnership.

    Science.gov (United States)

    Mavroudis, Constantine; Backer, Carl L

    2007-09-01

    The problems that exist in maintaining a partnership in paediatric cardiac surgery are considerable. They relate to fairness in allocation of time for leisure, the apportioning of cases between the partners, internal competition between them, financial considerations, and promotion of the ego. In this review, we discuss our own experiences in maintaining a partnership over a period of more than 18 years, relating such a "virtuous partnership" to the writings of Plato and Aristotle, and setting it against the tenets of the ancient Greek polis. The polis, or city state, came to prominence in ancient Greece during the golden age of Pericles, this period seeing the initial evolution of Western philosophy, as well as numerous other scientific, artistic and architectural advances. The concept of the polis was to create a natural association with its citizens that nurtured all that is best in people, at the same time defining their character. In this respect, according to Plato, the person and the polis are mirror images. Aristotle then expanded this notion to incorporate the various forms of friendship, which he pointed out last only as long as the interrelated pleasure survives. Using these principles as the point of departure, we argue that cardiac surgeons should respect moral virtue in each other. Extending this process means that we should also respect, and celebrate, our relationships with affiliated physicians, nurses, perfusionists, administrators, and all concerned in the care of children with congenitally malformed hearts. In this way, we create a virtuous partnership for congenital cardiac surgery that promotes all that was good, as engendered in the ancient Greek polis. As we extend these observations to the modern world, we discuss some of the features that have permitted us to work so well together. One of the most important is a summoning and unwritten tenet that greets us as we enter the operating room, namely "check your ego at the door". The operative

  6. Insecticides induced biochemical changes in freshwater microalga Chlamydomonas mexicana.

    Science.gov (United States)

    Kumar, Muthukannan Satheesh; Kabra, Akhil N; Min, Booki; El-Dalatony, Marwa M; Xiong, Jiuqiang; Thajuddin, Nooruddin; Lee, Dae Sung; Jeon, Byong-Hun

    2016-01-01

    The effect of insecticides (acephate and imidacloprid) on a freshwater microalga Chlamydomonas mexicana was investigated with respect to photosynthetic pigments, carbohydrate and protein contents, fatty acids composition and induction of stress indicators including proline, superoxide dismutase (SOD) and catalase (CAT). C. mexicana was cultivated with 1, 5, 10, 15, 20 and 25 mg L(-1) of acephate and imidacloprid. The microalga growth increased with increasing concentrations of both insecticides up to 15 mg L(-1), beyond which the growth declined compared to control condition (without insecticides). C. mexicana cultivated with 15 mg L(-1) of both insecticides for 12 days was used for further analysis. The accumulation of photosynthetic pigments (chlorophyll and carotenoids), carbohydrates and protein was decreased in the presence of both insecticides. Acephate and imidacloprid induced the activities of superoxide dismutase (SOD) and catalase (CAT) and increased the concentration of proline in the microalga, which play a defensive role against various environmental stresses. Fatty acid analysis revealed that the fraction of polyunsaturated fatty acids decreased on exposure to both insecticides. C. mexicana also promoted 25 and 21% removal of acephate and imidacloprid, respectively. The biochemical changes in C. mexicana on exposure to acephate and imidacloprid indicate that the microalga undergoes an adaptive change in response to the insecticide-induced oxidative stress.

  7. Virus and calcium: an unexpected tandem to optimize insecticide efficacy.

    Science.gov (United States)

    Apaire-Marchais, Véronique; Ogliastro, Mylène; Chandre, Fabrice; Pennetier, Cédric; Raymond, Valérie; Lapied, Bruno

    2016-04-01

    The effective control of insect pests is based on the rational use of the most efficient and safe insecticide treatments. To increase the effects of classical insecticides and to avoid the ability of certain pest insects to develop resistance, it is essential to propose novel strategies. Previous studies have shown that calcium-dependent phosphorylation/dephosphorylation is now considered as a new cellular mechanism for increasing the target sensitivity to insecticides. Because it is known that virus entry is correlated with intracellular calcium concentration rise, this report attempts to present the most important data relevant to the feasibility of combining an insect virus such as baculovirus or densovirus with an insecticide. In this case, the insect virus is not used as a bioinsecticide but acts as a synergistic agent able to trigger calcium rise and to activate calcium-dependent intracellular signalling pathways involved in the increase of the membrane receptors and/or ion channels sensitivity to insecticides. This virus-insecticide mixture represents a promising alternative to optimize the efficacy of insecticides against insect pests while reducing the doses. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  8. Uranium stripping from tributyl phosphate by urea solutions

    Science.gov (United States)

    Skripchenko, S. Yu.; Titova, S. M.; Smirnov, A. L.; Rychkov, V. N.

    2016-09-01

    The process of uranium stripping from tri-n-butyl phosphate in kerosene by urea solutions was investigated at the volume ratio of the organic and aqueous phases of (1-10) : 1 in the temperature range of 20-60 °C. The stripping of uranium from a loaded organic phase increased with increasing urea content in the solution and with increasing temperature. Maximum recovery of uranium from tributyl phosphate was obtained using a solution that contained 8-12 mol/l of urea. The application of a urea solution for uranium stripping resulted in the strip product solution containing 200-240 g/L of uranium. The process of uranium stripping by dilute nitric acid was also investigated. Results of uranium stripping by the two methods are compared and discussed.

  9. Energetic cost of insecticide resistance in Culex pipiens mosquitoes.

    Science.gov (United States)

    Rivero, A; Magaud, A; Nicot, A; Vézilier, J

    2011-05-01

    The extensive use of insecticides to control vector populations has lead to the widespread development of different mechanisms of insecticide resistance. Mutations that confer insecticide resistance are often associated to fitness costs that prevent them from spreading to fixation. In vectors, such fitness costs include reductions in preimaginal survival, adult size, longevity, and fecundity. The most commonly invoked explanation for the nature of such pleiotropic effects of insecticide resistance is the existence of resource-based trade-offs. According to this hypothesis, insecticide resistance would deplete the energetic stores of vectors, reducing the energy available for other biological functions and generating trade-offs between insecticide resistance and key life history traits. Here we test this hypothesis by quantifying the energetic resources (lipids, glycogen, and glucose) of larvae and adult females of the mosquito Culex pipiens L. resistant to insecticides through two different mechanisms: esterase overproduction and acetylcholinesterase modification. We find that, as expected from trade-off theory, insecticide resistant mosquitoes through the overproduction of esterases contain on average 30% less energetic reserves than their susceptible counterparts. Acetylcholinesterase-modified mosquitoes, however, also showed a significant reduction in energetic resources (20% less). We suggest that, in acetylcholinesterase-modified mosquitoes, resource depletion may not be the result of resource-based trade-offs but a consequence of the hyperactivation of the nervous system. We argue that these results not only provide a mechanistic explanation for the negative pleiotropic effects of insecticide resistance on mosquito life history traits but also can have a direct effect on the development of parasites that depend on the vector's energetic reserves to fulfil their own metabolic needs.

  10. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  11. High pressure water jet cutting and stripping

    Science.gov (United States)

    Hoppe, David T.; Babai, Majid K.

    1991-01-01

    High pressure water cutting techniques have a wide range of applications to the American space effort. Hydroblasting techniques are commonly used during the refurbishment of the reusable solid rocket motors. The process can be controlled to strip a thermal protective ablator without incurring any damage to the painted surface underneath by using a variation of possible parameters. Hydroblasting is a technique which is easily automated. Automation removes personnel from the hostile environment of the high pressure water. Computer controlled robots can perform the same task in a fraction of the time that would be required by manual operation.

  12. Fermilab silicon strip readout chip for BTev

    Energy Technology Data Exchange (ETDEWEB)

    Yarema, Raymond; Hoff, Jim; Mekkaoui, Abderrezak; Manghisoni, Massimo; Re, Valerio; Angeleri, Valentina; Manfredi, Pier Francesco; Ratti, Lodovico; Speziali, Valeria; /Fermilab /Bergamo U. /INFN, Pavia /Pavia U.

    2005-05-01

    A chip has been developed for reading out the silicon strip detectors in the new BTeV colliding beam experiment at Fermilab. The chip has been designed in a 0.25 {micro}m CMOS technology for high radiation tolerance. Numerous programmable features have been added to the chip, such as setup for operation at different beam crossing intervals. A full size chip has been fabricated and successfully tested. The design philosophy, circuit features, and test results are presented in this paper.

  13. Intelligent Control on Hot Strip Coiling Temperature

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A new intelligent control scheme for hot strip coiling temperature is presented. In this scheme, the prediction model of finishing temperature and the presetting model of main cooling zone are establish based on BP neural network, the feed-forward open-loop control model of main cooling zone is constructed based on T-S fuzzy neural network, a new improved structure of T-S fuzzy neural network is developed, and the feedback close-loop control model of precision cooling zone is obtained based on fuzzy control. The effectiveness of the proposed scheme has been demonstrated by computer simulation with a satisfactory result.

  14. Gas Stripping in the Simulated Pegasus Galaxy

    Science.gov (United States)

    Mercado, Francisco Javier; Samaniego, Alejandro; Wheeler, Coral; Bullock, James

    2017-01-01

    We utilize the hydrodynamic simulation code GIZMO to construct a non-cosmological idealized dwarf galaxy built to match the parameters of the observed Pegasus dwarf galaxy. This simulated galaxy will be used in a series of tests in which we will implement different methods of removing the dwarf’s gas in order to emulate the ram pressure stripping mechanism encountered by dwarf galaxies as they fall into more massive companion galaxies. These scenarios will be analyzed in order to determine the role that the removal of gas plays in rotational vs. dispersion support (Vrot/σ) of our galaxy.

  15. Beam Test Results for MSGC's with Thick Metal Strips.

    CERN Document Server

    Beaumont, W; Bernier, K; Bouhali, O; Boulogne, I; Daubie, Evelyne; De Troy, J G; Delentdecker, G; Devroede, O; Gregoire,,; Iacopi, F; Udo, Fred; Van Doninck, W K; Van Dyck, C; Van Lancker, L; Van der Velde, C; Verbeure, F; Zhukov, V

    1999-01-01

    Micro Strip Gas Counters with robust gold strips have been developed at IMEC, the Interuniversity Microelectronics Center at Leuven, in Belgium. The electroless plating technology was used, allowing to achieve a strip thickness of up to 1.6 mu m on 10 X 10 cm**2 substrates. Results on signal to noise ratio, spark rate, resulting damages and detector occupancy are presented for counters exposed to various intensities of heavily ionizing particles.

  16. Study on Production of Rubber Sealing Strips with Steel Bones

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Rubber sealing strips with steel bones are used in car manufacturing that produced in large quantities. Cutting processes, such as milling and punching, are needed when the strips are produced. Accuracy, smoothness and flatness of the machined surface have to be guaranteed in the cutting process; moreover, deformation of the steel bone and peeling-off of the rubber must be avoided. Therefore cutting action of rubber/steel strips differs from that of rubber or metal workpiece separately. In this paper, milli...

  17. Time domain non linear strip theory for ship motions

    OpenAIRE

    Fan, Y.T.; Wilson, P. A.

    2004-01-01

    A new implementation of strip theory is proposed based on the strip theory by Salvesen, et al. [1] and early work by Westlake and Wilson [2]. Compared with traditional strip theory, the main difference is that the calculation is carried out in the time domain. This makes it possible to cope with relatively large-amplitude motions and non-constant forward speed problems. At each time step, the exact underwater sections are extracted; the velocity potential is required to satisfyt...

  18. Factors Influencing Bonding Strength of Laminated Bamboo Strips Lumber

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Factors influencing bonding strength of laminated bamboo strips lumber (LBSL) were investigated in this paper. In order to find an optimized technology, this paper investigated how the thickness of bamboo strips, the assembly orientation of bamboo curtain, the type of adhesives, as well as coupling agent treatment of bamboo curtain affected the bonding strength. The following conclusions were drawn: 1)The thinner the thickness of the bamboo strips, the bigger the bonding strength of LBSL; 2) The assembly or...

  19. Terminal Strip Facilitates Printed-Circuit Board Changes

    Science.gov (United States)

    Pinto, E. A.; Mcosker, C. E.

    1983-01-01

    Laminanted copper and polyimide terminal strip makes it easy to modify printed-circuit (PC) board, after board has been fabricated. When epoxied over conductors or insulating portion of PC board, strip provides series of solder-coated copper conductor pads to which integrated-circuit leads are soldered for functional changes. Terminal strips accommodate leads on dual inline IC package or as staggered single or multiple leads on planar mounted flatpacks.

  20. Space Vehicle Heat Shield Having Edgewise Strips of Ablative Material

    Science.gov (United States)

    Blosser, Max L. (Inventor); Poteet, Carl C. (Inventor); Bouslog, Stan A. (Inventor)

    2015-01-01

    A heat shield for a space vehicle comprises a plurality of phenolic impregnated carbon ablator (PICA) blocks secured to a surface of the space vehicle and arranged in a pattern with gaps therebetween. The heat shield further comprises a plurality of PICA strips disposed in the gaps between the PICA blocks. The PICA strips are mounted edgewise, such that the structural orientation of the PICA strips is substantially perpendicular to the structural orientation of the PICA blocks.

  1. Synthetic and structure-activity relationship of insecticidal bufadienolides.

    Science.gov (United States)

    Hidayat, Ace Tatang; Zainuddin, Achmad; Dono, Danar; Hermawan, Wawan; Hayashi, Hideo; Supratman, Unang

    2014-07-01

    A new synthetic analog of bufadienolide, methyl isobryophyllinate A (1), and a known synthetic analog, methyl isobersaldegenate-1,3,5-orthoacetate (2), were obtained by methanolysis of bryophyllin A (3) and bersaldegenin-1,3,5-orthoacetate (5) in basic solution. Structure-insecticidal activity relationship studies revealed both orthoacetate and alpha-pyrone moieties seemed to be essential structural elements for exhibiting insecticidal activity, whereas oxygenated substituents in the C ring enhanced the insecticidal activity against the third instar larvae of silkworm (Bombyx mori).

  2. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  3. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  4. Toxicological Properties of the Organophosphorus Insecticide Dimethoate

    Science.gov (United States)

    Sanderson, D. M.; Edson, E. F.

    1964-01-01

    The results are presented of extensive toxicological studies on the systemic organophosphate insecticide dimethoate, and compared with published results from other laboratories. It behaves as a typical indirect anticholinesterase, by conversion in the liver to at least four short-lived active metabolites, whose hydrolysis products are rapidly excreted, mainly in the urine. The acute oral toxicity of dimethoate is low in mammals but higher in avians. Dermal absorption is notably slow and dermal toxicity correspondingly low. Cumulative dosing of rats and guinea-pigs gave no cholinesterase inhibition at 0·7 and 4 mg./kg./day respectively. Dietary feeding to growing rats caused no cholinesterase inhibition at 0·5 mg./kg./day and no other effect at 10 times this dose. The main plant metabolite is identical with one formed in the liver, and comparative feeding tests with normal dimethoate and that partly metabolized in vegetation showed that residue analysis determined total hazard. Tests on humans, some with 32P-labelled material, confirmed that metabolism and urinary excretion are very rapid, that skin absorption is very slow, and that at least 2·5 mg., and probably up to 18 mg., could be ingested daily for at least three weeks without cholinesterase inhibition or other effects. Vapour hazards proved negligible. Oral toxicity was not potentiated by any of 17 other insecticides. The earliest detectable effect of dimethoate poisoning was always erythrocyte cholinesterase inhibition. Symptoms of poisoning could be effectively treated by atropine but not by oxime therapy. No known cases of occupational poisoning have occurred during five years' commercial usage of dimethoate. PMID:14106136

  5. Clad strip casting by a twin roll caster

    OpenAIRE

    T. Haga; Nakamura, R; S. Kumai; H. Watari

    2009-01-01

    Purpose: Of this paper is to realize the casting of the clad strip by only one process. Therefore, the investigation of the ability of the casting of the clad strip by a vertical type twin roll caster was operated. The aim of the use of the twin roll caster to make clad strip was in the reduction of the production-energy of the clad strip.Design/methodology/approach: Used in the present study was a vertical type twin roll caster with the scriber. The scriber was used to prevent the mixture of...

  6. Three-Dimensional Model for Strip Hot Rolling

    Institute of Scientific and Technical Information of China (English)

    ZHANG Guo-min; XIAO Hong; WANG Chun-hua

    2006-01-01

    A three-dimensional model for strip hot rolling was developed, in which the plastic deformation of strip, the thermal crown of rolls, roll deflection and flattening were calculated by rigid-plastic finite element method, finite difference method, influential function method and elastic finite element method respectively. The roll wear was taken into consideration. The model can provide detailed information such as rolling pressure distribution, contact pressure distribution between backup rolls and work rolls, deflection and flattening of work rolls, lateral distribution of strip thickness, and lateral distribution of front and back tensions. The finish rolling on a 1 450 mm hot strip mill was simulated.

  7. Stripped elliptical galaxies as probes of ICM physics: I. Tails, wakes, and flow patterns in and around stripped ellipticals

    CERN Document Server

    Roediger, E; Nulsen, P E J; Forman, W R; Machacek, M; Randall, S; Jones, C; Churazov, E; Kokotanekova, R

    2014-01-01

    (abridged) Elliptical cluster galaxies are successively stripped of their gaseous atmospheres due to their motion through the ICM. The stripped galactic gas forms a 'tail' in the galaxy's wake. Deep X-ray observations reveal the fine-structure of the gas tail and of the interface between galactic gas and ICM. This fine-structure depends on dynamic conditions (galaxy potential, initial gas contents, orbit in the host cluster), stripping stage (early infall, pre-/post-pericenter passage), and on the still ill-constrained ICM plasma properties (thermal conductivity, viscosity, magnetic field structure). In a series of papers, we aim at disentangling dynamic and plasma effects in order to use observed stripped ellipticals as probes of the ICM plasma properties. This first paper determines flow phases and flow patterns of successive gas stripping by means of hydrodynamical simulations. During quasi-steady stripping, the flow of ICM around the remnant atmosphere is similar to the flow around solid bodies, including...

