Turbine engine airfoil and platform assembly

Science.gov (United States)

Campbell, Christian X [Oviedo, FL; James, Allister W [Chuluota, FL; Morrison, Jay A [Oviedo, FL

2012-07-31

A turbine airfoil (22A) is formed by a first process using a first material. A platform (30A) is formed by a second process using a second material that may be different from the first material. The platform (30A) is assembled around a shank (23A) of the airfoil. One or more pins (36A) extend from the platform into holes (28) in the shank (23A). The platform may be formed in two portions (32A, 34A) and placed around the shank, enclosing it. The two platform portions may be bonded to each other. Alternately, the platform (30B) may be cast around the shank (23B) using a metal alloy with better castability than that of the blade and shank, which may be specialized for thermal tolerance. The pins (36A-36D) or holes for them do not extend to an outer surface (31) of the platform, avoiding stress concentrations.

High-temperature MEMS Heater Platforms: Long-term Performance of Metal and Semiconductor Heater Materials

Directory of Open Access Journals (Sweden)

Theodor Doll

2006-04-01

Full Text Available Micromachined thermal heater platforms offer low electrical power consumptionand high modulation speed, i.e. properties which are advantageous for realizing non-dispersive infrared (NDIR gas- and liquid monitoring systems. In this paper, we report oninvestigations on silicon-on-insulator (SOI based infrared (IR emitter devices heated byemploying different kinds of metallic and semiconductor heater materials. Our resultsclearly reveal the superior high-temperature performance of semiconductor over metallicheater materials. Long-term stable emitter operation in the vicinity of 1300 K could beattained using heavily antimony-doped tin dioxide (SnO2:Sb heater elements.

Ionic liquid-based materials: a platform to design engineered CO2 separation membranes.

Science.gov (United States)

Tomé, Liliana C; Marrucho, Isabel M

2016-05-21

During the past decade, significant advances in ionic liquid-based materials for the development of CO2 separation membranes have been accomplished. This review presents a perspective on different strategies that use ionic liquid-based materials as a unique tuneable platform to design task-specific advanced materials for CO2 separation membranes. Based on compilation and analysis of the data hitherto reported, we provide a judicious assessment of the CO2 separation efficiency of different membranes, and highlight breakthroughs and key challenges in this field. In particular, configurations such as supported ionic liquid membranes, polymer/ionic liquid composite membranes, gelled ionic liquid membranes and poly(ionic liquid)-based membranes are detailed, discussed and evaluated in terms of their efficiency, which is attributed to their chemical and structural features. Finally, an integrated perspective on technology, economy and sustainability is provided.

AcEST: BP919506 [AcEST

Lifescience Database Archive (English)

Full Text Available _MACMU Mediator of DNA damage checkpoint protein 1... 29 8.4 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus...DFPTGSMILGISG----IRSAYLTGRGSIIMRGKAEIENIGNSRQAIIITE 263 >sp|Q8JTG9|L_ABLVH Large structural protein OS=Australian bat lyssavirus...) Link to BlastX Result : Swiss-Prot sp_hit_id Q9QSP0 Definition sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavi...rus (isolate Bat/AUS/1996) Align length 52 Score (bit) 3

AcEST: BP920099 [AcEST

Lifescience Database Archive (English)

Full Text Available esult : Swiss-Prot sp_hit_id Q9QSP0 Definition sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus.... 30 8.0 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=...avirus (isolate Human/AUS/1998) GN=L PE=3 SV=1 Length = 2127 Score = 32.7 bits (73)...RSRKCLSDLTQFYQKSSPIE--KLLNYTLGNRGLR 145 >sp|Q8JTG9|L_ABLVH Large structural protein OS=Australian bat lyss

Hybrid Nanocomposites of 2D Black Phosphorous Nanosheets Encapsulated in PMMA Polymer Material: New Platforms for Advanced Device Fabrication.