  8. Chromogenic platform based on recombinant Drosophila melanogaster acetylcholinesterase for visible unidirectional assay of organophosphate and carbamate insecticide residues

    Energy Technology Data Exchange (ETDEWEB)

    Han Zheng [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Chi Chensen [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Bai Bing; Liu Gang; Rao Qinxiong [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Peng Shaojie [Institute of Shanghai Food and Drug Supervision, 615 Liuzhou Road, Shanghai 200233 (China); Liu Hong [Shanghai Municipal Center for Disease Control and Prevention, 1380 Zhongshan West Road, Shanghai 200336 (China); Zhao Zhihui [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China); Zhang Dabing [School of Life Science and Biotechnology, Bor Luh Food Safety Center, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China); Wu Aibo, E-mail: wuaibo@saas.sh.cn [Institute for Agri-food Standards and Testing Technology, Shanghai Academy of Agricultural Sciences, 1018 Jinqi Road, Shanghai 201403 (China)

    2012-03-30

    Highlight: Black-Right-Pointing-Pointer A visible chromogenic platform for rapid analysis of OP and CM insecticide residues was developed. Black-Right-Pointing-Pointer The assay has the capabilities of both qualitative measurement and quantitative analysis. Black-Right-Pointing-Pointer The sensitivity, capabilities of resisting interferences and storage stability were desirable. Black-Right-Pointing-Pointer Matrix effects were acceptable and detection performance was satisfactory in real application. - Abstract: In this study we propose a chromogenic platform for rapid analysis of organophosphate (OP) and carbamate (CM) insecticide residues, based on recombinant Drosophila melanogaster acetylcholinesterase (R-DmAChE) as enzyme and indoxyl acetate as substrate. The visible chromogenic strip had the advantages identical to those of commonly used lateral flow assays (LFAs) with utmost simplicity in sample loading and result observation. After optimization, depending on the color intensity (CI) values, the well-established assay has the capabilities of both qualitative measurement via naked eyes and quantitative analysis by colorimetric reader with the desirable IC{sub 50} values against the tested six insecticides (0.06 {mu}g mL{sup -1} of carbofuran, 0.28 {mu}g mL{sup -1} of methomyl, 0.03 {mu}g mL{sup -1} of dichlorvos, 31.6 {mu}g mL{sup -1} of methamidophos, 2.0 {mu}g mL{sup -1} of monocrotophos, 6.3 {mu}g mL{sup -1} of omethoate). Acceptable matrix effects and satisfactory detection performance were confirmed by in-parallel LC-MS/MS analysis in different vegetable varieties at various spiked levels of 10{sup -3} to 10{sup 1} {mu}g g{sup -1}. Overall, the testified suitability and applicability of this novel platform meet the requirements for practical use in food safety management and environmental monitoring, especially in the developing world.

  9. Therapeutic surfactant-stripped frozen micelles

    Science.gov (United States)

    Zhang, Yumiao; Song, Wentao; Geng, Jumin; Chitgupi, Upendra; Unsal, Hande; Federizon, Jasmin; Rzayev, Javid; Sukumaran, Dinesh K.; Alexandridis, Paschalis; Lovell, Jonathan F.

    2016-05-01

    Injectable hydrophobic drugs are typically dissolved in surfactants and non-aqueous solvents which can induce negative side-effects. Alternatives like `top-down' fine milling of excipient-free injectable drug suspensions are not yet clinically viable and `bottom-up' self-assembled delivery systems usually substitute one solubilizing excipient for another, bringing new issues to consider. Here, we show that Pluronic (Poloxamer) block copolymers are amenable to low-temperature processing to strip away all free and loosely bound surfactant, leaving behind concentrated, kinetically frozen drug micelles containing minimal solubilizing excipient. This approach was validated for phylloquinone, cyclosporine, testosterone undecanoate, cabazitaxel and seven other bioactive molecules, achieving sizes between 45 and 160 nm and drug to solubilizer molar ratios 2-3 orders of magnitude higher than current formulations. Hypertonic saline or co-loaded cargo was found to prevent aggregation in some cases. Use of surfactant-stripped micelles avoided potential risks associated with other injectable formulations. Mechanistic insights are elucidated and therapeutic dose responses are demonstrated.

  10. SKULL-STRIPPING WITH DEFORMABLE ORGANISMS.

    Science.gov (United States)

    Prasad, Gautam; Joshi, Anand A; Thompson, Paul M; Toga, Arthur W; Shattuck, David W; Terzopoulos, Demetri

    2011-01-01

    Segmenting brain from non-brain tissue within magnetic resonance (MR) images of the human head, also known as skull-stripping, is a critical processing step in the analysis of neuroimaging data. Though many algorithms have been developed to address this problem, challenges remain. In this paper, we apply the "deformable organism" framework to the skull-stripping problem. Within this framework, deformable models are equipped with higher-level control mechanisms based on the principles of artificial life, including sensing, reactive behavior, knowledge representation, and proactive planning. Our new deformable organisms are governed by a high-level plan aimed at the fully-automated segmentation of various parts of the head in MR imagery, and they are able to cooperate in computing a robust and accurate segmentation. We applied our segmentation approach to a test set of human MRI data using manual delineations of the data as a reference "gold standard." We compare these results with results from three widely used methods using set-similarity metrics.

  11. Stream Surface Strip Element Method and Simulation of Three-Dimensional Deformation of Continuous Hot Rolled Strip

    Institute of Scientific and Technical Information of China (English)

    LIU Hong-min; WANG Ying-rui

    2004-01-01

    A new method, the stream surface strip element method, for simulating the three-dimensional deformation of plate and strip rolling process was proposed. The rolling deformation zone was divided into a number of stream surface (curved surface) strip elements along metal flow traces, and the stream surface strip elements were mapped into the corresponding plane strip elements for analysis and computation. The longitudinal distributions of the lateral displacement and the altitudinal displacement of metal were respectively constructed to be a quartic curve and a quadratic curve, of which the lateral distributions were expressed as the third-power spline function, and the altitudinal distributions were fitted in the quadratic curve. From the flow theory of plastic mechanics, the mathematical models of the three-dimensional deformations and stresses of the deformation zone were constructed. Compared with the streamline strip element method proposed by the first author of this paper, the stream surface strip element method takes into account the uneven distributions of stresses and deformations along altitudinal direction, and realizes the precise three-dimensional analysis and computation. The simulation example of continuous hot rolled strip indicates that the method and the model accord with facts and provide a new reliable engineering-computation method for the three-dimensional mechanics simulation of plate and strip rolling process.

  12. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  13. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    SERVER

    2006-02-16

    Feb 16, 2006 ... Key words: Rhodotorula glutinis, Escherichia coli, Melanin, Insecticidal Protein. INTRODUCTION ... proteinaceous crystals toxic to different insect larvae (Bulla ..... Gulex univitattus, Aedes aegypti and Culex pipens. Mosq.

  14. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing.

  15. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  16. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    ACSS

    Chemicals and rates used on snap beans in Mwea, Kenya. Trade name ... Source: Product labels ..... 1,400.6. *The cost of sprays includes cost of purchasing insecticide and labour for spraying ... chemistries and other consumer preferred.

  17. High insecticidal activity of Leclercia adecarboxylata isolated from ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-15

    Dec 15, 2009 ... bacterial flora of CPB, and tested them for insecticidal effects on it. The highest ... Genetically engineered resistant varieties containing toxin genes from ... certain proteins for interfering with the evolution of taxa through billions ...

  18. Fungal infection counters insecticide resistance in African malaria mosquitoes

    NARCIS (Netherlands)

    Farenhorst, M.; Mouatcho, J.C.; Kikankie, C.K.; Brooke, B.D.; Hunt, R.H.; Thomas, M.B.; Koekemoer, L.L.; Knols, B.G.J.; Coetzee, M.

    2009-01-01

    The evolution of insecticide resistance in mosquitoes is threatening the effectiveness and sustainability of malaria control programs in various parts of the world. Through their unique mode of action, entomopathogenic fungi provide promising alternatives to chemical control. However, potential

  19. Bio-evaluation of South African plants for insecticidal properties

    CSIR Research Space (South Africa)

    Maharaj, R

    2006-02-01

    Full Text Available Malaria is a serious health problem in South Africa affecting the lives of approximately 4 million people. Resistance to the principal vector, Anopheles arabiensis, has initiated a search for new plant-derived insecticides. Plants were selected...

  20. Fungal infection counters insecticide resistance in African malaria mosquitoes

    NARCIS (Netherlands)

    Farenhorst, M.; Mouatcho, J.C.; Kikankie, C.K.; Brooke, B.D.; Hunt, R.H.; Thomas, M.B.; Koekemoer, L.L.; Knols, B.G.J.; Coetzee, M.

    2009-01-01

    The evolution of insecticide resistance in mosquitoes is threatening the effectiveness and sustainability of malaria control programs in various parts of the world. Through their unique mode of action, entomopathogenic fungi provide promising alternatives to chemical control. However, potential inte

  1. Effect of insecticide application on pests of late maturing pigeonpea ...

    African Journals Online (AJOL)

    Effect of insecticide application on pests of late maturing pigeonpea cultivar ... University of Nigeria, Nsukka agro-ecological zone in 2000/2001 cropping season. ... control of pigoenpea pests under the integrated management concept.

  2. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  3. Design, synthesis and insecticidal activity of novel phenylurea derivatives.

    Science.gov (United States)

    Sun, Jialong; Zhou, Yuanming

    2015-03-19

    A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  4. Misrepresentation of vital status follow-up: challenging the integrity of the PLATO trial and the claimed mortality benefit of ticagrelor versus clopidogrel.

    Science.gov (United States)

    DiNicolantonio, James J; Tomek, Ales

    2013-10-30

    Ticagrelor, a novel, reversible, and oral P2Y12 receptor antagonist, was claimed to reduce all-cause mortality compared to clopidogrel in the PLATO trial. We sought to ascertain vital status follow-up for clopidogrel and ticagrelor to determine if any discrepancy existed by reviewing data from the FDA Complete Response Review. The FDA Complete Response Review indicated misrepresentation of vital status follow-up by the sponsor's presenter at the Cardiovascular and Renal Drugs Advisory Committee. Instead of five patients with missing vital status follow-up, the FDA primary efficacy reviewer indicated that there was a minimum of 106 patients. Additionally and more concerning was the fact that significantly more patients on ticagrelor (3.1%, n = 289 patients) had incomplete vital status follow-up versus clopidogrel (2.6%, n = 242 patients, p = 0.04 for the difference). The Advisory Committee that voted in favor to approve ticagrelor was given misrepresented data, which may have affected the approval of ticagrelor. The fact that significantly more patients on ticagrelor had incomplete vital status follow-up versus clopidogrel challenges the claimed mortality benefit of ticagrelor and the approval of the PLATO trial. © 2013 Elsevier Ireland Ltd. All rights reserved.

  5. Proporción y autoría. Arte mueble paleolítico. Figuras de los Omóplatos de

    Directory of Open Access Journals (Sweden)

    José Antonio Fernández Lombera

    2003-01-01

    Full Text Available El trabajo se compone de las siguientes partes : a.- Realización de calcos con una gran objetividad gráfica de las figuras grabadas en los omóplatos de El Castillo, exhumados por OBERMAIER en sus campañas de 1911/12. b.- Diseño, validación y aplicación de un método para el cálculo de la proporción de una figura, independoentemente de cuál sea, enfrentándola a un arquetipo. c.- Aplicación de tal método, una vez validado, a las figuras de los omóplatos de El Castillo. d.- Análisis de la manera de hacer de cada uno de los autores de las figuras de El Castillo ; es a lo que llamamos autoría. e.- Obtención de un conjunto de conclusiones de tipo formal, artístico y paleoetnológico

  6. Comparative toxicities of organophosphate and pyrethroid insecticides to aquatic macroarthropods.

    Science.gov (United States)

    Halstead, Neal T; Civitello, David J; Rohr, Jason R

    2015-09-01

    As agricultural expansion and intensification increase to meet the growing global food demand, so too will insecticide use and thus the risk of non-target effects. Insecticide pollution poses a particular threat to aquatic macroarthropods, which play important functional roles in freshwater ecosystems. Thus, understanding the relative toxicities of insecticides to non-target functional groups is critical for predicting effects on ecosystem functions. We exposed two common macroarthropod predators, the crayfish Procambarus alleni and the water bug Belostoma flumineum, to three insecticides in each of two insecticide classes (three organophosphates: chlorpyrifos, malathion, and terbufos; and three pyrethroids: esfenvalerate, λ-cyhalothrin, and permethrin) to assess their toxicities. We generated 150 simulated environmental exposures using the US EPA Surface Water Contamination Calculator to determine the proportion of estimated peak environmental concentrations (EECs) that exceeded the US EPA level of concern (0.5×LC50) for non-endangered aquatic invertebrates. Organophosphate insecticides generated consistently low-risk exposure scenarios (EECs0.5×LC50) to P. alleni, but not to B. flumineum, where only λ-cyhalothrin produced consistently high-risk exposures. Survival analyses demonstrated that insecticide class accounted for 55.7% and 91.1% of explained variance in P. alleni and B. flumineum survival, respectively. Thus, risk to non-target organisms is well predicted by pesticide class. Identifying insecticides that pose low risk to aquatic macroarthropods might help meet increased demands for food while mitigating against potential negative effects on ecosystem functions. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Effects of Diamide Insecticides on Predators in Soybean.

    Science.gov (United States)

    Whalen, R A; Herbert, D A; Malone, S; Kuhar, T P; Brewster, C C; Reisig, D D

    2016-10-01

    Predatory arthropods can be important for preventing insect pests from reaching damaging levels in soybean. However, the predator community can be compromised when pest control strategies include the application of broad-spectrum insecticides. The use of selective insecticides such as diamides could conserve predators while still providing necessary pest control. We evaluated two selective diamide insecticides, chlorantraniliprole and flubendiamide, and a broad-spectrum insecticide, lambda-cyhalothrin in combination with chlorantraniliprole, for impact on predators in soybean. We applied insecticides to field plots and documented predator abundance prior to and up to 3 wk postapplication using sticky card, beat sheet, and sweep net sampling methods. In sweep net samples, total predator abundance in plots treated with the selective insecticides was not significantly different from untreated control plots. For beat sheet samples, there were no significant differences in the abundance of total predators on any day postapplication between the selective diamide insecticides or the untreated control, but abundance decreased after application of lambda-cyhalothrin + chlorantraniliprole and did not recover. For sticky cards, there were no differences in predator abundance among treatments on any day postapplication. Over all, results showed that there were no significant differences in the abundance of total predators, Anthocoridae, Araneae, or Geocoridae after application of flubendiamide or chlorantraniliprole compared with the untreated control for up to 3 wk after application. All insecticides significantly decreased populations of lepidopteran pests compared with the untreated control, but only lambda-cyhalothrin + chlorantraniliprole reduced predatory arthropod abundance. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  9. Impact of triazophos insecticide on paddy soil environment

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A laboratory incubation study was carried out to elucidate the dynamic response of insecticide (triazophos) on a paddy field soil health under controlled moisture (flooded soil) and temperature (25℃).The insecticide was applied at five levels that were 0.0 (control),0.5 field rate (FR),1.0 FR,5.0 FR,and 10.0 FR,where FR was 1500 ml/hm2,and the parameters were studied at 1,4,7,14,and 21days after treatments' addition.The electron transport system (ETS)/dehydrogenase activity exhibited a negative correlation with insecticide concentrations,and the activity affected adversely as the concentration increased.The higher doses of 5 and 10 field rates significantly reduced the ETS activity,while lower rates failed to produce any significant inhibiting effect against the control.The toxicity of insecticide decreased towards decreasing the ETS activity with the advancement of incubation period.The insecticide caused an improvement in the soil phenol content and it increased with increasing concentration of insecticide.The insecticide incorporation applied at various concentrations did not produce any significant change in soil protein content and it remained stable throughout the incubation period of 21 - days.The response of biomass phospholipid content was nearly similar to ETS activity.The phospholipid content was decreased with the addition of insecticide and the toxicity was in the order:10 FR (field rate) > 5 FR > 1.0 FR > 0.5 FR > control and it also decreased with incubation period.

  10. Profile of the population use of household insecticides against mosquitoes

    Directory of Open Access Journals (Sweden)

    Luzilene Barbosa Oliveira

    2015-11-01

    Full Text Available This study described the use of household insecticides in Picos (Piauí, Brazil, identify which are the most used types of insecticides and describes the incidence of poisoning and environmental awareness of the population. After home visits (n = 700, it was seen that the majority of respondents was represented by women (75%, with 31-55 years-old (49%, incomplete primary education (38.1% and income between 1-2 earnings (64%. Most homes have between 1-3 residents (48%, 85% of the persons use insecticides mainly chosen in TV and radio and only 54% of them read the label before employing the product. The most used form of presentation is the aerosol (70.7%. Majority (79% recognizes that insecticides are harmful to health, but 74% do not use any Personal Protective Equipment (PPE. Symptoms of toxicity were reported by 27% of people interviewed. Two women reported irritation, dizziness and respiratory problems and need for medical intervention and hospitalization. All interviewed discard the package as regular trash, since Picos does not has selective collection. In conclusion, most people use insecticides, know about the individual and collective risks to which they are exposed but do not use PPE, though they believe insecticides are toxic. It was noted that acquisition of knowledge does not necessarily result in behavioral changes, since learning does not translate into appropriate preventive attitudes and practices, emphasizing the requirement for awareness campaigns about toxicity and environmental risks, preparation of professionals and surveillance policy against indiscriminate sale.

  11. Using Luseweilei insecticide to control Dendrolimus superans T.

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Luseweilei is an easily-bursted microcapsule insecticide. A test of effectiveness of the insecticide to control the larvae of Dendrolimus superans T. was carried out in larch forest in Baoan Forest Farm of Nehe City, Heilongjiang Province, in April 2001. The solutions of different concentrations (1:150, 1:250, 1:350, and 1:450 Luseweilei : water) were sprayed on the larch trunk before the overwintering larvae climbing on trees and the spraying lengths (height) designed were 1.0, 2.5, and 3.5 m high from ground. The control result showed that spraying 150-, 250-, and 350-fold solutions of the insecticide all produced a good control result, with a mortality rate of 97%, but the 450-fold solution only produced 70% mortality. It is concluded that this insecticide can be used as a kind of good insecticide to control the overwintering larvae of D. superans in spring. Spraying 350-fold solution of easy-burst microcapsule insecticide and one meter spraying length are recommended for the future application..

  12. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  13. Design, synthesis and insecticidal evaluation of aryloxy dihalopropene derivatives.

    Science.gov (United States)

    Yang, Ji-Chun; Li, Miao; Wu, Qiao; Liu, Chang-Ling; Chang, Xiu-Hui

    2016-02-01

    Plutella xylostella (P. xylostella) is a highly migratory, cosmopolitan species and one of the most important pest of cruciferous crops worldwide. Pyridalyl as a novel class of insecticides has good efficacy against P. xylostella. On the basis of the commercial insecticide pyridalyl, a series of new aryloxy dihalopropene derivatives were designed and synthesized by using Intermediate Derivatization Methods. Their chemical structures were confirmed by (1)H NMR, high-resolution mass spectrum (HRMS), and single-crystal X-ray diffraction analysis. The insecticidal activities of the new compounds against P. xylostella were evaluated. The results of bioassays indicated that most of the compounds showed moderate to high activities at the tested concentration, especially compounds 10e and 10g displayed more than 75% insecticidal activity against P. xylostella at 6.25mg/L, while pyridalyl showed 50% insecticidal activity at the same concentration. The field trials result of the insecticidal activities showed that compound 10e as a 10% emulsifiable concentrate (EC) was effective in the control of P. xylostella at 75-150g a.i./ha, and the mortality of P. xylostella for treatment with compound 10e at 75g a.i./ha was equivalent to pyridalyl at 105g a.i./ha.

  14. Metal films with imprinted nanostructures by template stripping

    DEFF Research Database (Denmark)

    Eriksen, René Lynge; Pors, Anders; Dreier, Jes

    We present a novel template stripping procedure for fabricating metal films with imprinted nanostructures. The basic idea is to deposit a gold film onto a nano-structured substrate and subsequently strip the film from the substrate surface thereby revealing imprinted nanostructures in the film...... result is a thin gold film with imprinted nano-cavities....

  15. Modeling of Strip Heating Process in Vertical Continuous Annealing Furnace

    Institute of Scientific and Technical Information of China (English)

    WAN Fei; WANG Yong-qin; QIN Shu-ren

    2012-01-01

    The mechanism for heat transfer of radiation is usually adopted to heat strip in vertical continuous annealing furnace. The rate of heat transfer among strip and other objects can be hugely affected by the parameters of strip speed, geometry factors and radiating characteristic of surfaces of strip, radiating tubes and walls of furnace. A model including all parameters is proposed for calculating the heat transfer coefficient, predicting the strip tempera- ture and boundary temperature of strip through analyzing these parameters. The boundary temperature is a important datum and different from average arithmetic value of temperature of strip and temperature in furnace. Also, the model can be used to analyze the relation for temperature of strip and heat transfer coefficient, total heat transfer quantity and heating time. The model is built by using the radiating heat transfer rate, the Newtonrs law of cooling, and lumped system analysis. The results of calculation are compared to the data from production line. The comparisons indicate that the model can well predict the heating process. The model is already applied for process control in pro- duction line. Also, this research will provide a new method for analyzing the radiation heat transfer.

  16. A strip array for spoligotyping of Mycobacterium tuberculosis complex isolates.

    Science.gov (United States)

    Tu, Yiling; Zeng, Xiaohong; Li, Hui; Zheng, Rongrong; Xu, Ye; Li, Qingge

    2016-03-01

    A novel strip array was developed for a nine-spacer spoligotyping scheme of Mycobacterium tuberculosis complex (MTBC). The new method was evaluated using 211 MTBC isolates and the results were fully concordant with the traditional spoligotyping approach. The strip array proved to be rapid and convenient for spoligotyping of MTBC.

  17. Status Quo of China’s Aluminum Sheet & Strip Industry

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    <正>Aluminum sheet & strip products are one of the major product varieties in the aluminum processing industry, they also provide indis-pensable basic materials for the development of national economy. In recent years, driven by rapid economic growth, China’s investment in aluminum sheet & strip industry continued to

  18. Using Comic Strips as a Book Report Alternative

    Science.gov (United States)

    Reading Teacher, 2012

    2012-01-01

    Comic strips are great to share with parents, younger students, and peers. This article presents an activity where students use a six-paneled comic strip to summarize a story. This activity allows for multiple interpretations and enhances comprehension by drawing attention to story elements.

  19. Using Comic Strips as a Book Report Alternative

    Science.gov (United States)

    Reading Teacher, 2012

    2012-01-01

    Comic strips are great to share with parents, younger students, and peers. This article presents an activity where students use a six-paneled comic strip to summarize a story. This activity allows for multiple interpretations and enhances comprehension by drawing attention to story elements.

  20. Young tourists visiting strip clubs and paying for sex

    DEFF Research Database (Denmark)

    Hesse, Morten; Tutenges, Sébastien

    2011-01-01

    Little is known about young adults’ use of strip clubs and prostitution during their holidays abroad. This study examined this issue with a sample of 1125 Danish tourists between the ages of 16 and 34, and sought data about the frequency with which they paid for sex and attended strip clubs while...

  1. Fabrication of chitosan-magnetite nanocomposite strip for chromium removal

    Science.gov (United States)

    Sureshkumar, Vaishnavi; Kiruba Daniel, S. C. G.; Ruckmani, K.; Sivakumar, M.

    2016-02-01

    Environmental pollution caused by heavy metals is a serious threat. In the present work, removal of chromium was carried out using chitosan-magnetite nanocomposite strip. Magnetite nanoparticles (Fe3O4) were synthesized using chemical co-precipitation method at 80 °C. The nanoparticles were characterized using UV-visible spectroscopy, fourier transform infrared spectroscopy, X-ray diffraction spectrometer, atomic force microscope, dynamic light scattering and vibrating sample magnetometer, which confirm the size, shape, crystalline nature and magnetic behaviour of nanoparticles. Atomic force microscope revealed that the particle size was 15-30 nm and spherical in shape. The magnetite nanoparticles were mixed with chitosan solution to form hybrid nanocomposite. Chitosan strip was casted with and without nanoparticle. The affinity of hybrid nanocomposite for chromium was studied using K2Cr2O7 (potassium dichromate) solution as the heavy metal solution containing Cr(VI) ions. Adsorption tests were carried out using chitosan strip and hybrid nanocomposite strip at different time intervals. Amount of chromium adsorbed by chitosan strip and chitosan-magnetite nanocomposite strip from aqueous solution was evaluated using UV-visible spectroscopy. The results confirm that the heavy metal removal efficiency of chitosan-magnetite nanocomposite strip is 92.33 %, which is higher when compared to chitosan strip, which is 29.39 %.

  2. Determination of residual stresses in roll compacted titanium strips

    CSIR Research Space (South Africa)

    Mothosi, KL

    2017-01-01

    Full Text Available induced during roll compaction of titanium strips were measured for strips of different densities. The different densities were achieved by rolling two different particle size (100 and 325 mesh) titanium powders varying the roll gap (0.1, 0.3 and 0.5 mm...

  3. Tape Stripping Technique for Stratum Corneum Protein Analysis

    DEFF Research Database (Denmark)

    Clausen, Maja-Lisa; Slotved, H.-C.; Krogfelt, Karen Angeliki

    2016-01-01

    The aim of this study was to investigate the amount of protein in stratum corneum in atopic dermatitis (AD) patients and healthy controls, using tape stripping technique. Furthermore, to compare two different methods for protein assessment. Tape stripping was performed in AD patients and healthy ...

  4. Susceptibility of Cimex lectularius (Hemiptera: Cimicidae) to pyrethroid insecticides and to insecticidal dusts with or without pyrethroid insecticides.

    Science.gov (United States)

    Anderson, John F; Cowles, Richard S

    2012-10-01

    Relative increases of bed bug, Cimex lectularius L., populations are probably due in large measure to their resistance to pyrethroids, which have been used extensively against urban pests. A Connecticut population of bed bugs was assessed for sensitivity to pyrethroids and exposed to commonly-used commercial insecticides applied to various substrates on which the residues were allowed to age for 0-24 wk. Type I and type II pyrethroids differed in toxicity when applied at a high dosage (1 microg) per bed bug. Some type II pyrethroids (cyfluthrin, lambda-cyhalothrin, cis-cypermethrin, and deltamethrin) caused > 80% mortality, whereas exposure to type I pyrethroids caused 0.95) an exponential rise to a maximum model from which the survival half-life (S1/2) was calculated directly. Tempo Dust (Bayer Environmental Science, Montvale, NJ) killed bed bugs relatively quickly, as did Syloid 244 (Grace Davison, Columbia, MD) and Drione (Bayer Environmental Science, Montvale, NJ) on hardboard and mattress fabric substrates (S1/2 Companies, Waterbury, CT), displayed reduced residual toxicity as they aged; the mortality was < 50% on some substrates after 4 d. Desiccant dusts, with their physical mode of action and long residual activity, appear to be superior to sprayable pyrethroid products for killing bed bugs.

  5. Sublethal and transgenerational effects of insecticides in developing Trichogramma galloi (Hymenoptera: Trichogrammatidae) : toxicity of insecticides to Trichogramma galloi.

    Science.gov (United States)

    Costa, Mariana Abreu; Moscardini, Valéria Fonseca; da Costa Gontijo, Pablo; Carvalho, Geraldo Andrade; de Oliveira, Rodrigo Lopes; de Oliveira, Harley Nonato

    2014-10-01

    This study assessed the transgenerational effects of insecticides in developing Trichogramma galloi (Hymenoptera: Trichogrammatidae). Laboratory bioassays were performed in which five insecticides were sprayed on egg-larval, pre-pupal and pupal stages of the parasitoid. The interaction between insecticides and development stages of the parasitoid was not significant for the rate of F0 emergence. All insecticides significantly reduced the emergence of wasps, with the lowest emergence observed when they were applied to the pupal stage. For the sex ratio, only spinosad applied to the pre-pupal stage and triflumuron applied on the egg-larval and pre-pupal stages did not differ from the controls. Triflumuron applied to pre-pupae did not lead to any difference in the parasitism rate of the treated generation (F0) when compared to the control. There were no significant differences among survival curves for females of F0 when all insecticides were sprayed on the egg-larval stage. Both concentrations of lambda-cyhalothrin + thiamethoxam reduced female pre-pupal survival, and all treatments reduced female pupal survival. In addition, we observed a transgenerational effect of the insecticides on emergence and sex ratio of next generation (F1). Lambda-cyhalothrin + thiamethoxam (Min) applied to the pre-pupae and pupae, the maximum rate of the same insecticides applied to the egg-larvae and pre-pupae, and spinosad applied to pre-pupae all significantly reduced the adults emergence of T. galloi F1 generation. Only triflumuron did not alter the F1 sex ratio. These bioassays provide a basis for better understanding the effects of insecticide use on beneficial parasitoids.

  6. Aerial insecticide treatments for management of Dectes stem borer, Dectes texanus, in soybean.

    Science.gov (United States)

    Sloderbeck, P E; Buschman, L L

    2011-01-01

    The Dectes stem borer, Dectes texanus LeConte (Coleoptera: Cerambycidae), is an increasingly important pest of soybean and sunflower in central North America. Nine large-scale field trials were conducted over a 3-year period to determine if Dectes stem borer could be managed with insecticide treatments. Aerial applications of lambda on July 6, 12 and 15 were successful in significantly reducing adults, but applications on July 1, 20 and 24 were less successful. These data suggest that for central Kansas two aerial applications may be required to control Dectes stem borers in soybean. Based on our experience the first application should be made at the peak of adult flight about July 5(th) and the second application 10 days later. The local treatment schedule should be developed to follow the local Dectes stem borer adult emergence pattern. Treated aerial strips 59 m (195 ft) wide were not large enough to prevent reinfestation, but treated half-circles (24 ha or 60 acres) were successful in reducing in Dectes stem borer infestation of soybean. Sweep net samples of adults were not successful in identifying a treatment threshold, so treatment decisions will need to be based on field history of infestation. Further studies are needed to identify better sampling methods that can be used to establish treatment thresholds and to refine the best timing for treatments.

  7. Evaluation of anatomy comic strips for further production and applications.

    Science.gov (United States)

    Shin, Dong Sun; Kim, Dae Hyun; Park, Jin Seo; Jang, Hae Gwon; Chung, Min Suk

    2013-09-01

    The corresponding author of the study has been sketching comic strips to explain anatomy in a humorous manner. All the anatomy comic strips, including those in Korean (650 episodes) and English (451 episodes), can be viewed on the homepage (http://anatomy.co.kr). Such comic strips were created with the aim of assisting medical students. However, their impact was unknown, and therefore, we surveyed the students' responses. We noted that anatomy grades were better in the students who read the comic strips. The comics helped the trainees chat with individuals with and without a medical background. The authors also considered comments on the problems with the comic strips and attempted to find solutions. The episodes are being currently used and further produced for educational purposes. To support this effort, the readers' valuable opinions will be continuously collected and assessed.

  8. Evaluation of anatomy comic strips for further production and applications

    Science.gov (United States)

    Shin, Dong Sun; Kim, Dae Hyun; Park, Jin Seo; Jang, Hae Gwon

    2013-01-01

    The corresponding author of the study has been sketching comic strips to explain anatomy in a humorous manner. All the anatomy comic strips, including those in Korean (650 episodes) and English (451 episodes), can be viewed on the homepage (http://anatomy.co.kr). Such comic strips were created with the aim of assisting medical students. However, their impact was unknown, and therefore, we surveyed the students' responses. We noted that anatomy grades were better in the students who read the comic strips. The comics helped the trainees chat with individuals with and without a medical background. The authors also considered comments on the problems with the comic strips and attempted to find solutions. The episodes are being currently used and further produced for educational purposes. To support this effort, the readers' valuable opinions will be continuously collected and assessed. PMID:24179697

  9. Flux avalanches in Nb superconducting shifted strip arrays

    Science.gov (United States)

    Tsuchiya, Y.; Mawatari, Y.; Ibuka, J.; Tada, S.; Pyon, S.; Nagasawa, S.; Hidaka, M.; Maezawa, M.; Tamegai, T.

    2013-09-01

    Flux penetrations into three-dimensional Nb superconducting strip arrays, where two layers of strip arrays are stacked by shifting a half period, are studied using a magneto-optical imaging method. Flux avalanches are observed when the overlap between the top and bottom layers is large even if the width of each strip is well below the threshold value. In addition, anomalous linear avalanches perpendicular to the strip are observed in the shifted strip array when the overlap is very large and the thickness of the superconductor is greater than the penetration depth. We discuss possible origins for the flux avalanches, including linear ones, by considering flux penetration calculated by the Campbell method assuming the Bean model.

  10. Usage pattern, physical integrity & insecticidal efficacy of long-lasting insecticidal nets in Odisha State, India

    Directory of Open Access Journals (Sweden)

    S S Anuse

    2015-01-01

    Full Text Available Background & objectives: One of the major strategies being pursued for malaria control by the National Vector Borne Disease Control Programme is the distribution of long lasting insecticidal nets (LLINs in endemic areas since 2009. Information on durability of insecticidal efficacy and physical integrity of LLINs and community usage at different time intervals of their use is essential to plan net replacements to maintain universal coverage for an effective and sustainable malaria control strategy. Therefore, a study was undertaken to assess these parameters in two malaria endemic districts of the Odisha State. Methods: A total of 309 households were selected in 15 villages of two community health centres (CHCs (Borigumma and Laxmipur from Koraput district and one (Khairput from Malkangiri district. Data on net usage were collected during March to July 2014 using semi-structured questionnaires. PermaNet 2.0 were sampled from all households, replaced with new ones, and bioassays were carried out to determine the insecticidal efficacy of LLINs after four and half, four and two years of field use following the standard procedure of World Health Organization. Results: LLIN use rate varied from 57.9 to 90.2 per cent in the study CHCs. The annual washing rate per net in Borigumma, Khairput and Laxmipur was 6.6, 3.2 and 4.8, respectively. The LLINs used two years in the field caused 100 per cent mortality and four to four and half years caused below 80 per cent mortality, except one net. Interpretation & conclusions: Nearly 20 per cent of the people were out of net coverage and hence the Programme to ensure 100 per cent coverage. The community should adequately be educated so as to increase the net use rate and avoid incorrect washing practices.