Science.gov (United States)

Telesio, Francesca; Passaglia, Elisa; Cicogna, Francesca; Costantino, Federica; Serrano-Ruiz, Manuel; Peruzzini, Maurizio; Heun, Stefan

2018-04-12

Hybrid materials, containing a 2D filler embedded in a polymeric matrix, are an interesting platform for several applications, because of the variety of properties that the filler can impart to the polymer matrix when dispersed at the nanoscale. Moreover, novel properties could arise from the interaction between the two. Mostly the bulk properties of these materials have been studied so far, especially focusing on how the filler changes the polymeric matrix properties. Here we propose a complete change of perspective by using the hybrid nanocomposite material as a platform suitable to engineer the properties of the filler and to exploit its potential in the fabrication of devices. As a proof of concept of the versatility and potentiality of the new method, we applied this approach to prepare black phosphorus nanocomposites through its dispersion in poly (methyl methacrylate). Black phosphorus is a very interesting 2D material, whose application have so far been limited by its very high reactivity to oxygen and water. In this respect, we show that electronic-grade black phosphorus flakes, already embedded in a protecting matrix since their exfoliation from the bulk material, are endowed with significant increased stability, and can be further processed into devices without degrading their properties. Creative Commons Attribution license.

Effect of platform connection and abutment material on stress distribution in single anterior implant-supported restorations: a nonlinear 3-dimensional finite element analysis.

Science.gov (United States)

Carvalho, Marco Aurélio; Sotto-Maior, Bruno Salles; Del Bel Cury, Altair Antoninha; Pessanha Henriques, Guilherme Elias

2014-11-01

Although various abutment connections and materials have recently been introduced, insufficient data exist regarding the effect of stress distribution on their mechanical performance. The purpose of this study was to investigate the effect of different abutment materials and platform connections on stress distribution in single anterior implant-supported restorations with the finite element method. Nine experimental groups were modeled from the combination of 3 platform connections (external hexagon, internal hexagon, and Morse tapered) and 3 abutment materials (titanium, zirconia, and hybrid) as follows: external hexagon-titanium, external hexagon-zirconia, external hexagon-hybrid, internal hexagon-titanium, internal hexagon-zirconia, internal hexagon-hybrid, Morse tapered-titanium, Morse tapered-zirconia, and Morse tapered-hybrid. Finite element models consisted of a 4×13-mm implant, anatomic abutment, and lithium disilicate central incisor crown cemented over the abutment. The 49 N occlusal loading was applied in 6 steps to simulate the incisal guidance. Equivalent von Mises stress (σvM) was used for both the qualitative and quantitative evaluation of the implant and abutment in all the groups and the maximum (σmax) and minimum (σmin) principal stresses for the numerical comparison of the zirconia parts. The highest abutment σvM occurred in the Morse-tapered groups and the lowest in the external hexagon-hybrid, internal hexagon-titanium, and internal hexagon-hybrid groups. The σmax and σmin values were lower in the hybrid groups than in the zirconia groups. The stress distribution concentrated in the abutment-implant interface in all the groups, regardless of the platform connection or abutment material. The platform connection influenced the stress on abutments more than the abutment material. The stress values for implants were similar among different platform connections, but greater stress concentrations were observed in internal connections

Relationship between renal pathology and the size of circulating immune complexes in patients with systemic lupus erythematosus

International Nuclear Information System (INIS)

Wener, M.H.; Mannik, M.; Schwartz, M.M.; Lewis, E.J.

1987-01-01

Sera from 35 patients with biopsy-proven diffuse proliferative (WHO class IV) or membranous (WHO class V) lupus nephritis were analyzed for the presence and size of circulating immune complexes. Elevations of the C1q solid-phase assay (C1qSP) for immune complexes were found in sera from all patients with diffuse proliferative nephritis, with a mean +/- 1 SEM of 166.8 +/- 42.0 micrograms/AHG-equivalents/ml serum, and in 71.4% of the patients with membranous nephritis (83.1 +/- 26.7, p = 0.06). Using the WHO criteria for subclasses of membranous lupus nephritis, we also designated renal biopsies as nonproliferative (WHO classes Va and Vb) or proliferative (WHO classes IV and Vc). Employing the latter groupings, we observed significant differences between C1qSP results of patients with nonproliferative (30.3 +/- 8.8) and proliferative (172.8 +/- 36.8, p less than 0.001) lupus nephritis. These data suggest that the presence of C1q-binding material in serum is pathophysiologically related to proliferative glomerular lesions, and that levels of C1qSP binding reflect renal lesions in SLE patients. Sucrose density gradient ultracentrifugation was performed on each serum, and gradient fractions analyzed for C1qSP-binding and total IgG, using techniques to minimize losses of immune complexes. The predominant peak of C1qSP activity sedimented with the 6.6S monomeric IgG. The 6.6S C1q-binding IgG was increased only in 1 of 10 patients with membranous lupus nephritis without proliferative changes, and was elevated in 16 of 25 patients with proliferative lesions (WHO classes IV and Vc)

Cross-platform learning: on the nature of children's learning from multiple media platforms.

Science.gov (United States)

Fisch, Shalom M

2013-01-01

It is increasingly common for an educational media project to span several media platforms (e.g., TV, Web, hands-on materials), assuming that the benefits of learning from multiple media extend beyond those gained from one medium alone. Yet research typically has investigated learning from a single medium in isolation. This paper reviews several recent studies to explore cross-platform learning (i.e., learning from combined use of multiple media platforms) and how such learning compares to learning from one medium. The paper discusses unique benefits of cross-platform learning, a theoretical mechanism to explain how these benefits might arise, and questions for future research in this emerging field. Copyright © 2013 Wiley Periodicals, Inc., A Wiley Company.

Cryptococcus neoformans sexual reproduction is controlled by a quorum sensing peptide.

Science.gov (United States)

Tian, Xiuyun; He, Guang-Jun; Hu, Pengjie; Chen, Lei; Tao, Changyu; Cui, Ying-Lu; Shen, Lan; Ke, Weixin; Xu, Haijiao; Zhao, Youbao; Xu, Qijiang; Bai, Fengyan; Wu, Bian; Yang, Ence; Lin, Xiaorong; Wang, Linqi

2018-06-01

Bacterial quorum sensing is a well-characterized communication system that governs a large variety of collective behaviours. By comparison, quorum sensing regulation in eukaryotic microbes remains poorly understood, especially its functional role in eukaryote-specific behaviours, such as sexual reproduction. Cryptococcus neoformans is a prevalent fungal pathogen that has two defined sexual cycles (bisexual and unisexual) and is a model organism for studying sexual reproduction in fungi. Here, we show that the quorum sensing peptide Qsp1 serves as an important signalling molecule for both forms of sexual reproduction. Qsp1 orchestrates various differentiation and molecular processes, including meiosis, the hallmark of sexual reproduction. It activates bisexual mating, at least in part through the control of pheromone, a signal necessary for bisexual activation. Notably, Qsp1 also plays a major role in the intercellular regulation of unisexual initiation and coordination, in which pheromone is not strictly required. Through a multi-layered genetic screening approach, we identified the atypical zinc finger regulator Cqs2 as an important component of the Qsp1 signalling cascade during both bisexual and unisexual reproduction. The absence of Cqs2 eliminates the Qsp1-stimulated mating response. Together, these findings extend the range of behaviours governed by quorum sensing to sexual development and meiosis.

Emerging heterogeneous integrated photonic platforms on silicon

Directory of Open Access Journals (Sweden)