  11. Nonlinear optical model for strip plasmonic waveguides

    DEFF Research Database (Denmark)

    Lysenko, Oleg; Bache, Morten; Lavrinenko, Andrei

    2016-01-01

    This paper presents a theoretical model of nonlinear optical properties for strip plasmonic waveguides. The particular waveguides geometry that we investigate contains a gold core, adhesion layers, and silicon dioxide cladding. It is shown that the third-order susceptibility of the gold core...... significantly depends on the layer thickness and has the dominant contribution to the effective third-order susceptibility of the long-range plasmon polariton mode. This results in two nonlinear optical effects in plasmonic waveguides, which we experimentally observed and reported in [Opt. Lett. 41, 317 (2016......)]. The first effect is the nonlinear power saturation of the plasmonic mode, and the second effect is the spectral broadening of the plasmonic mode. Both nonlinear plasmonic effects can be used for practical applications and their appropriate model will be important for further developments in communication...

  12. Synchronization of the CMS Cathode Strip Chambers

    CERN Document Server

    Raknessa, G; Wang, D

    2007-01-01

    The synchronization of the trigger and data acquisition systems for the Cathode Strip Chambers (CSCs) in the Compact Muon Solenoid (CMS) detector at CERN is described. The CSC trigger system is designed to trigger CMS on muons with high efficiency (~99% per chamber) and is able to accurately identify its 25ns proton bunch crossing. To date, asynchronous cosmic ray data have been used to define the protocol and to refine timing algorithms, allowing synchronization to be realized within and between chambers to within ±10 ns. Final synchronization of the CSCs requires timing parameters to be accurate to 2 ns. This goal will be readily achieved from the cosmic ray baseline using data taken with the synchronous beam structure of the Large Hadron Collider.

  13. Digital autoradiography using silicon strip detectors

    Energy Technology Data Exchange (ETDEWEB)

    Overdick, M.

    1998-05-01

    Spatially resolving radiation detection systems operating in real time can be used to acquire autoradiographic images. An overview over alternatives to traditional autoradiography is given and the special features of these filmless methods are discussed. On this basis the design of a system for digital autoradiography using silicon strip detectors is presented. Special emphasis is put on the physical background of the detection process in the semiconductor and on the self-triggering read-out technique. The practical performance of the system is analyzed with respect to energy and spatial resolution. This analysis is complemented by case studies from cell biology (especially electrophoresis), botany and mineralogy. Also the results from a time-resolved autoradiographic experiment are presented. (orig.) 80 refs.

  14. [Obstetrical handbook in comic strip form].

    Science.gov (United States)

    1998-04-01

    An obstetric handbook was created in comic strip form in cooperation with the Ministry of Health in the region of Segou, Mali, for training of traditional midwives living far from community health centers. The drawings illustrate pregnancies at risk that the midwife should be able to identify in order to advise women to stay near the health facility before onset of labor. Drawings indicate pregnancies that are at risk because of the following: small stature, limping as a result of polio or sciatic paralysis, high parity, prior cesarean delivery, heart disease, overly large uterus, or prior stillbirth. Serious complications requiring referral to a health service are also illustrated and include severe anemia, genital bleeding, and signs of toxemia and edema. The midwife should accompany the woman during transport.

  15. Determination of chitosan by cathodic stripping voltammetry.

    Science.gov (United States)

    Lu, Guanghan; Wang, Lirong; Wang, Ruixia; Zeng, Yan; Huang, Xi

    2006-04-01

    A sensitive method for the determination of chitosan (CTS) by cathodic stripping voltammetry is presented. The method exploits a pair of oxidation-reduction peaks of CTS at -0.62 V (vs. SCE) and -0.54 V (vs. SCE), and an enhancement of the peak current of CTS observed in a 0.05 mol l(-1) potassium hydrogenphthalate buffer solution (pH 2.5). The peak current is linear with the concentration of CTS from 5.0 x 10(-7) to 1.5 x 10(-5) g ml(-1), and the detection limit is 1.0 x 10(-7) g ml(-1). We studied the characteristics and the mechanism of the electrode reaction, which proved that this process was diffusion controlled. This method was applied to determine the content of CTS in real samples with satisfactory results.

  16. Optical fiber cable chemical stripping fixture

    Science.gov (United States)

    Kolasinski, John R. (Inventor); Coleman, Alexander M. (Inventor)

    1995-01-01

    An elongated fixture handle member is connected to a fixture body member with both members having interconnecting longitudinal central axial bores for the passage of an optical cable therethrough. The axial bore of the fixture body member, however, terminates in a shoulder stop for the outer end of a jacket of the optical cable covering both an optical fiber and a coating therefor, with an axial bore of reduced diameter continuing from the shoulder stop forward for a predetermined desired length to the outer end of the fixture body member. A subsequent insertion of the fixture body member including the above optical fiber elements into a chemical stripping solution results in a softening of the exposed external coating thereat which permits easy removal thereof from the optical fiber while leaving a desired length coated fiber intact within the fixture body member.

  17. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  18. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  19. Streptococcus pneumoniae carriage in the Gaza strip.

    Directory of Open Access Journals (Sweden)

    Gili Regev-Yochay

    Full Text Available BACKGROUND: Pneumococcal infections cause major morbidity and mortality in developing countries. We report the epidemiology of S. pneumoniae carriage in a developing region, the Gaza strip, and evaluate the theoretical coverage of carriage strains by pneumococcal conjugate vaccines (PCVs. METHODOLOGY: In 2009 we conducted a cross-sectional survey of S. pneumoniae carriage in healthy children and their parents, living throughout the Gaza strip. Data were collected and nasopharyngeal swabs were obtained. Antibiotic susceptibilities were determined by Vitek-2 and serotypes by the Quellung reaction. PRINCIPAL FINDINGS: S. pneumoniae carriage was detected in 189/379 (50% of children and 30/376 (8% of parents. Carriage prevalence was highest in children <6 months of age (63%. Significant predictors for child carriage were number of household members and DCC attendance. The proportion of pediatric and adults isolates with serotypes included in PCV7 were 32% and 20% respectively, and 46% and 33% in PCV13 respectively. The most prominent non-vaccine serotypes (NVT were 35B, 15B/C and 23B. Penicillin-nonsusceptible strains were carried by 70% of carriers, penicillin-resistant strains (PRSP by 13% and Multi-drug-resistant (MDR by 30%. Of all PRSP isolates 54% belonged to serotypes included in PCV7 and 71% in the PCV13. Similarly, 59% and 73% of MDR-SP isolates, would theoretically be covered by PCV7 and PCV13, respectively. CONCLUSIONS: This study demonstrates that, PCV13-included strains were carried by 46% and 33% of pediatric and adult subjects respectively. In the absence of definitive data regarding the virulence of the NVT strains, it is difficult to predict the effect of PCVs on IPD in this region.

  20. Neonicotinoid-contaminated pollinator strips adjacent to cropland reduce honey bee nutritional status.

    Science.gov (United States)

    Mogren, Christina L; Lundgren, Jonathan G

    2016-07-14

    Worldwide pollinator declines are attributed to a number of factors, including pesticide exposures. Neonicotinoid insecticides specifically have been detected in surface waters, non-target vegetation, and bee products, but the risks posed by environmental exposures are still not well understood. Pollinator strips were tested for clothianidin contamination in plant tissues, and the risks to honey bees assessed. An enzyme-linked immunosorbent assay (ELISA) quantified clothianidin in leaf, nectar, honey, and bee bread at organic and seed-treated farms. Total glycogen, lipids, and protein from honey bee workers were quantified. The proportion of plants testing positive for clothianidin were the same between treatments. Leaf tissue and honey had similar concentrations of clothianidin between organic and seed-treated farms. Honey (mean±SE: 6.61 ± 0.88 ppb clothianidin per hive) had seven times greater concentrations than nectar collected by bees (0.94 ± 0.09 ppb). Bee bread collected from organic sites (25.8 ± 3.0 ppb) had significantly less clothianidin than those at seed treated locations (41.6 ± 2.9 ppb). Increasing concentrations of clothianidin in bee bread were correlated with decreased glycogen, lipid, and protein in workers. This study shows that small, isolated areas set aside for conservation do not provide spatial or temporal relief from neonicotinoid exposures in agricultural regions where their use is largely prophylactic.

  1. Application of WLS strips for position determination in Strip PET tomograph based on plastic scintillators

    CERN Document Server

    Smyrski, J; Bednarski, T; Białas, P; Czerwiński, E; Kapłon, Ł; Kochanowski, A; Korcyl, G; Kowal, J; Kowalski, P; Kozik, T; Krzemień, W; Molenda, M; Niedźwiecki, Sz; Pałka, M; Pawlik, M; Raczyński, L; Rudy, Z; Salabura, P; Sharma, N G; Silarski, M; Słomski, A; Strzelecki, A; Wiślicki, W; Zieliński, M; Zoń, N

    2013-01-01

    A method of determination of a gamma quantum absorption point in a plastic scintillator block using a matrix of wavelength-shifting (WLS) strips is proposed. Application of this method for improvement of position resolution in newly proposed PET detectors based on plastic scintillators is presented. The method enables to reduce parallax errors in reconstruction of images which occurs in the presently used Positron Emission Tomography scanners.

  2. Tolerance to the carbamate insecticide propoxur.

    Science.gov (United States)

    Costa, L G; Hand, H; Schwab, B W; Murphy, S D

    1981-01-01

    Male mice were given the carbamate insecticide propoxur (2-isopropoxy phenyl methylcarbamate; Baygon) in the drinking water at weekly increasing concentrations (from 50 to 2000 ppm), for a period of 6 weeks. At the end of the treatment the LD50 for propoxur was significantly higher in the treated animals as compared with controls. Propoxur-treated animals were also resistant to the hypothermic effect of an acute administration of the same compound. Groups of mice were challenged with the cholinergic agonist carbachol at intervals during the drinking water dosing and at its end. No differences in sensitivity to carbachol acute toxicity were found between control and treated animals. Propoxur-tolerant animals were also not resistant to the hypothermic effect of oxotremorine, another cholinergic agonist. [3H]Quinuclidinyl benzilate ([3H]QNB) binding (a measure of muscarinic receptor density and affinity) in forebrain, hindbrain and ileum never differed in control and treated mice. The possibility that repeated administrations of propoxur induced increased metabolic inactivation was tested by measuring hexobarbital sleeping time and carboxylesterase activity in treated and control mice. No changes in tissue carboxylesterase activities occurred but hexobarbital sleeping time was significantly reduced in propoxur treated animals suggesting an induction of hepatic microsomal enzymes. These results suggest that tolerance to propoxur is not mediated by a decrease of cholinergic receptors, as reported for other acetylcholinesterase inhibitors, but possibly by an enhancement of its metabolism.

  3. Mutagenic and cytotoxic activities of benfuracarb insecticide.

    Science.gov (United States)

    Eren, Yasin; Erdoğmuş, Sevim Feyza; Akyıl, Dilek; Özkara, Arzu

    2016-08-01

    Benfuracarb is a carbamate insecticide used to control insect pests in vegetables and it has anti-acetylcholinesterase activity lower than other carbamates. Cytotoxic effects of benfuracarb were evaluated by using root growth inhibition (EC50), mitotic index (MI), and mitotic phase determinations on the root meristem cells of Allium cepa and mutagenic effects were determined in Salmonella typhymurium Ames test by TA98 and TA100 strains with and without metabolic activation. In Allium test, 1 % DMSO was used as negative control group and 10 ppm MMS was used as positive control group. 75 ppm concentration of benfuracarb was found as EC50. In MI and mitotic phases determination study, 37.5, 75 and 150 ppm doses of benfuracarb were used. Dose-dependent cytotoxic activity was found by root growth inhibition and MI studies. It was identified that mitotic inhibition activity of benfuracarb was higher than 10 ppm MMS. In Ames test, mutagenic activity was not observed and over 200 µg/plate of benfuracarb was determined as cytotoxic to S. typhymurium strains. Benfuracarb can be called as "mitotic inhibitor" but not called as mutagen.

  4. Anaerobic microbial degradation of organochlorine insecticides Aldrin

    Energy Technology Data Exchange (ETDEWEB)

    Chiu, T.C.; Yen, J.H.; Wang, Y.S. [National Taiwan Univ. (Taiwan)

    2004-09-15

    Aldrin (1,2,3,4,10,10-hexachloro-1,4,4a,5,8,8a-hexahydro-1,4-endo-exo-5,8-dimethanonnaphthalene), a cyclodiene organochlorine insecticide, was banned by nations and classified as B2 carcinogen by United States Environmental Protection Agency (EPA). Because of its chemical stability and lipophilicity, aldrin is regarded as a persistent and recalcitrant compound. Aldrin is easily adsorbed to soil and sediment after spreading to the environments, furthermore, it may be accumulated in animal's tissue or milk and then cause adverse effects by food-chain. The dissipation process of aldrin in environments has continuously been paid much attention by researchers. In general, the dissipation of aldrin has been thought as relating to three mechanisms: photo-degradation, chemical hydrolysis, and microbial degradation. And it has been well known that microbial degradation is the most important agent for breakdown of organochlorine pesticides. There has been shown that aldrin could be transformed to its metabolites, such as dieldrin or photo-dieldrin, by microorganisms under aerobic conditions, however, limited information has been shown under anaerobic conditions. For this reason, the degradation potential of aldrin by anaerobic microorganisms obtained from indigenous river sediment was evaluated, and the effect of environmental factors such as temperatures and nutrients on the aldrin degradation was also investigated in this study.

  5. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  6. La cuadratura del plato

    Directory of Open Access Journals (Sweden)

    Ángeles Mora

    2012-06-01

    Full Text Available Una de las cosas que el Jurado del X Premio de Poesía Vicente Núñez destacó de este libro fue “su exquisito tratamiento del lenguaje”. Y desde luego lo es, es exquisito su tratamiento del lenguaje pero no porque utilice un lenguaje exquisito o excelso sino porque sabe arrancarle al lenguaje de todos los días, a las palabras sencillas, toda la carga poética de emoción e iluminación que llevan dentro. Mónica Doña nos dice que en su libro ha querido huir de un lirismo que muchas veces resulta falso, hueco, y nos habla de que lo que ha querido hacer es “épica cotidiana”, sin héroes, porque por su libro, como por la vida nuestra de todos los días, lo que circulan son seres que sobreviven como pueden en un mundo adverso.

  7. La cuadratura del plato

    OpenAIRE

    Ángeles Mora

    2012-01-01

    Una de las cosas que el Jurado del X Premio de Poesía Vicente Núñez destacó de este libro fue “su exquisito tratamiento del lenguaje”. Y desde luego lo es, es exquisito su tratamiento del lenguaje pero no porque utilice un lenguaje exquisito o excelso sino porque sabe arrancarle al lenguaje de todos los días, a las palabras sencillas, toda la carga poética de emoción e iluminación que llevan dentro. Mónica Doña nos dice que en su libro ha querido huir de un lirismo que muchas veces resulta fa...

  8. New Concept of Cultivation Using Limited Strip-Tillage with Strip Shallow Irrigation

    Directory of Open Access Journals (Sweden)

    Yazid Ismi Intara

    2014-04-01

    Full Text Available Normal 0 false false false IN X-NONE X-NONE Dry land is one of land resources which potentially used for food crop cultivation, especially in the areas which have light to medium technical obstacles. The development of technology to improve soil quality in marginal lands to be productive lands is still widely open for agricultural development in Indonesia. Rooting medium quality can be improved by changing soil tillage method and observing the proper crop irrigation technology. It can be the solution for crop cultivation in clay loam soil. This study aimed to obtain water movement model in a minimally-tilled clay soil with strip shallow irrigation. The concept is limited soil-tillage with strip shallow irrigation method, water supply technique, and crop water requirement. Method used in this study includes developing water movement model (software development in a minimally-tilled clay soil with subsurface irrigation. In the final stages, research also conducted water movement analysis testing apparatus in the laboratory, field validation of the subsurface irrigation performance, and cultivation technique testing to chili pepper growth (Capsicum annuumL.. The development of water movement simulation on a limited strip-tillage with subsurface irrigation uses the concept to quantify the amount of water in the soil. The analysis of movement pattern was demonstrated on contour patterns. It showed that the wetting process can reach depth zone – 5 cm to the rooting zone. It was an important discovery on the development of minimum stripe tillage soil with subsurface irrigation. Specifically, it can be concluded that: the result of fitting by eyes to diffusivity graphic and water content obtained the required parameter values for soil physical properties. It was then simulated on horizontal water movement model on a minimum strip-tillage with strip shallow irrigation /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso

  9. The water crisis in the gaza strip: prospects for resolution.

    Science.gov (United States)

    Weinthal, E; Vengosh, A; Marei, A; Kloppmann, W

    2005-01-01

    Israel and the Palestinian Authority share the southern Mediterranean coastal aquifer. Long-term overexploitation in the Gaza Strip has resulted in a decreasing water table, accompanied by the degradation of its water quality. Due to high levels of salinity and nitrate and boron pollution, most of the ground water is inadequate for both domestic and agricultural consumption. The rapid rate of population growth in the Gaza Strip and dependence upon ground water as a single water source present a serious challenge for future political stability and economic development. Here, we integrate the results of geochemical studies and numerical modeling to postulate different management scenarios for joint management between Israel and the Palestinian Authority. The chemical and isotopic data show that most of the salinity phenomena in the Gaza Strip are derived from the natural flow of saline ground water from Israel toward the Gaza Strip. As a result, the southern coastal aquifer does not resemble a classic "upstream-downstream" dispute because Israel's pumping of the saline ground water reduces the salinization rates of ground water in the Gaza Strip. Simulation of different pumping scenarios using a monolayer, hydrodynamic, two-dimensional model (MARTHE) confirms the hypothesis that increasing pumping along the Gaza Strip border combined with a moderate reduction of pumping within the Gaza Strip would improve ground water quality within the Gaza Strip. We find that pumping the saline ground water for a source of reverse-osmosis desalination and then supplying the desalinated water to the Gaza Strip should be an essential component of a future joint management strategy between Israel and the Palestinian Authority.