Fathpour Sasan

2015-05-01

Full Text Available Silicon photonics has been established as a mature and promising technology for optoelectronic integrated circuits, mostly based on the silicon-on-insulator (SOI waveguide platform. However, not all optical functionalities can be satisfactorily achieved merely based on silicon, in general, and on the SOI platform, in particular. Long-known shortcomings of silicon-based integrated photonics are optical absorption (in the telecommunication wavelengths and feasibility of electrically-injected lasers (at least at room temperature. More recently, high two-photon and free-carrier absorptions required at high optical intensities for third-order optical nonlinear effects, inherent lack of second-order optical nonlinearity, low extinction ratio of modulators based on the free-carrier plasma effect, and the loss of the buried oxide layer of the SOI waveguides at mid-infrared wavelengths have been recognized as other shortcomings. Accordingly, several novel waveguide platforms have been developing to address these shortcomings of the SOI platform. Most of these emerging platforms are based on heterogeneous integration of other material systems on silicon substrates, and in some cases silicon is integrated on other substrates. Germanium and its binary alloys with silicon, III–V compound semiconductors, silicon nitride, tantalum pentoxide and other high-index dielectric or glass materials, as well as lithium niobate are some of the materials heterogeneously integrated on silicon substrates. The materials are typically integrated by a variety of epitaxial growth, bonding, ion implantation and slicing, etch back, spin-on-glass or other techniques. These wide range of efforts are reviewed here holistically to stress that there is no pure silicon or even group IV photonics per se. Rather, the future of the field of integrated photonics appears to be one of heterogenization, where a variety of different materials and waveguide platforms will be used for

AcEST: BP917326 [AcEST

Lifescience Database Archive (English)

Full Text Available rase, cytosolic OS... 29 6.3 sp|Q9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus... 29 8.2 >sp|...9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=G PE=1 SV=1 Length =

Polymer-Silica Nanocomposites: A Versatile Platform for Multifunctional Materials

Science.gov (United States)

Chiu, Chi-Kai

was ground into two different sizes of powder followed by powder pressing, heat-treating and etching. A new robust porous silver foam was then successfully made. By combining the results from room temperature and high temperature processes, we further study the patterned silver nanoparticles arrays in order to examine how mobility of silver can be controlled on a quantifiable scale. Furthermore, we have identified a thiolcontaining sol-gel precursor to control the affinity between silver and silica matrix. Lastly, the effects of interfacial interactions between sol-gel silica and other nanocomposite components and the effect of thickness of the sol-gel layer on mechanical properties were investigated. These studies were applied to the biomimetic hydroxyapatite-gelatin system. We have found that by limiting the thickness while maintaining interfacial interactions of the sol-gel layer, a unique moldable property and short hardening time from these nanocomposites can be achieved without compromising its biocompatibility. Their biocompatibility has been proven based on the in vitro and in vivo testing of these materials. In conclusion, the present study has demonstrated that polymer-silica nanocomposite is a versatile platform to carry out applications in nanocrystal growth, nanoporous metals, metal-ceramic composites, nano-imprint thin film, and bone grafts. These important findings not only provide new insights into nanocomposites but also give new meanings to the previously functional-limited sol-gel materials.

Application of a Smartphone Metabolomics Platform to the Authentication of Schisandra sinensis.

Science.gov (United States)

Kwon, Hyuk Nam; Phan, Hong-Duc; Xu, Wen Jun; Ko, Yoon-Joo; Park, Sunghyouk

2016-05-01

Herbal medicines have been used for a long time all around the world. Since the quality of herbal preparations depends on the source of herbal materials, there has been a strong need to develop methods to correctly identify the origin of materials. To develop a smartphone metabolomics platform as a simpler and low-cost alternative for the identification of herbal material source. Schisandra sinensis extracts from Korea and China were prepared. The visible spectra of all samples were measured by a smartphone spectrometer platform. This platform included all the necessary measures built-in for the metabolomics research: data acquisition, processing, chemometric analysis and visualisation of the results. The result of the smartphone metabolomics platform was compared to that of NMR-based metabolomics, suggesting the feasibility of smartphone platform in metabolomics research. The smartphone metabolomics platform gave similar results to the NMR method, showing good separation between Korean and Chinese materials and correct predictability for all test samples. With its accuracy and advantages of affordability, user-friendliness, and portability, the smartphone metabolomics platform could be applied to the authentication of other medicinal plants. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

Creating a Discovery Platform for Confined-Space Chemistry and Materials: Metal-Organic Frameworks.

Energy Technology Data Exchange (ETDEWEB)

Allendorf, Mark D.; Greathouse, Jeffery A.; Simmons, Blake

2008-09-01

Metal organic frameworks (MOF) are a recently discovered class of nanoporous, defect-free crystalline materials that enable rational design and exploration of porous materials at the molecular level. MOFs have tunable monolithic pore sizes and cavity environments due to their crystalline nature, yielding properties exceeding those of most other porous materials. These include: the lowest known density (91% free space); highest surface area; tunable photoluminescence; selective molecular adsorption; and methane sorption rivaling gas cylinders. These properties are achieved by coupling inorganic metal complexes such as ZnO4 with tunable organic ligands that serve as struts, allowing facile manipulation of pore size and surface area through reactant selection. MOFs thus provide a discovery platform for generating both new understanding of chemistry in confined spaces and novel sensors and devices based on their unique properties. At the outset of this project in FY06, virtually nothing was known about how to couple MOFs to substrates and the science of MOF properties and how to tune them was in its infancy. An integrated approach was needed to establish the required knowledge base for nanoscale design and develop methodologies integrate MOFs with other materials. This report summarizes the key accomplishments of this project, which include creation of a new class of radiation detection materials based on MOFs, luminescent MOFs for chemical detection, use of MOFs as templates to create nanoparticles of hydrogen storage materials, MOF coatings for stress-based chemical detection using microcantilevers, and "flexible" force fields that account for structural changes in MOFs that occur upon molecular adsorption/desorption. Eight journal articles, twenty presentations at scientific conferences, and two patent applications resulted from the work. The project created a basis for continuing development of MOFs for many Sandia applications and succeeded in securing $2.75 M in

National platform electromobility. Interim report of the working group 5 Materials and recycling; Nationale Plattform Elektromobilitaet. Zwischenbericht der Arbeitsgruppe 5 Materialien und Recycling

Energy Technology Data Exchange (ETDEWEB)

Nuessle, Falk D [ThyssenKrupp AG, Essen (Germany). Business Area Components Technology; Wissel-Stoll, Kathrin [BASF SE, Ludwigshafen (Germany). Marketing Acids and Specialties

2010-07-01

Sufficient range, appropriate road performances, fulfilment of ecological requirements and an alternative price structuring are challenges in order to obtain the necessary acceptance for electric-powered vehicles by the customer. For this, new materials with adapted recycling strategies have to make a substantial contribution and are a driving force to an economic and sustainable electrical mobility. In order to achieve the goal of the national platform electromobility the following key fields are success critical in this connection: (a) Material for batteries; (b) Materials for construction and material lightweight construction; (c) Concepts for securing raw materials and recycling; (d) Materials for further key components.

Peer-to-Peer Service Sharing Platforms

DEFF Research Database (Denmark)

Andersson, Magnus; Hjalmarsson, Anders; Avital, Michel

2013-01-01

The sharing economy has been growing continuously in the last decade thanks to the proliferation of internet-based platforms that allow people to disintermediate the traditional commercial channels and to share excess resources and trade with one another effectively at a reasonably low transaction...... cost. Whereas early peer-to-peer platforms were designed to enable file sharing and goods trading, we recently witness the emergence of a new breed of peer-to-peer platforms that are designed for ordinary service sharing. Ordinary services entail intangible provisions and are defined as an economic...... activity that generates immaterial benefits and does not result in ownership of material goods. Based on a structured analysis of 41 internet-based rideshare platforms, we explore and layout the unique characteristics of peer-to-peer service sharing platforms based on three distinct temporal patterns...

Material-Efficient Microfluidic Platform for Exploratory Studies of Visible-Light Photoredox Catalysis.