  10. A display model for the TOU of PLATO: just a cool toy or a benchmark of opportunities?

    Science.gov (United States)

    Dima, M.; Greggio, D.; Bergomi, M.; Biondi, F.; Farinato, J.; Farisato, G.; Magrin, D.; Lessio, L.; Marafatto, L.; Munari, M.; Pagano, I.; Ragazzoni, R.; Viotto, V.; Piazza, D.

    2016-07-01

    We produced a "toy-model" of one Telescope Optical Unit of PLATO, the Medium sized mission selected by ESA to fly in 2024. This is a six lenses dioptric very wide field camera with a window in front to take care of radiation impact on the first lens whose optical glass cannot be replaced with a radiation hardened one. The main aim of this project is just to produce a "cool" model for display purposes, in which one can "explore" the details of the inside through some openings in the tube, in order to visually inspect some of the fine details of the opto-mechanics. While its didactic and advertising role is out of doubt, during its construction we realized that some interesting outcome can be of some relevance for the project itself and that some findings could be useful, in order to assess the ability of producing with the same technology some (of course of much more modest quality) optical systems. In this context, we immediately dropped the option of producing the lenses with opaque material painted with a color resembling a refractive material (like blue for instance) and decided to actually produce them with transparent plastic. Furthermore the surfaces are then finely polished in order to give them basic optical properties. Such an optical system has only very coarsely the converging properties of the original nominal design for a number of reasons: the refractive indexes are not the nominal ones, the quality of the surfaces and their nominal values are only roughly, within a few percent, the targeted one, and the way the surfaces are built up makes them prone to some diffraction effects. However, the bulk of the lens and the surface roughness will give a large magnification of the scattering effects that will be experienced, at a much lower level, on the actual flight model. We investigated through propagation of a laser beam and by digital camera the main stray light modes that this toymodel offers. In other words, the model amplifies, to a large extent, the

  11. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  12. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management.

  13. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaV and KV channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  14. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives.

    Science.gov (United States)

    Nguyen, Binh Cao Quan; Chompoo, Jamnian; Tawata, Shinkichi

    2015-09-14

    Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol) from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively). Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b) showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively) with 50%-60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C₅-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  15. Water Modeling of Twin-Roll Strip Casting

    Institute of Scientific and Technical Information of China (English)

    WANG Bo; ZHANG Jie-yu; FAN Jun-fei; ZHAO Shun-li; FANG Yuan; AN Sheng-li

    2006-01-01

    Twin-roll strip casting is regarded as a prospective technology of near net shape continuous casting. The fluid flow field and level fluctuation in the pool have a strong influence not only on composition and temperature homogeneity of pool, but also on the strip quality. A 1∶1 water model of a twin-roll strip caster was set up based on the criteria of Froude number and Reynold number similarity. The level fluctuation was measured. The influence of pool depth, casting speed and feeding system configuration on level fluctuation in the pool was studied. The experimental results provided a basis for the optimization of feeding system and process parameters.

  16. Improvement of Prediction Method for Strip Coiling Temperature

    Institute of Scientific and Technical Information of China (English)

    YU Qing-bo; WANG Zhao-dong; WANG Zhe-ying; LIU Xiang-hua; WANG Guo-dong

    2003-01-01

    In order to improve the control precision of strip coiling temperature for hot strip mill, the BP neural network was combined with mathematical model to calculate convective heat-transfer coefficient of laminar flow cooling. The off-line calculated results indicate that the standard deviation of coiling temperature prediction is reduced by 22.84 % with the convective heat-transfer coefficient calculated by BP neural network. The prospects of this method for on-line application are bright. This method is more helpful to increasing the control precision of coiling temperature for hot strip steel.

  17. Roll caster for the three-layer clad-strip

    OpenAIRE

    Nakamura, R; T. Yamabayashi; T. Haga; S. Kumai; H. Watari

    2010-01-01

    Purpose: of this paper is to show the characteristics of two kinds of roll casters for three-layer clad strip of aluminium alloys. Moreover, the characteristics of these twin roll casters were compeered with the early type of roll casters for clad strip.Design/methodology/approach: Design was tried to attain the fabrication of the roll casters to cast the three-layers-clad-strip. One caster was an unequal diameter roll caster equipped with a scraper. The scraper was adopted to prevent the mix...

  18. Element Tracking Strategies for Hot Strip Laminar Cooling Control

    Institute of Scientific and Technical Information of China (English)

    HAN Bin; ZHANG Zhong-ping; LIU Xiang-hua; WANG Guo-dong

    2005-01-01

    Feedforward control is the core to control function in the cooling process of hot strip. One of the most important tasks in feedforward control is to determine the arrival time of the strip at various locations on the runout table for effective control. Based on the principles of element tracking and tracking strategies for variable rolling speed and constant rolling speed, a simple diagonal tracking method for an existing hot strip mill was proposed and tested. The test results show that the proposed strategies are effective for improving tracking control.

  19. New technology for the production of magnesium strips and sheets

    Directory of Open Access Journals (Sweden)

    R. Kawalla

    2008-07-01

    Full Text Available A new production technology for magnesium strip, based on twin-roll-casting and strip rolling was developed in Freiberg Germany. By means of this economic method it is possible to produce strips in deep drawing quality with good forming properties in order to satisfy the request for low cost Mg sheets in the automotive and electronic industry. Both, coils as single sheets, were manufactured and rolled to a thickness of 1mm(0,5 mm. The technology of the new process and the properties of the twin-roll-casted material and the final sheets are presented.

  20. RESISTANCE OF THE TOXAPHENE INSECTICIDE IN SOIL

    Directory of Open Access Journals (Sweden)

    G MIRSATTARI

    2001-06-01

    Full Text Available Introduction. Toxaphene is resistant to degration and has been known as persistent bioaccumulator. In oder to understand the persistence and degradation phenomena of toxaphene in soil a series of tests were run. Methods. All experiments for dry and moist soil were conducted with 10 to 20 kg soil samples, contained in plastic tubs. The experiment was carried out in two parts. The five samples studied in each part are described below. Part I: "Dry samples". Soil control I soil amended with 10 percent gin trash/soil amended with 25 percent gin trash/soil amended with 10 percent gin trash and treated with 500 ppm toxaphene and soil treated with 500 ppm toxaphene. These samples were kept dry during the entire experimental period. Part II: "Moist samples". The samples were the same as described in part I, but they were kept moist by addition of water weekly during the experimental period. Periodically twenty grams of soil were analyzed using a gas chromatograph. Results. Chromatograms of dry and moist samples from soil containers (Part I and II analyzed up to 12 months after initiation of the experiments showed that no toxaphene degradation or dissipation had occurred. GLC profiles of extracts of 12 months soil samples were identical to those of 0 dry samples and almost 100 percent of toxaphene was recovered in all samples after one year regardless of whether samples were dry or moist I amended or not. Discussion. The results suggest that toxaphene dose not undergo degradation in soil" under aerobic condition, so it can be a persistent insecticide in soil under environmental condition.

  1. 苏格拉底、柏拉图、亚里士多德与丑%Socrates,Plato and Aristotle's Views on Ugliness

    Institute of Scientific and Technical Information of China (English)

    区翰子; 李佳

    2014-01-01

    尽管从苏格拉底开始就萌生“丑”这个美学范畴,其在古代一直处于被忽视和非独立的地位。拟通过分析苏格拉底、柏拉图和亚里士多德三位巨匠的“丑”观,揭示“审丑”在萌芽时期的状态。%Despite its first faint showing started from Socrates , Ugliness had constantly been over-looked as a dependent aesthetic category in the ancient time .The following discussion will analyze the views of Socrates ,Plato and Aristotle on the appreciation of ugliness ,thus revealing the state of the appre-ciation of ugliness in its earlier stage .

  2. On Aesthetic Thoughts of Socrates, Plato and Aristotle%古希腊“三贤”美育思想概论

    Institute of Scientific and Technical Information of China (English)

    秦宾; 刘忠伟

    2011-01-01

    Based on analysis of aesthetic thoughts of Socrates, Plato and Aristotle, the famous philosophers in ancient Greek, this paper attempts to use their ideas for reference in guiding the cur- rent teaching practice to better aesthetic education.%通过对古希腊时期三位著名哲学家苏格拉底、柏拉图、亚里土多德美育思想的简要概括和论述,试图从他们对美育思想的主张中提取有益于符合我们现实国情的教育理念,对我们在教学实践中更好地实施美育教育提供可资借鉴的依据。

  3. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  4. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  5. Resistance to bio-insecticides or how to enhance their sustainability: a review

    Directory of Open Access Journals (Sweden)

    Myriam eSIEGWART

    2015-06-01

    Full Text Available After more than 70 years of chemical pesticide use, modern agriculture is increasingly using biological control products. Resistances to conventional insecticides are wide spread, while those to bio-insecticides have raised less attention, and resistance management is frequently neglected. However, a good knowledge of the limitations of a new technique often provides greater sustainability. In this review, we compile cases of resistance to widely used bio-insecticides and describe the associated resistance mechanisms. This overview shows that all widely used bio-insecticides ultimately select resistant individuals. For example, at least 27 species of insects have been described as resistant to Bacillus thuringiensis toxins. The resistance mechanisms are at least as diverse as those that are involved in resistance to chemical insecticides, some of them being common to bio-insecticides and chemical insecticides. This analysis highlights the specific properties of bio-insecticides that the scientific community should use to provide a better sustainability of these products.

  6. Resistance to bio-insecticides or how to enhance their sustainability: a review.

    Science.gov (United States)

    Siegwart, Myriam; Graillot, Benoit; Blachere Lopez, Christine; Besse, Samantha; Bardin, Marc; Nicot, Philippe C; Lopez-Ferber, Miguel

    2015-01-01

    After more than 70 years of chemical pesticide use, modern agriculture is increasingly using biological control products. Resistances to conventional insecticides are wide spread, while those to bio-insecticides have raised less attention, and resistance management is frequently neglected. However, a good knowledge of the limitations of a new technique often provides greater sustainability. In this review, we compile cases of resistance to widely used bio-insecticides and describe the associated resistance mechanisms. This overview shows that all widely used bio-insecticides ultimately select resistant individuals. For example, at least 27 species of insects have been described as resistant to Bacillus thuringiensis toxins. The resistance mechanisms are at least as diverse as those that are involved in resistance to chemical insecticides, some of them being common to bio-insecticides and chemical insecticides. This analysis highlights the specific properties of bio-insecticides that the scientific community should use to provide a better sustainability of these products.

  7. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  8. The Differences between Plato and Aristotle's Educational Philosophy%柏拉图与亚里士多德教育哲学的差异

    Institute of Scientific and Technical Information of China (English)

    刘良华

    2012-01-01

    古典西方教育哲学分为两个阵营:柏拉图以苏格拉底的名义组建他的“理想国”,按照“理论理性”设计他的“政治哲学”和教育方案;柏拉图坚持“哲人王”统治、公产制和道德教育。亚里士多德虽然坚持了哲学对政治的指导,但他看到了哲学对政治的危险,按照“实践理性”的优先性开创了不同于柏拉图的“政治哲学”的“政治科学”以及相关的教育方案。亚里士多德重视轮流制、私有制和法制教育。%The classical philosophy of education is divided into two camps. Plato built his Republic in the name of Socrates and designed the political philosophy and education plan with the theoretical reason. He adhered to the rule of the “philosophy king”, the communist membership system and moral education. Aristotle realized the danger of the philosophy to the politics, although he insisted in the guidance of philosophy to politics. He created the political science and education plan with the practical reason instead of Plato's political philosophy. He valued the political rule, the private ownership, and the legal education.

  9. Process Simulation Analysis of HF Stripping

    Directory of Open Access Journals (Sweden)

    Thaer A. Abdulla

    2013-05-01

    Full Text Available    HYSYS process simulator is used for the analysis of existing HF stripping column in LAB plant (Arab Detergent Company, Baiji-Iraq. Simulated column performance and profiles curves are constructed. The variables considered are the thermodynamic model option, bottom temperature, feed temperature, and column profiles for the temperature, vapor flow rate, liquid flow rate and composition. The five thermodynamic models options used (Margules, UNIQUAC, van laar, Antoine, and Zudkevitch-Joffee, affecting the results within (0.1-58% variation for the most cases.        The simulated results show that about 4% of paraffin (C10 & C11 presents at the top stream, which may cause a problem in the LAB production plant. The major variations were noticed for the total top vapor flow rate with bottom temperature and with feed composition. The column profiles maintain fairly constants from tray 5 to tray 18. The study gives evidence about a successful simulation with HYSYS because the results correspond with the real plant operation data.

  10. Profile of a science comic strip author

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    After studying visual arts, Lison Bernet worked as a lock keeper, waitress, grape picker, farm labourer and chef before finally returning to her first love: drawing. Today a scientific illustrator, Lison is the author of the cartoon strip "La BD du LHC", which she draws every month for LHC France (by CNRS/IN2P3 and CEA/Irfu, see here).   © Lison Bernet. Lison’s career path might seem somewhat chaotic, but it is a reflection of the artist herself: original and passionate. “I never do anything by half measures. When I got into cooking for example [Lison took a chef training course for adults], I became completely wrapped up in it. I even went as far as cooking roasts during my lunch hour, just for practice…” says Lison. On completing the course, Lison got a job as a chef on a canal boat. And it was then that she got the drawing bug again. “I started keeping an illustrated travel diary,” she says. &ldquo...

  11. Toxicity, synergism, and neurological effects of novel volatile insecticides in insecticide-susceptible and -resistant Drosophila strains.

    Science.gov (United States)

    Nguyen, Sam N; Song, Cheol; Scharf, Michael E

    2007-04-01

    Naturally derived volatile insecticides from the heterobicyclic and formate ester classes were investigated using a combination of volatility and synergist bioassays. In these studies, Drosophila melanogaster (Meigen) was used as a model for other medically important dipterans. In addition to a susceptible strain (Canton-S), three mutant strains were tested that included a strain resistant by P450-based metabolism (Hikone-R) and two resistant neurological mutant strains; one voltage-gated sodium channel mutant (para(ts-1)) and one GABA-gated chloride channel mutant (Rdl). In general, the 11 tested insecticides displayed a diversity of toxicity, metabolism, and resistance characteristics that correlate with their structural diversity. Several important trends were revealed by these studies, including hydrolase- and cytochrome P450 (P450)-based activation, P450-based resistance, distinct patterns of neurological activity, and negative cross-resistance with established insecticides. These findings provide important insight into the metabolism and modes of action for the volatile insecticides. These findings also suggest potential approaches for insecticide deployment in integrated vector management and resistance management programs.

  12. Modeling the integration of parasitoid, insecticide, and transgenic insecticidal crop for the long-term control of an insect pest.

    Science.gov (United States)

    Onstad, David W; Liu, Xiaoxia; Chen, Mao; Roush, Rick; Shelton, Anthony M

    2013-06-01

    The tools of insect pest management include host plant resistance, biological control, and insecticides and how they are integrated will influence the durability of each. We created a detailed model of the population dynamics and population genetics of the diamondback moth, Plutella xylostella L., and its parasitoid, Diadegma insulare (Cresson), to study long-term pest management in broccoli Brassica oleracea L. Given this pest's history of evolving resistance to various toxins, we also evaluated the evolution of resistance to transgenic insecticidal Bt broccoli (expressing Cry1Ac) and two types of insecticides. Simulations demonstrated that parasitism provided the most reliable, long-term control of P. xylostella populations. Use of Bt broccoli with a 10% insecticide-free refuge did not reduce the long-term contribution of parasitism to pest control. Small refuges within Bt broccoli fields can delay evolution of resistance > 30 generations if resistance alleles are rare in the pest population. However, the effectiveness of these refuges can be compromised by insecticide use. Rainfall mortality during the pest's egg and neonate stages significantly influences pest control but especially resistance management. Our model results support the idea that Bt crops and biological control can be integrated in integrated pest management and actually synergistically support each other. However, the planting and maintenance of toxin-free refuges are critical to this integration.

  13. Insecticide Resistance in the Western Flower Thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity......, and a haplodiploid breeding system. Although resistance in F. occidentalis is a common problem, the underlying mechanisms conferring resistance have only been studied on a few populations. A purpose of this study was to gain more knowledge about possible resistance mechanisms in F. occidentulis and, furthermore...

  14. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  15. Non-Oriented Fe-Si Thin Strip Produced from Grain Oriented Fe-Si Strip by CSR

    Institute of Scientific and Technical Information of China (English)

    YE He-zhou; QI Ke-min; GAO Xiu-hua; QIU Chun-lin; LIU En

    2004-01-01

    The grain oriented silicon strip was rolled by cross shear rolling (CSR) and then annealed to manufacture non-oriented thin silicon strip of high quality. The recrystallization of rolled grain-oriented silicon steel into non-oriented silicon steel was studied. For this purpose, CSR is better than conventional rolling, and the higher the mismatched speed rate is, the better the properties of the non-oriented thin silicon strip are. The optimum annealing schedule is heating at 1 000 ℃ for 1 h in pure hydrogen atmosphere added with H2S of 0.001 0 %.

  16. Chlorfenapyr: irritant effect compared to other insecticides and its intrinsic toxicity in multiple-insecticide-susceptible and -resistant Anopheles stephensi (Diptera: Culicidae).

    Science.gov (United States)

    Verma, Vaishali; Elamathi, N; Velamuri, Poonam S; Sreehari, U; Agrawal, O P; Raghavendra, K

    2015-03-01

    For effective management of vector resistance there is a need for new insecticide molecules with novel modes of action. For desired toxic effect of an insecticide, apart from other behavioural aspects, toxicity and chemical nature of the molecule are important that may cause irritability in the mosquito to the insecticide affecting the uptake. In this study, a pyrrole class insecticide, chlorfenapyr (a late acting insecticide) was tested for its irritability against multiple-insecticide-susceptible and -resistant strains of Anopheles stephensi Liston 1901 (Diptera: Culicidae). Studies were conducted to assess the irritability due to chlorfenapyr, DDT, malathion, deltamethrin and permethrin and intrinsic toxicity of chlorfenapyr in multiple-insecticide-susceptible and -resistant laboratory strains of An. stephensi following standard WHO methods. Chlorfenapyr molecule has shown least irritant effect against susceptible and resistant strains among all the insecticides tested allowing more landing time to the vector species on the impregnated surfaces to pick-up lethal dose. Chlorfenapyr could be an ideal insecticide for management of multiple-insecticide-resistance including pyrethroids.

  17. REVIEW ON THE EFFICACY OF INSECTICIDES AND BIO-INSECTICIDES (PATHOGEN AND IGR AGAINST VECTOR DISEASES EVALUATIONS CONDUCTED BY VRCRU (2001-2002

    Directory of Open Access Journals (Sweden)

    Damar Tri Boewono

    2012-11-01

    Full Text Available Vector and Reservoir Control Research Unit (VRCRU Salatiga, as WHO Collaborating Center for Pesticide Evaluation, has evaluate the efficacy of several new insecticides for various purposes especially for the registration in Indonesia Pesticide Commission. This unit has evaluated insecticides inc ollaboration with pesticide companies and WHO. The aim of the studies were to provide the efficacy and residual effect of insecticides against vector disease. Such as malaria, dengue haemorrhagic fever (DHF, filariasis, plague, diarrhea, etc. The studied insecticides in the unit were belong to Organophosphate, Carbamate and Synthetic Phyrethroid compounds and also bio-insecticides (pathogen & Insect Grow Regulator/IGR. Various insecticide applications were performed against the adult, e.g. residual spraying (IRS, thermal fogging, Ultra Low Volume (ULV, bed nets impregnation. The study was also conducted to evaluate the efficacy of insecticides, bio-insecticides (pathogen and IGR against mosquito larvae as well as insecticides against fleas and cockroaches. This paper is an overall review of the related studies which were conducted on 2001-2002. Keywords: efficacy, bio-insecticides, vector disease

  18. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  19. Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.

    Science.gov (United States)

    Mougabure-Cueto, Gastón; Picollo, María Inés

    2015-09-01

    Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid

  20. Insecticide resistance status in Anopheles gambiae in southern Benin

    Directory of Open Access Journals (Sweden)

    Corbel Vincent

    2010-03-01

    Full Text Available Abstract Background The emergence of pyrethroid resistance in Anopheles gambiae has become a serious concern to the future success of malaria control. In Benin, the National Malaria Control Programme has recently planned to scaling up long-lasting insecticidal nets (LLINs and indoor residual spraying (IRS for malaria prevention. It is, therefore, crucial to monitor the level and type of insecticide resistance in An. gambiae, particularly in southern Benin where reduced efficacy of insecticide-treated nets (ITNs and IRS has previously been reported. Methods The protocol was based on mosquito collection during both dry and rainy seasons across forty districts selected in southern Benin. Bioassay were performed on adults collected from the field to assess the susceptibility of malaria vectors to insecticide-impregnated papers (permethrin 0.75%, delthamethrin 0.05%, DDT 4%, and bendiocarb 0.1% following WHOPES guidelines. The species within An. gambiae complex, molecular form and presence of kdr and ace-1 mutations were determined by PCR. Results Strong resistance to permethrin and DDT was found in An. gambiae populations from southern Benin, except in Aglangandan where mosquitoes were fully susceptible (mortality 100% to all insecticides tested. PCR showed the presence of two sub-species of An. gambiae, namely An. gambiae s.s, and Anopheles melas, with a predominance for An. gambiae s.s (98%. The molecular M form of An. gambiae was predominant in southern Benin (97%. The kdr mutation was detected in all districts at various frequency (1% to 95% whereas the Ace-1 mutation was found at a very low frequency (≤ 5%. Conclusion This study showed a widespread resistance to permethrin in An. gambiae populations from southern Benin, with a significant increase of kdr frequency compared to what was observed previously in Benin. The low frequency of Ace-1 recorded in all populations is encouraging for the use of bendiocarb as an alternative insecticide to

  1. Novel AChE inhibitors for sustainable insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Haoues Alout

    Full Text Available Resistance to insecticides has become a critical issue in pest management and it is particularly chronic in the control of human disease vectors. The gravity of this situation is being exacerbated since there has not been a new insecticide class produced for over twenty years. Reasoned strategies have been developed to limit resistance spread but have proven difficult to implement in the field. Here we propose a new conceptual strategy based on inhibitors that preferentially target mosquitoes already resistant to a currently used insecticide. Application of such inhibitors in rotation with the insecticide against which resistance has been selected initially is expected to restore vector control efficacy and reduce the odds of neo-resistance. We validated this strategy by screening for inhibitors of the G119S mutated acetylcholinesterase-1 (AChE1, which mediates insensitivity to the widely used organophosphates (OP and carbamates (CX insecticides. PyrimidineTrione Furan-substituted (PTF compounds came out as best hits, acting biochemically as reversible and competitive inhibitors of mosquito AChE1 and preferentially inhibiting the mutated form, insensitive to OP and CX. PTF application in bioassays preferentially killed OP-resistant Culex pipiens and Anopheles gambiae larvae as a consequence of AChE1 inhibition. Modeling the evolution of frequencies of wild type and OP-insensitive AChE1 alleles in PTF-treated populations using the selectivity parameters estimated from bioassays predicts a rapid rise in the wild type allele frequency. This study identifies the first compound class that preferentially targets OP-resistant mosquitoes, thus restoring OP-susceptibility, which validates a new prospect of sustainable insecticide resistance management.

  2. Stability of flow over axisymmetric bodies with porous suction strips

    Science.gov (United States)

    Nayfeh, A. H.; Reed, H. L.

    1982-01-01

    Linear triple deck, closed form solutions for mean-flow quantities are developed for axisymmetric incompressible flow past a body with porous strips. The solutions account for upstream influence and are linear superpositions of the flow past the body without suction plus the perturbations due to the suction strips. Flow past the suctionless body is calculated using the Transition Analysis Program System, and a simple linear optimization scheme to determine number, spacing, and mass flow rate through the strips on an axisymmetric body is developed using the linear, triple-deck, closed-form solutions. The theory is demonstrated by predicting optimal strip distributions, and the effect of various adverse pressure-gradient situations on stability is studied.

  3. SIMULATION OF THE TWIN ROLL STAINLESS STRIP CASTING PROCESS

    Institute of Scientific and Technical Information of China (English)

    Y.C. Miao; X.M. Zhang; G.D. Wang; H.S. Di; X.H. Liu

    2001-01-01

    The position of the solidification completed temperature of twin roll stainless strip casting process is very important to the quality of the casting strip. In order to control this position, the solidification completed temperature should be known at first.The present paper first simulated dendritic microsegregation under conditions of twin roll stainless strip casting, and got the relationship between the temperature and solid fraction of the mush zone. The temperatures such as ZDT (equal to the solidification completed temperature) and LIT (liquid impenetrable temperature), et al., also were obtained. Then by using the turbulent model, the flow and thermal fields of the pool of the twin roll stainless strip casting, and the speed and temperature fields of different casting speeds were given and also explained. The results are coincident with the experimental result. Combined with the results of these two simulations. the appropriated casting speed was found.

  4. Flow and heat transfer in compact offset strip fin surfaces

    Institute of Scientific and Technical Information of China (English)

    Junqi DONG; Jiangping CHEN; Zhijiu CHEN

    2008-01-01

    Experimental studies of air-side heat transfer and pressure drop characteristics of offset strip fins and flat tube heat exchangers were performed. A series of tests were conducted for 9 heat exchangers with different fin space, fin height, fin strip length and flow length, at a constant tube-side water flow rate of 2.5 m3/h. The char-acteristics of the heat transfer and pressure drop of differ-ent fin space, fin height and fin length were analyzed and compared. The curves of the heat transfer coefficients vs. The pumping power per unit frontal area were then plot-ted. Moreover, the enhanced heat transfer mechanism of offset strip fins was analyzed using field synergy theory. The results showed that fin length and flow length have more obviously effect on the thermal hydraulic character-istics of offset strip fins.

  5. Feasibility and energetic evaluation of air stripping for bioethanol production.

    Science.gov (United States)

    Schläfle, Sandra; Senn, Thomas; Gschwind, Peter; Kohlus, Reinhard

    2017-05-01

    Stripping of mashes with air as stripping gas and low ethanol contents between 3 and 5wt% was investigated in terms of its suitability for continuous bioethanol production. Experiments in a Blenke cascade system were carried out and the results were compared with values obtained from theoretical vapour-liquid-equilibrium calculations. The whole stripping process was energetically evaluated by a simulation in ChemCAD and compared to conventional distillation. Therefore several parameters such as temperature, air volume flow and initial ethanol load of the mash were varied. Air stripping was found to be a suitable separation method for bioethanol from mashes with low concentrations. However, energetic aspects have to be considered, when developing a new process.

  6. Diagnosis of Spontaneous Bacterial Peritonitis in Children by Reagent Strips

    Directory of Open Access Journals (Sweden)

    Fatemeh Farahmand

    2013-02-01

    Full Text Available This study was aimed to evaluate the efficacy of dipstick tests (leukocyte esterase and nitrite in diagnosis of spontaneous bacterial peritonitis (SBP in cirrhotic patients. Forty six children with ascites hospitalized between 2009 and 2010 in Children Medical Center were enrolled in this study. Reagent strip assays for leukocyte esterase and nitrite were performed on ascetic fluid and the results were compared to manual cell counting and ascitic fluid culture. SBP was defined as having a polymorphonuclear ascites count of ≥ 250/mm3. Twenty children were female and twenty six were male with mean age of 3±3.9 years. The sensitivity specificity, positive and negative predictive values of the leukocyte esterase reagent strips were all 100%. The sensitivity, specificity, positive and negative predictive value of the nitrite reagent strip test were 100%, 97%, 90% and 100% respectively. Leukocyte esterase reagent strips may provide a rapid, bedside diagnostic test for the diagnosis of SBP.

  7. Results of Laboratory Testing of Advanced Power Strips: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Earle, L.; Sparn, B.

    2012-08-01

    This paper describes the results of a laboratory investigation to evaluate the technical performance of advanced power strip (APS) devices when subjected to a range of home entertainment center and home office usage scenarios.

  8. Slow-plasmon resonant nano-strip antennas

    DEFF Research Database (Denmark)

    Søndergaard, Thomas; Beermann, Jonas; Boltasseva, Alexandra

    2008-01-01

    Resonant scattering by gold nanostrip antennas due to constructive interference of counterpropagating slow surface plasmon polaritons SPPs is analyzed, including the quasistatic limit of ultrasmall antennas, and experimentally demonstrated. The phase of slow SPP reflection by strip ends is found...

  9. Nanoscale Test Strips for Multiplexed Blood Analysis Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of our nanoscale test strips, or nanostrips, is to provide rapid, low-cost, powerful multiplexed analyses in a diminutive form so that whole body health...

  10. Installation of some Cathode Strip Chambers on March 2004

    CERN Multimedia

    Richard Breedon

    2004-01-01

    Installation on the Disk of some Cathode Strip Chambers, type ME3/1, produced in the US. The installation has been performed on March 2004 at the CMS experimental site SX5 (P5) in Cessy, neighbouring France.

  11. The New Silicon Strip Detectors for the CMS Tracker Upgrade

    CERN Document Server

    Dragicevic, Marko

    2010-01-01

    The first introductory part of the thesis describes the concept of the CMS experiment. The tasks of the various detector systems and their technical implementations in CMS are explained. To facilitate the understanding of the basic principles of silicon strip sensors, the subsequent chapter discusses the fundamentals in semiconductor technology, with particular emphasis on silicon. The necessary process steps to manufacture strip sensors in a so-called planar process are described in detail. Furthermore, the effects of irradiation on silicon strip sensors are discussed. To conclude the introductory part of the thesis, the design of the silicon strip sensors of the CMS Tracker are described in detail. The choice of the substrate material and the complex geometry of the sensors are reviewed and the quality assurance procedures for the production of the sensors are presented. Furthermore the design of the detector modules are described. The main part of this thesis starts with a discussion on the demands on the ...

  12. Do insecticide-treated bednets have an effect on malaria vectors?

    NARCIS (Netherlands)

    Takken, W.

    2002-01-01

    The use of insecticide-treated bednets (ITNs) has been widely adopted as an important method for malaria control. Few data exist on effects of ITNs on mosquito biology and ecology, other than the development of insecticide resistance against the insecticides used. There is no hard evidence that the

  13. New Insecticides and Repellents For Use on Mosquitoes and Sand Flies

    Science.gov (United States)

    The major emphasis of our research is on the discovery and development of new insecticides for personal protection. The insecticide discovery effort involves structure-activity modeling to correlate molecular structure and electronic properties with repellent and/or insecticidal activity. Models a...

  14. Toxaphene, a complex mixture of polychloroterpenes and a major insecticide, is mutagenic

    Energy Technology Data Exchange (ETDEWEB)

    Hooper, N.K.; Ames, B.N.; Saleh, M.A.; Casida, J.E.

    1979-08-10

    Toxaphene, the most widely used chlorinated insecticide, is mutagenic in the Salmonella test without requiring liver homogenate for activity. This insecticide is a complex mixture (more than 177 polychloroterpenes) with carcinogenic activity in rodents. Some but not all of the mutagenic components are easily separated from the insecticidal ingredients.

  15. Haematological parameters as bioindicators of insecticide exposure in teleosts.

    Science.gov (United States)

    Singh, Narendra Nath; Srivastava, Anil Kumar

    2010-06-01

    Haematological parameters, such as erythrocyte and leucocyte count, erythrocyte indices and thrombocyte number vis-a-vis coagulation of blood has been considered bioindicators of toxicosis in fish following exposure to organochlorine, organophosphate, carbamate and pyrethroid insecticides. This review deals with the effects of insecticides on the morphology of red blood cells, total erythrocyte count, haemoglobin content, haematocrit, mean corpuscular volume, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, erythrocyte sedimentation rate, total and differential leucocyte counts, thrombocyte count and clotting time in the peripheral blood of a number of teleosts. The review also takes stock of knowledge of the subject and explores prospects of additional research in the related area.

  16. Development of Cooling Process Control Technique in Hot Strip Mill

    Institute of Scientific and Technical Information of China (English)

    HAN Bin; LIU Xiang-hua; WANG Guo-dong; SHE Guang-fu

    2005-01-01

    In order to ensure required mechanical properties of steel strip, various innovations in the cooling process control on the run-out table of a hot strip mill were actively promoted. The recent progress of process mathematical model and the new cooling strategy and equipment were discussed. The computer control system of high performance was introduced. The development trend in cooling process control was given.

  17. High speed twin roll casting of 6061 alloy strips

    OpenAIRE

    T. Haga; Sakaguchi, H.; H. Watari; S. Kumai

    2008-01-01

    Purpose: of this paper is to clear the possibility of high speed roll casting of thin strips of two aluminum alloys:6061 and recycled 6061. Mechanical properties of the roll cast 6061 and recycled 6061 strips were investigated inthe frame of this purpose.Design/methodology/approach: Methods used in the present study were high speed twin roll caster and lowtemperature casting. These methods were used to realize rapid solidification and increase the casting speed.Findings: are that 6061 and rec...

  18. A CAD model for the inductive strip in finline

    OpenAIRE

    Knorr, Jeffrey B.

    1988-01-01

    This report describes a CAD compatible circuit model for an inductive strip centered in f inline with W/b=E r2 =1 . The circuit model is shown to predict, strip scattering coefficients which agree closly with those measured experimentally in X-band. By application of the scaling principle the model is generalized for use with any waveguide size over the normal frequency range for the dominant TE 10 mode. Prepared for: Naval Postgraduate School Monterey, CA http://archive.o...

  19. The Strip: Las Vegas and the Symbolic Destruction of Spectacle

    OpenAIRE

    Al, Stefan Johannes

    2010-01-01

    Over the past 70 years, various actors have dramatically reconfigured the Las Vegas Strip in many forms. I claim that behind the Strip's "reinventions" lies a process of symbolic destruction. Since resorts distinguish themselves symbolically, each new round of capital accumulation relies on the destruction of symbolic capital of existing resorts. A new resort either ups the language within a paradigm, or causes a paradigm shift, which devalues the previous resorts even further. This is why, i...