Science.gov (United States)

Coley, Connor W; Abolhasani, Milad; Lin, Hongkun; Jensen, Klavs F

2017-08-07

We present an automated microfluidic platform for in-flow studies of visible-light photoredox catalysis in liquid or gas-liquid reactions at the 15 μL scale. An oscillatory flow strategy enables a flexible residence time while preserving the mixing and heat transfer advantages of flow systems. The adjustable photon flux made possible with the platform is characterized using actinometry. Case studies of oxidative hydroxylation of phenylboronic acids and dimerization of thiophenol demonstrate the capabilities and advantages of the system. Reaction conditions identified through droplet screening translate directly to continuous synthesis with minor platform modifications. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Dental Implant Surrounding Marginal Bone Level Evaluation: Platform Switching versus Platform Matching—One-Year Retrospective Study

Directory of Open Access Journals (Sweden)

Eisner Salamanca

2017-01-01

Full Text Available The benefits and feasibility of platform switching have been discussed in several studies, reporting lesser crestal bone loss in platform-switched implants than in platform-matched implants. Objective. The aim of the present study was to observe the changes in vertical and horizontal marginal bone levels in platform-switched and platform-matched dental implants. Materials and Methods. 51 patients received 60 dental implants in the present study over a 1-year period. Measurement was performed between the implant shoulder and the most apical and horizontal marginal defect by periapical radiographs to examine the changes of peri-implant alveolar bone before and 12 months after prosthodontic restoration delivery. Results. These marginal bone measurements showed a bone gain of 0.23±0.58 mm in the vertical gap and 0.22±0.53 mm in the horizontal gap of platform matching, while in platform switching a bone gain of 0.93±1 mm (P<0.05 in the vertical gap and 0.50±0.56 mm in the horizontal gap was found. The average vertical gap reduction from the baseline until 12 months was 0.92±1.11 mm in platform switching and 0.29±0.85 mm in platform matching (P<0.05. Conclusions. Within the limitations of the present study, platform switching seemed to be more effective for a better peri-implant alveolar bone vertical and horizontal gap reduction at 1 year.

A Portable Wireless Communication Platform Based on a Multi-Material Fiber Sensor for Real-Time Breath Detection

Directory of Open Access Journals (Sweden)

Mourad Roudjane

2018-03-01

Full Text Available In this paper, we present a new mobile wireless communication platform for real-time monitoring of an individual’s breathing rate. The platform takes the form of a wearable stretching T-shirt featuring a sensor and a detection base station. The sensor is formed by a spiral-shaped antenna made from a multi-material fiber connected to a compact transmitter. Based on the resonance frequency of the antenna at approximately 2.4 GHz, the breathing sensor relies on its Bluetooth transmitter. The contactless and non-invasive sensor is designed without compromising the user’s comfort. The sensing mechanism of the system is based on the detection of the signal amplitude transmitted wirelessly by the sensor, which is found to be sensitive to strain. We demonstrate the capability of the platform to detect the breathing rates of four male volunteers who are not in movement. The breathing pattern is obtained through the received signal strength indicator (RSSI which is filtered and analyzed with home-made algorithms in the portable system. Numerical simulations of human breath are performed to support the experimental detection, and both results are in a good agreement. Slow, fast, regular, irregular, and shallow breathing types are successfully recorded within a frequency interval of 0.16–1.2 Hz, leading to a breathing rate varying from 10 to 72 breaths per minute.

Mid-infrared materials and devices on a Si platform for optical sensing

Science.gov (United States)

Singh, Vivek; Lin, Pao Tai; Patel, Neil; Lin, Hongtao; Li, Lan; Zou, Yi; Deng, Fei; Ni, Chaoying; Hu, Juejun; Giammarco, James; Soliani, Anna Paola; Zdyrko, Bogdan; Luzinov, Igor; Novak, Spencer; Novak, Jackie; Wachtel, Peter; Danto, Sylvain; Musgraves, J David; Richardson, Kathleen; Kimerling, Lionel C; Agarwal, Anuradha M