  20. Laser pulse modulation instabilities in partially stripped plasma

    Institute of Scientific and Technical Information of China (English)

    Hu Qiang-Lin; Liu Shi-Bing; Jiang Yi-Jian

    2005-01-01

    The laser pulse modulation instabilities in partially stripped plasma were discussed based on the phase and group velocities of the laser pulse and the two processes that modulation instabilities excited. The excitation condition and growth rate of the modulation instability were obtained. It was found that the positive chirp and competition between normal and abnormal dispersions play important roles in the modulation instability. In the partially stripped plasma,the increased positive chirp enhances the modulation instability, and the dispersion competition reduces it.

  1. Insecticide applications to soil contribute to the development of Burkholderia mediating insecticide resistance in stinkbugs.

    Science.gov (United States)

    Tago, Kanako; Kikuchi, Yoshitomo; Nakaoka, Sinji; Katsuyama, Chie; Hayatsu, Masahito

    2015-07-01

    Some soil Burkholderia strains are capable of degrading the organophosphorus insecticide, fenitrothion, and establish symbiosis with stinkbugs, making the host insects fenitrothion-resistant. However, the ecology of the symbiotic degrading Burkholderia adapting to fenitrothion in the free-living environment is unknown. We hypothesized that fenitrothion applications affect the dynamics of fenitrothion-degrading Burkholderia, thereby controlling the transmission of symbiotic degrading Burkholderia from the soil to stinkbugs. We investigated changes in the density and diversity of culturable Burkholderia (i.e. symbiotic and nonsymbiotic fenitrothion degraders and nondegraders) in fenitrothion-treated soil using microcosms. During the incubation with five applications of pesticide, the density of the degraders increased from less than the detection limit to around 10(6)/g of soil. The number of dominant species among the degraders declined with the increasing density of degraders; eventually, one species predominated. This process can be explained according to the competitive exclusion principle using V(max) and K(m) values for fenitrothion metabolism by the degraders. We performed a phylogenetic analysis of representative strains isolated from the microcosms and evaluated their ability to establish symbiosis with the stinkbug Riptortus pedestris. The strains that established symbiosis with R. pedestris were assigned to a cluster including symbionts commonly isolated from stinkbugs. The strains outside the cluster could not necessarily associate with the host. The degraders in the cluster predominated during the initial phase of degrader dynamics in the soil. Therefore, only a few applications of fenitrothion could allow symbiotic degraders to associate with their hosts and may cause the emergence of symbiont-mediated insecticide resistance.

  2. The development of drift-strip detectors based on CdZnTe

    DEFF Research Database (Denmark)

    Gostilo, V.; Budtz-Jørgensen, Carl; Kuvvetli, Irfan

    2002-01-01

    The design and technological development of a CdZnTe drift strip detector is described. The device is based on a monocrystal of dimensions 10 x 10 x 3 mm(3) and has a pitch of 200 mum and a strip width of 100 mum. The strip length is 9.5 mm. The distribution of the leakage currents of the strips...

  3. Preliminary Design and Evaluation of Portable Electronic Flight Progress Strips

    Science.gov (United States)

    Doble, Nathan A.; Hansman, R. John

    2002-01-01

    There has been growing interest in using electronic alternatives to the paper Flight Progress Strip (FPS) for air traffic control. However, most research has been centered on radar-based control environments, and has not considered the unique operational needs of the airport air traffic control tower. Based on an analysis of the human factors issues for control tower Decision Support Tool (DST) interfaces, a requirement has been identified for an interaction mechanism which replicates the advantages of the paper FPS (e.g., head-up operation, portability) but also enables input and output with DSTs. An approach has been developed which uses a Portable Electronic FPS that has attributes of both a paper strip and an electronic strip. The prototype flight strip system uses Personal Digital Assistants (PDAs) to replace individual paper strips in addition to a central management interface which is displayed on a desktop computer. Each PDA is connected to the management interface via a wireless local area network. The Portable Electronic FPSs replicate the core functionality of paper flight strips and have additional features which provide a heads-up interface to a DST. A departure DST is used as a motivating example. The central management interface is used for aircraft scheduling and sequencing and provides an overview of airport departure operations. This paper will present the design of the Portable Electronic FPS system as well as preliminary evaluation results.

  4. Acrylamide content and color development in fried potato strips

    DEFF Research Database (Denmark)

    Pedreschi, F.; Kaack, K.; Granby, Kit

    2006-01-01

    Acrylamide formation and changes in color of fried potato strips was investigated in relation to frying temperature and three treatments before frying. Potato strips (0.8 x 0.8 x 5 cm) of Bintje variety were fried at 150, 170 and 190 degrees C until reaching moisture contents of similar to 40 g...... and 45 min; 90 degrees C for 3 and 10 min); (iii) immersed in a citric acid solution of 10 g/L for an hour; (iv) immersed in a sodium pyrophosphate solution of 10 g/L for an hour. Acrylamide content and color was determined in the potato strips after frying. Immersed strips in water for 120 min showed...... a reduction of acrylamide formation of 33%, 21% and 27% at 150, 170 and 190 T, respectively, when they were compared against the control. Potato strips blanched at 50 T for 80 min had the lowest acrylamide content when compared against strips blanched at different conditions and fried at the same temperature...

  5. Efficient ozone, sulfate, and ammonium free resist stripping process

    Science.gov (United States)

    Dattilo, Davide; Dietze, Uwe

    2014-07-01

    In recent years, photomask resist strip and cleaning technology development was substantially driven by the industry's need to prevent surface haze formation through the elimination of sulfuric acid and ammonium hydroxide from these processes. As a result, conventional SPM (H2SO4 + H2O2) was replaced with Ozone water (DIO3) for resist stripping and organic removal to eliminate chemical haze formation [1, 2]. However, it has been shown that DIO3 basted strip and clean process causes oxidative degradation of photomask materials [3, 4]. Such material damage can affect optical properties of funcitional mask layers, causeing CD line-width, phase, transmission and reflection changes, adversely affecting image transfer during the Lithography process. To overcome Ozone induced surface damage, SUSS MicroTec successfully developed a highly efficient strip process, where photolysis of DIO3 is leading to highly reactive hydroxyl radical formation, as the main contribution to hydrocarbon removal without surface damage [5]. This technology has been further extended to a final clean process, which is utilizing pure DI water for residual organic material removal during final clean [6]. Recently, SUS MicroTec did also successfully release strip and clean processes which completely remove NH4OH, eliminating any chemicals known today to induce haze [7]. In this paper we show the benefits of these new technologies for highly efficient sulfate and ammonium free stripping and cleaning processes.

  6. Development of a thin steel strip casting process. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Williams, R.S.

    1994-04-01

    This is a comprehensive effort to develop direct strip casting to the point where a pilot scale program for casting carbon steel strip could be initiated. All important aspects of the technology were being investigated, however the program was terminated early due to a change in the business strategy of the primary contractor, Armco Inc. (focus to be directed at specialty steels, not low carbon steel). At termination, the project was on target on all milestones and under budget. Major part was casting of strip at the experiment casting facility. A new caster, capable of producing direct cast strip of up to 12 in. wide in heats of 1000 and 3000 lb, was used. A total of 81 1000-1200 lb heats were cast as well as one test heat of 3000 lb. Most produced strip of from 0.016 to 0.085 in. thick. Process reliability was excellent for short casting times; quality was generally poor from modern hot strip mill standards, but the practices necessary for good surface quality were identified.

  7. Microstructure and Eutectic Carbide Morphology of the High Speed Steel Strips Produced by Twin Roll Strip Casting Process

    Institute of Scientific and Technical Information of China (English)

    Hongshuang DI; Xiaoming ZHANG; Guodong WANG; Xianghua LIU

    2003-01-01

    The M2 high-speed steel strip was produced by using the laboratory scale twin roll strip caster. The microstructureand eutectic carbide morphology of thus produced products were observed and analyzed, and the comparison ofthose with conventional products was carried out. The effects of the processing parameters such as the meltingtemperature, the pouring temperature, rolling speed and separating force on the microstructure and eutectic carbidemorphology and their distribution were analyzed. The spheroidizing process of the strips in the annealing process wasinvestigated. The relations between the growth and spheroidizing of the eutectic carbide and the annealing technologywere obtained, and the mechanism of the twin roll strip casting process improving the eutectic carbide spheroidizingwas discussed. The theoretical instruction for determining the subsequent treatment process was provided.

  8. Hydrological heterogeneity in agricultural riparian buffer strips

    Science.gov (United States)

    Hénault-Ethier, Louise; Larocque, Marie; Perron, Rachel; Wiseman, Natalie; Labrecque, Michel

    2017-03-01

    Riparian buffer strips (RBS) may protect surface water and groundwater in agricultural settings, although their effectiveness, observed in field-scale studies, may not extend to a watershed scale. Hydrologically-controlled leaching plots have often shown RBS to be effective at buffering nutrients and pesticides, but uncontrolled field studies have sometimes suggested limited effectiveness. The limited RBS effectiveness may be explained by the spatiotemporal hydrological heterogeneity near non-irrigated fields. This hypothesis was tested in conventional corn and soy fields in the St. Lawrence Lowlands of southern Quebec (Canada), where spring melt brings heavy and rapid runoff, while summer months are hot and dry. One field with a mineral soil (Saint-Roch-de-l'Achigan) and another with an organic-rich soil (Boisbriand) were equipped with passive runoff collectors, suction cup lysimeters, and piezometers placed before and after a 3 m-wide RBS, and monitored from 2011 to 2014. Soil topography of the RBS was mapped to a 1 cm vertical precision and a 50 cm sampling grid. On average, surface runoff intersects the RBS perpendicularly, but is subject to substantial local heterogeneity. Groundwater saturates the root zones, but flows little at the time of snowmelt. Groundwater flow is not consistently perpendicular to the RBS, and may reverse, flowing from stream to field under low water flow regimes with stream-aquifer connectivity, thus affecting RBS effectiveness calculations. Groundwater flow direction can be influenced by stratigraphy, local soil hydraulic properties, and historical modification of the agricultural stream beds. Understanding the spatiotemporal heterogeneity of surface and groundwater flows is essential to correctly assess the effectiveness of RBS in intercepting agro-chemical pollution. The implicit assumption that water flows across vegetated RBS, from the field to the stream, should always be verified.

  9. A Low-Profile Dual-Band Micro-strip Antenna Having Open-Circuited Strip-line-Stub

    OpenAIRE

    長谷川, 孝明; 羽石, 操

    1986-01-01

    Copyright notice. c1986 IEICE All rights reserved. "A Low-Profile Dual-Band Micro-strip Antenna Having Open-Circuited Strip-line-Stub"Misao HANEISHI, Hidekazu SUGA, Takaaki HASEGAWA.The Transactions of the Institute of Electronics and Communication Engineers of Japan. Section E, English, 1986. Vol. E69 No.11 pp. 1165-1166 許諾No.07RB0055.

  10. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-01-01

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments. PMID:23297352

  11. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  12. Control Strategies of Asymmetric Strip Shape in Six-High Cold Rolling Mill%Control Strategies of Asymmetric Strip Shape in Six-High Cold Rolling Mill

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yun; YANG Quan; WANG Xiao-chen

    2011-01-01

    It is a complicated problem for cold-rolled strip to improve asymmetric strip shape in strip production. A roll system and strip coupled model of six-high cold rolling mill was established with finite element method to estimate the effect of intermediate roll shifting, tilting, symmetric and asymmetric bending technologies on strip profile. To reduce asymmetric defects of strip shape as much as possible, some control strategies were proposed, including tilting and asymmetric bending of intermediate roll and work roll. The combinations of these three control strategies can effectively eliminate asymmetric strip shape defects. Finally, the closed-loop control model of asymmetric flat- ness at the last stand was given, and the flatness control system with the function of asymmetric strip shape control was also designed for cold tandem mill.

  13. The activity of the pyrrole insecticide chlorfenapyr in mosquito bioassay: towards a more rational testing and screening of non-neurotoxic insecticides for malaria vector control

    OpenAIRE

    Oxborough, RM; N'Guessan, R.; Jones, R.; Kitau, J; Ngufor, C; Malone, D; Mosha, FW; Rowland, MW

    2015-01-01

    Background\\ud The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of exper...

  14. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  15. Behavioral responses of the bed bug to insecticide residues.

    Science.gov (United States)

    Romero, Alvaro; Potter, Michael F; Haynes, Kenneth F

    2009-01-01

    The recent resurgence of bed bugs, Cimex lectularius L. (Heteroptera: Cimicidae), has increased the demand for information about effective control tactics. Several studies have focused on determining the susceptibility of bed bug populations to insecticides. However, behavioral responses of bed bugs to insecticide residues could influence their efficacy. The behavioral responses of bed bugs to deltamethrin and chlorfenapyr, two commonly used insecticides for bed bug control in the United States, were evaluated. In two-choice tests, grouped insects and individual insects avoided resting on filter paper treated with deltamethrin. Insects did not avoid surfaces treated with chlorfenapyr. Harborages, containing feces and eggs and treated with a deltamethrin-based product, remained attractive to individuals from a strain resistant to pyrethroids. Video recordings of bed bugs indicated that insects increased activity when they contacted sublethal doses of deltamethrin. Insecticide barriers of chlorfenapyr or deltamethrin did not prevent bed bugs from reaching a warmed blood source and acquiring blood meals. We discuss the impact of these responses on bed bug control practices.

  16. GABA receptor subunit composition relative to insecticide potency and selectivity.

    Science.gov (United States)

    Ratra, G S; Casida, J E

    2001-07-01

    Three observations on the 4-[(3)H]propyl-4'-ethynylbicycloorthobenzoate ([(3)H]EBOB) binding site in the gamma-aminobutyric acid (GABA) receptor indicate the specific target for insecticide action in human brain and a possible mechanism for selectivity. First, from published data, alpha-endosulfan, lindane and fipronil compete for the [(3)H]EBOB binding site with affinities of 0.3--7 nM in both human recombinant homooligomeric beta 3 receptors and housefly head membranes. Second, from structure-activity studies, including new data, GABAergic insecticide binding potency on the pentameric receptor formed from the beta 3 subunit correlates well with that on the housefly receptor (r=0.88, n=20). This conserved inhibitor specificity is consistent with known sequence homologies in the housefly GABA receptor and the human GABA(A) receptor beta 3 subunit. Third, as mostly new findings, various combinations of alpha 1, alpha 6, and gamma 2 subunits coexpressed with a beta 1 or beta 3 subunit confer differential insecticide binding sensitivity, particularly to fipronil, indicating that subunit composition is a major factor in insecticide selectivity.

  17. Control of Scirtothrips dorsalis with foliar insecticides, 2011

    Science.gov (United States)

    The objective of this study was to evaluate the efficacy of several conventional and novel insecticides against a new invasive thrips pest, Scirtothrips dorsalis Hood, in pepper under greenhouse condition. The trial was conducted at Tropical Research and Education Center in Homestead, Florida in hop...

  18. Soil applied insecticidal control of Scirtothrips dorsalis, 2011

    Science.gov (United States)

    The objective of this study was to evaluate the efficacy of several conventional and novel soil applied insecticides against a new invasive thrips pest, Scirtothrips dorsalis Hood, in pepper under greenhouse condition. The trial was conducted at Tropical Research and Education Center in Homestead, F...

  19. Investigation of the Insecticide Seed Dressing on the Sugar Beet

    Directory of Open Access Journals (Sweden)

    Jasminka Igrc Barčić

    2000-06-01

    Full Text Available The results of three year trials with various sugar beet seed treatments on the most important sugar beet pests, wireworms, flea beetles, sugar beet weevil and aphids are presented. The task of the investigation was to establish whether or not the sugar beet seed should be treated with insecticides and when granulars should be applied. In threeyear investigations 6 trials on different localities were carried out. Gaucho 70WS, Montur 190 FS, Geocid ST 35, Carbofuran 500 FS and a combination of Geocid ST 35 and Geocid G-5 were applied. The results showed that the imidacloprid seed treatment was satisfactory efficient on wireworms ensuring 20-42% more plants than on untreated plots. The efficacy of all treatments on the flea beetles was sufficient: Gaucho 70 WS 63-70%, the combined carbofuran treatment 65-67%, Geocid ST 35 54-55% and Montur 190 FS 52-55%. Therefore on imidacloprid and carbofuran treated crops the foliar treatment against flea beetles is mostly unnecassary. Insecticides based on imidacloprid showed a very good efficacy on aphids until 64 days after the sowing time with a somewhat longer residual action than the standard carbofuran treatments. All investigated insecticides were not satisfactorily efficient against sugar beet weevil. The seed dressing with a systemic insecticide is a justified measure. But, if the attack of wirevorms is strong or if a positive sugar beet weevil forecast is present, granulars shoud be applied additionaly.

  20. Neurotoxicological effects and the mode of action of pyrethroid insecticides

    NARCIS (Netherlands)

    Vijverberg, H.P.M.; Bercken, Joep van den

    1990-01-01

    Neuroexcitatory symptoms of acute poisoning of vertebrates by pyrethroids are related to the ability of these insecticides to modify electrical activity in various parts of the nervous system. Repetitive nerve activity, particularly in the sensory nervous system, membrane depolarization, and enhance

  1. Paraoxonase 1 (PON1) Status and Risk of Insecticide Exposure

    Energy Technology Data Exchange (ETDEWEB)

    Furlong, Clement E.; Cole, Toby B.; Walter, Betsy J.; Shih, Diana M.; Tward, Aaron; Lusis, Aldons J.; Timchalk, Chuck; Richter, Rebecca J.; Costa, Lucio G.

    2005-06-23

    Paraoxonase 1 (PON1) is an HDL associated enzyme that catalyzes a number of different reactions including the hydrolysis of the toxic oxon metabolites of the insecticides diazinon and chlorpyrifos. PON1 has also been implicated in the detoxication of oxidized lipids and the metabolism of a number of drugs, activating some, while inactivating others. There are two common PON1 coding region polymorphisms (L55M and Q192R). The latter determines the catalytic efficiency of hydrolysis of a number of substrates including chlorpyrifos oxon, but not diazoxon. Evidence for the physiological importance of PON1 in modulating exposures to these two insecticides comes from several different studies. Early studies noted that species with high levels of PON1 were much more resistant to certain organophosphorus (OP) insecticides than were species with low levels. Another early study by Main demonstrated that injected rabbit paraoxonase protected rats from paraoxon toxicity. Our research group began the development of a mouse model system for examining the importance of PON1 in the detoxication of OP insecticides.

  2. Seed coating with a neonicotinoid insecticide negatively affects wild bees.

    Science.gov (United States)

    Rundlöf, Maj; Andersson, Georg K S; Bommarco, Riccardo; Fries, Ingemar; Hederström, Veronica; Herbertsson, Lina; Jonsson, Ove; Klatt, Björn K; Pedersen, Thorsten R; Yourstone, Johanna; Smith, Henrik G

    2015-05-07

    Understanding the effects of neonicotinoid insecticides on bees is vital because of reported declines in bee diversity and distribution and the crucial role bees have as pollinators in ecosystems and agriculture. Neonicotinoids are suspected to pose an unacceptable risk to bees, partly because of their systemic uptake in plants, and the European Union has therefore introduced a moratorium on three neonicotinoids as seed coatings in flowering crops that attract bees. The moratorium has been criticized for being based on weak evidence, particularly because effects have mostly been measured on bees that have been artificially fed neonicotinoids. Thus, the key question is how neonicotinoids influence bees, and wild bees in particular, in real-world agricultural landscapes. Here we show that a commonly used insecticide seed coating in a flowering crop can have serious consequences for wild bees. In a study with replicated and matched landscapes, we found that seed coating with Elado, an insecticide containing a combination of the neonicotinoid clothianidin and the non-systemic pyrethroid β-cyfluthrin, applied to oilseed rape seeds, reduced wild bee density, solitary bee nesting, and bumblebee colony growth and reproduction under field conditions. Hence, such insecticidal use can pose a substantial risk to wild bees in agricultural landscapes, and the contribution of pesticides to the global decline of wild bees may have been underestimated. The lack of a significant response in honeybee colonies suggests that reported pesticide effects on honeybees cannot always be extrapolated to wild bees.

  3. Toxicity of selected insecticides applied to western spruce budworm

    Science.gov (United States)

    Jacqueline L. Robertson; Nancy L. Gillette; Melvin Look; Barbara A. Lucas; Robert L. Lyon

    1975-01-01

    The contact toxicity of 100 insecticides to last stage larvae of Choristoneura occidentalis Freeman was tested by topical application in a 10-yr series of screening experiments. Pyrethroids were generally the most toxic group of chemicals tested. Compounds more toxic than the standard, mexacarbate, at Ld50 were:...

  4. Hydrocarbon insecticides: their risks for environment and human health.

    Science.gov (United States)

    El-Bahnasawy, Mamdouh M; Mohammad, Amina El-Hosini; Morsy, Tosson A

    2014-08-01

    Insecticides are used to control diseases spread by arthropods, but theys vary greatly in toxicity. Toxicity depends on the chemical and physical properties of a substance, and may be defined as the quality of being poisonous or harmful to animals or plants. Poisons have many different modes of action, but in general cause biochemical changes which interfere with normal body functions. Toxicity can be either acute or chronic. Acute toxicity is the ability of a substance to cause harmful effects which develop rapidly following absorption, i.e. a few hours or a day. Chronic toxicity is the ability of a substance to cause adverse health effects resulting from long-term exposure to a substance. There is a great range in the toxicity of insecticides to humans. The relative hazard of an insecticide is dependent upon the toxicity of the pesticide, the dose received and the length of time exposed. A hazard can be defined as a source of danger. The great majority of insecticides are poisonous to man and his beneficial insects and animals and are carcinogenic agents particularly, the halogenated hydrocarbons containing benzene ring.

  5. Discovering and Designing New Insecticides and their Development Vector Control.

    Science.gov (United States)

    The discovery and development of novel insecticides for vector control is a primary focus of toxicology research conducted at the Mosquito and Fly Research Unit, Gainesville, FL. To identify new active ingredients, the screening of large numbers of experimental compounds is conducted using a primary...

  6. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... insecticides and their mixture in the control of gypsy moth. Mara Tabaković-Tošić ... gypsy moths, in progragation phase, when the number of pests is relatively small. When the number is .... invertebrate animals. Treatment of ...

  7. Insecticide assays against the brown stink bug feeding on pecan

    Science.gov (United States)

    The brown stink bug, Euschistus servus (Say) (Hemiptera: Pentatomidae), is an economic pest of pecan, Carya illinoinensis (Wangenh) K. Koch (Juglandaceae), and other agronomic crops across the southeastern U.S. Management of this pest is mainly via insecticides. Many commercial products indicate o...

  8. Effects of carbamate and pyrethroid insecticides on cowpea ...

    African Journals Online (AJOL)

    tet::hnique was used to estimate the cowpea b•·adyrhizobial count in the original soil from which the ... Then, the effects of these insecticides each at 0.5 and 1.5 ppm were assessed on tbe cowpea- ... unavailable) atmospheric nitrogen (N2. ) ...

  9. Control of rugose spiraling whitefly using biological insecticides, 2014

    Science.gov (United States)

    The objective of this study was to evaluate the efficacy of selected biological insecticides against a new invasive whitefly pest, Aleurodicus rugioperculatus Martin, in white bird of paradise under field condition. The trial was conducted at United States Horticultural Research Laboratory in Fort P...

  10. Domains of Bacillus thuringiensis crystal proteins involved in insecticidal activity

    NARCIS (Netherlands)

    Bosch, H.J.; Schipper, B.; Kleij, van der H.; Maagd, de R.A.; Stiekema, W.J.

    1994-01-01

    The expected increase in application of Bacillus thuringiensis (Bt) in crop protection makes it necessary to anticipate the development of Bt-resistant insects. To safeguard the long-term use of Bt-based insecticides, we studied the mode of action of Bt crystal proteins. CryIA(b), CryIC and CryIE ar

  11. Insecticidal Activity of Piperine Isolated from Piper sarmentosum

    Institute of Scientific and Technical Information of China (English)

    Feng; Gang; Ye; Huochun; Yuan; Enlin; Zhang; Jing; Yan; Chao; Jin; Qian; Peng; Zhengqiang; Fu; Yue-guan

    2014-01-01

    In order to clarify the insecticidal active ingredients of Piper sarmentosum,one active ingredient was isolated from ethanol extract of P. sarmentosum by bioassay-guided fractionation method. Its chemical structures were identified to be piperine by MS,1H NMR,13C NMR. The insecticidal activity of piperine and ethanol extract of P. sarmentosum against Aleurodicus dispels Russell were tested by leaf dip method. The results showed that piperine and ethanol extract of P. sarmentosum exhibited strong insecticidal activity against adults and nymphs of A. dispels; LC50values against adults were 28. 59 and 224. 31 mg/L,and LC50values against nymphs were 65. 91 and 336. 68 mg/L,respectively. There was no significant difference between piperine and azadirachtin against adults and nymphs of A.dispels. Therefore,piperine might be one of the main insecticidal ingredients of P. sarmentosum. In addition,piperine and ethanol extract showed ovicidal activity with different mode of action,piperine reduced the survival rate of newly hatched nymphs while ethanol extract impacted hatch of eggs.

  12. Oral insecticidal activity of plant-associated pseudomonads.

    Science.gov (United States)

    Ruffner, Beat; Péchy-Tarr, Maria; Ryffel, Florian; Hoegger, Patrik; Obrist, Christian; Rindlisbacher, Alfred; Keel, Christoph; Maurhofer, Monika

    2013-03-01

    Biocontrol pseudomonads are most known to protect plants from fungal diseases and to increase plant yield, while intriguing aspects on insecticidal activity have been discovered only recently. Here, we demonstrate that Fit toxin producing pseudomonads, in contrast to a naturally Fit-deficient strain, exhibit potent oral activity against larvae of Spodoptera littoralis, Heliothis virescens and Plutella xylostella, all major insect pests of agricultural crops. Spraying plant leaves with suspensions containing only 1000 Pseudomonas cells per ml was sufficient to kill 70-80% of Spodoptera and Heliothis larvae. Monitoring survival kinetics and bacterial titres in parallel, we demonstrate that Pseudomonas fluorescens CHA0 and Pseudomonas chlororaphis PCL1391, two bacteria harbouring the Fit gene cluster colonize and kill insects via oral infection. Using Fit mutants of CHA0 and PCL1391, we show that production of the Fit toxin contributes substantially to oral insecticidal activity. Furthermore, the global regulator GacA is required for full insecticidal activity. Our findings demonstrate the lethal oral activity of two root-colonizing pseudomonads so far known as potent antagonists of fungal plant pathogens. This adds insecticidal activity to the existing biocontrol repertoire of these bacteria and opens new perspectives for applications in crop pest control and in research on their ecological behaviour.

  13. Insecticide resistance in bedbugs in Thailand and laboratory evaluation of insecticides for the control of Cimex hemipterus and Cimex lectularius (Hemiptera: Cimicidae).

    Science.gov (United States)

    Tawatsin, Apiwat; Thavara, Usavadee; Chompoosri, Jakkrawarn; Phusup, Yutthana; Jonjang, Nisarat; Khumsawads, Chayada; Bhakdeenuan, Payu; Sawanpanyalert, Pathom; Asavadachanukorn, Preecha; Mulla, Mir S; Siriyasatien, Padet; Debboun, Mustapha

    2011-09-01

    Bedbugs are found in many countries around the world, and in some regions they are resistant to numerous insecticides. This study surveyed bedbugs in Thailand and determined their resistance to insecticides. The surveys were carried out in six provinces that attract large numbers of foreign tourists: Bangkok, Chonburi, Chiang Mai, Ubon Ratchathani, Phuket, and Krabi. Bedbugs were collected from hotels and colonized in the laboratory to evaluate their resistance to insecticides. Cimex hemipterus (F.) was found in some hotels in Bangkok, Chonburi, Phuket, and Krabi, whereas Cimex lectularius L. was found only in hotels in Chiang Mai. No bedbugs were found in Ubon Ratchathani. The colonized bedbugs showed resistance to groups of insecticides, including organochlorines (dichlorodiphenyl trichloroethane, dieldrin), carbamates (bendiocarb, propoxur), organophosphates (malathion, fenitrothion), and pyrethroids (cyfluthrin, deltamethrin, permethrin, lambda-cyhalothrin, etofenprox) in tests using World Health Organization insecticide-impregnated papers. The new insecticides imidacloprid (neonicotinoid group), chlorfenapyr (pyrrole group), and fipronil (phenylpyrazole group) were effective against the bedbugs; however, organophosphate (diazinon), carbamates (fenobucarb, propoxur), and pyrethroids (bifenthrin, cypermethrin, esfenvalerate, etofenprox) were ineffective. Aerosols containing various pyrethroid insecticides with two to four different active ingredients were effective against the bedbugs. The results obtained from this study suggested that both species of bedbugs in Thailand have developed marked resistance to various groups of insecticides, especially those in the pyrethroid group, which are the most common insecticides used for pest control. Therefore, an integrated pest management should be implemented for managing bedbugs in Thailand.

  14. Novel and Viable Acetylcholinesterase Target Site for Developing Effective and Environmentally Safe Insecticides

    Science.gov (United States)

    Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

    2012-01-01

    Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market. PMID:22280344

  15. Analysis of Insecticides in Dead Wild Birds in Korea from 2010 to 2013.

    Science.gov (United States)

    Kim, Soohee; Park, Mi-Young; Kim, Hyo-Jin; Shin, Jin Young; Ko, Kyung Yuk; Kim, Dong-Gyu; Kim, MeeKyung; Kang, Hwan-Goo; So, ByungJae; Park, Sung-Won

    2016-01-01

    Wild birds are exposed to insecticides in a variety of ways, at different dose levels and via multiple routes, including ingestion of contaminated food items, and dermal, inhalation, preening, and embryonic exposure. Most poisoning by insecticides occurs as a result of misuse or accidental exposure, but intentional killing of unwanted animals also occurs. In this study, we investigated insecticides in the gastric contents of dead wild birds that were suspected to have died from insecticide poisoning based on necropsy. The wild birds were found dead in various regions and locations such as in mountains, and agricultural and urban areas. A total of 182 dead wild birds of 27 species were analyzed in this study, and insecticide residue levels were determined in 60.4% of the total samples analyzed. Monocrotophos and phosphamidon were the most common insecticides identified at rates of 50.0% and 30.7% of the insecticide-positive samples, respectively. Other insecticides identified in dead wild birds included organophosphorous, organochlorine and carbamate insecticides. However, there was limited evidence to conclusively establish the cause of death related to insecticides in this study. Nevertheless, considering the level of insecticide exposure, it is speculated that the exposure was mainly a result of accidental or intentional killing, and not from environmental residue.

  16. Changes in insecticide resistance of the rice striped stem borer (Lepidoptera: Crambidae).

    Science.gov (United States)

    Su, Jianya; Zhang, Zhenzhen; Wu, Min; Gao, Congfen

    2014-02-01

    Application of insecticides is the most important method to control Chilo suppressalis (Walker) (Lepidoptera: Crambidae), and continuous use of individual insecticides has driven the rapid development of insecticide resistance in C. suppressalis during the past 30 yr. Monitoring insecticide resistance provides information essential for integrated pest management. Insecticide resistance of field populations to monosultap, triazophos, chlorpyrifos, and abamectin in China was examined in 2010 and 2011. The results indicated that the resistance levels of 14 field populations to four insecticides were significantly different. Four populations showed moderate resistance, and other populations possessed low-level resistance or were susceptible to monosultap. Nine populations displayed an extremely high or a high level of resistance to triazophos, whereas four populations were sensitive to this agent. Five populations exhibited a low level of resistance to abamectin, while the others remained sensitive. When compared with historical data, resistance to monosultap and triazophos decreased significantly, and the percentage of populations with high-level or extremely high-level resistance was obviously reduced. By contrast, the resistance to abamectin increased slightly. The increasing and decreasing resistance levels reported in this study highlight the different evolutionary patterns of insecticide resistance in C. suppressalis. An overreliance on one or two insecticides may promote rapid development of resistance. Slow development of resistance to abamectin, which was used mainly in mixtures with other insecticides, implies that the use of insecticide mixtures may be an effective method to delay the evolution of resistance to insecticides.

  17. Agricultural insecticides threaten surface waters at the global scale

    Science.gov (United States)

    Stehle, Sebastian; Schulz, Ralf

    2015-01-01

    Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions. PMID:25870271

  18. Underpinning sustainable vector control through informed insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Edward K Thomsen

    Full Text Available BACKGROUND: There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions. METHODOLOGY/PRINCIPAL FINDINGS: A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s. CONCLUSIONS/SIGNIFICANCE: Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.

  19. Microstructural Characterization of Novel Ni-Containing Nd-Fe-B Strips by Strip Casting

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The characteristics of novel Nd-Fe(Ni, Co, Al)-B microstructure prepared by strip casting technique were studied. The novel microstructure was observed using scanning electron microscope (SEM) and transmission electron microscope (TEM). Along the direction of heat flow, there are two kinds of different microstructures. Close to the wheel side, there is a thick layer containing many polygonal Nd2Fe14B grains. Near the free surface side, however, there are relative uniform platelike Nd2Fe14B grains whose growth direction is not completely the direction of the heat flow during solidification. The formation of the novel microstructure is presumed to be the contribution of the special temperature field and Ni component.

  20. Stripped Elliptical Galaxies as Probes of ICM Physics: I. Tails, Wakes, and Flow Patterns in and Around Stripped Ellipticals

    Science.gov (United States)

    Roediger, E.; Kraft, R. P.; Nulsen, P. E. J.; Forman, W. R.; Machacek, M.; Randall, S.; Jones, C.; Churazov, E.; Kokotanekova, R.

    2015-06-01

    Elliptical cluster galaxies are progressively stripped of their atmospheres due to their motion through the intracluster medium (ICM). Deep X-ray observations reveal the fine-structure of the galaxy’s remnant atmosphere and its gas tail and wake. This fine-structure depends on dynamic conditions (galaxy potential, initial gas contents, orbit through the host cluster), orbital stage (early infall, pre-/post-pericenter passage), and ICM plasma properties (thermal conductivity, viscosity, magnetic field structure). We aim to disentangle dynamic and plasma effects in order to use stripped ellipticals as probes of ICM plasma properties. This first paper of a series investigates the hydrodynamics of progressive gas stripping by means of inviscid hydrodynamical simulations. We distinguish a long-lasting initial relaxation phase and a quasi-steady stripping phase. During quasi-steady stripping, the ICM flow around the remnant atmosphere resembles the flow around solid bodies, including a “deadwater” region in the near wake. Gas is stripped from the remnant atmosphere predominantly at its sides via Kelvin-Helmholtz instabilities. The downstream atmosphere is largely shielded from the ICM wind and thus shaped into a tail. Observationally, both this “remnant tail” and the stripped gas in the wake can appear as a “tail”, but only in the wake can galactic gas mix with the ambient ICM. While the qualitative results are generic, the simulations presented here are tailored to the Virgo elliptical galaxy M89 (NGC 4552) for the most direct comparison to observations. Papers II and III of this series describe the effect of viscosity and compare to Chandra and XMM-Newton observations, respectively.