2014-01-01

In this article, we review our recent work on mid-infrared (mid-IR) photonic materials and devices fabricated on silicon for on-chip sensing applications. Pedestal waveguides based on silicon are demonstrated as broadband mid-IR sensors. Our low-loss mid-IR directional couplers demonstrated in SiNx waveguides are useful in differential sensing applications. Photonic crystal cavities and microdisk resonators based on chalcogenide glasses for high sensitivity are also demonstrated as effective mid-IR sensors. Polymer-based functionalization layers, to enhance the sensitivity and selectivity of our sensor devices, are also presented. We discuss the design of mid-IR chalcogenide waveguides integrated with polycrystalline PbTe detectors on a monolithic silicon platform for optical sensing, wherein the use of a low-index spacer layer enables the evanescent coupling of mid-IR light from the waveguides to the detector. Finally, we show the successful fabrication processing of our first prototype mid-IR waveguide-integrated detectors. PMID:27877641

Cyclodextrin-Containing Polymers: Versatile Platforms of Drug Delivery Materials

Directory of Open Access Journals (Sweden)

Jeremy D. Heidel

2012-01-01

Full Text Available Nanoparticles are being widely explored as potential therapeutics for numerous applications in medicine and have been shown to significantly improve the circulation, biodistribution, efficacy, and safety profiles of multiple classes of drugs. One leading class of nanoparticles involves the use of linear, cyclodextrin-containing polymers (CDPs. As is discussed in this paper, CDPs can incorporate therapeutic payloads into nanoparticles via covalent attachment of prodrug/drug molecules to the polymer (the basis of the Cyclosert platform or by noncovalent inclusion of cationic CDPs to anionic, nucleic acid payloads (the basis of the RONDEL platform. For each of these two approaches, we review the relevant molecular architecture and its rationale, discuss the physicochemical and biological properties of these nanoparticles, and detail the progress of leading drug candidates for each that have achieved clinical evaluation. Finally, we look ahead to potential future directions of investigation and product candidates based upon this technology.

Analysis of human plasma metabolites across different liquid chromatography/mass spectrometry platforms: Cross-platform transferable chemical signatures.

Science.gov (United States)

Telu, Kelly H; Yan, Xinjian; Wallace, William E; Stein, Stephen E; Simón-Manso, Yamil

2016-03-15

The metabolite profiling of a NIST plasma Standard Reference Material (SRM 1950) on different liquid chromatography/mass spectrometry (LC/MS) platforms showed significant differences. Although these findings suggest caution when interpreting metabolomics results, the degree of overlap of both profiles allowed us to use tandem mass spectral libraries of recurrent spectra to evaluate to what extent these results are transferable across platforms and to develop cross-platform chemical signatures. Non-targeted global metabolite profiles of SRM 1950 were obtained on different LC/MS platforms using reversed-phase chromatography and different chromatographic scales (conventional HPLC, UHPLC and nanoLC). The data processing and the metabolite differential analysis were carried out using publically available (XCMS), proprietary (Mass Profiler Professional) and in-house software (NIST pipeline). Repeatability and intermediate precision showed that the non-targeted SRM 1950 profiling was highly reproducible when working on the same platform (relative standard deviation (RSD) HPLC, UHPLC and nanoLC) on the same platform. A substantial degree of overlap (common molecular features) was also found. A procedure to generate consistent chemical signatures using tandem mass spectral libraries of recurrent spectra is proposed. Different platforms rendered significantly different metabolite profiles, but the results were highly reproducible when working within one platform. Tandem mass spectral libraries of recurrent spectra are proposed to evaluate the degree of transferability of chemical signatures generated on different platforms. Chemical signatures based on our procedure are most likely cross-platform transferable. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.

Platform Isolation Using Out-of-Plane Complaint Mechanisms

KAUST Repository

Arevalo, A.

2014-10-08

This paper reports the structural solid mechanic simulation of a MEMS out-of-plane platform that provides thermal and electrical isolation for a device built on it. When assemble, the platform lifted for approximately 400 μm above the substrate level. A mechanical stress analysis is then presented in order to evaluate the feasibility of building it using commonly used materials in MEMS. Our analysis showed that polymeric materials such as polyimide and SU8 may undergo a localized plastic deformation but are not likely to fail upon assembly. Polysilicon on the contrary, showed high failure probability.

Platform Isolation Using Out-of-Plane Complaint Mechanisms

KAUST Repository

Arevalo, A.; Rawashdeh, E.; Foulds, I. G.

2014-01-01

This paper reports the structural solid mechanic simulation of a MEMS out-of-plane platform that provides thermal and electrical isolation for a device built on it. When assemble, the platform lifted for approximately 400 μm above the substrate level. A mechanical stress analysis is then presented in order to evaluate the feasibility of building it using commonly used materials in MEMS. Our analysis showed that polymeric materials such as polyimide and SU8 may undergo a localized plastic deformation but are not likely to fail upon assembly. Polysilicon on the contrary, showed high failure probability.

Cross-Platform Learning: On the Nature of Children's Learning from Multiple Media Platforms

Science.gov (United States)

Fisch, Shalom M.

2013-01-01

It is increasingly common for an educational media project to span several media platforms (e.g., TV, Web, hands-on materials), assuming that the benefits of learning from multiple media extend beyond those gained from one medium alone. Yet research typically has investigated learning from a single medium in isolation. This paper reviews several…

A HUMANIZED CLINICALLY CALIBRATED QUANTITATIVE SYSTEMS PHARMACOLOGY MODEL FOR HYPOKINETIC MOTOR SYMPTOMS IN PARKINSON’S DISEASE

Directory of Open Access Journals (Sweden)

Hugo eGeerts

2016-02-01

Full Text Available The current treatment of Parkinson’s disease with dopamine-centric approaches such as L-DOPA and dopamine agonists, although very succesfull, is in need of alternative treatment strategies, both in terms of disease modification and symptom management. Various non-dopaminergic treatment approaches did not result in a clear clinical benefit, despite showing a clear effect in preclinical animal models. In addition, polypharmacy is common, sometimes leading to unintended effects on non-motor symptoms such as in cognitive and psychiatric domains. To explore novel targets for symptomatic treatment and possible synergistic pharmacodynamic effects between different drugs, we developed a Quantitative Systems Pharmacology (QSP platform of the closed cortico-striatal-thalamic-cortical basal ganglia loop of the dorsal motor circuit. This mechanism-based simulation platform is based on the known neuro-anatomy and neurophysiology of the basal ganglia and explicitly incorporates domain expertise in a formalized way. The calculated beta/gamma power ratio of the local field potential in the subthalamic nucleus correlates well (R2=0.71 with clinically observed extra-pyramidal symptoms triggered by antipsychotics during schizophrenia treatment (43 drug-dose combinations. When incorporating Parkinsonian (PD pathology and reported compensatory changes, the computer model suggests a major increase in b/g ratio (corresponding to bradykinesia and rigidity from a dopamine depletion of 70% onwards. The correlation between the outcome of the QSP model and the reported changes in UPDRS III Motor Part for 22 placebo-normalized drug-dose combinations is R2=0.84. The model also correctly recapitulates the lack of clinical benefit for perampanel, MK-0567 and flupirtine and offers a hypothesis for the translational disconnect. Finally, using human PET imaging studies with placebo response, the computer model predicts well the placebo response for chronic treatment, but not

A novel rotating experimental platform in a superconducting magnet.

Science.gov (United States)

Chen, Da; Cao, Hui-Ling; Ye, Ya-Jing; Dong, Chen; Liu, Yong-Ming; Shang, Peng; Yin, Da-Chuan

2016-08-01

This paper introduces a novel platform designed to be used in a strong static magnetic field (in a superconducting magnet). The platform is a sample holder that rotates in the strong magnetic field. Any samples placed in the platform will rotate due to the rotation of the sample holder. With this platform, a number of experiments such as material processing, culture of biological systems, chemical reactions, or other processes can be carried out. In this report, we present some preliminary experiments (protein crystallization, cell culture, and seed germination) conducted using this platform. The experimental results showed that the platform can affect the processes, indicating that it provides a novel environment that has not been investigated before and that the effects of such an environment on many different physical, chemical, or biological processes can be potentially useful for applications in many fields.

Test of Gravel to South Leg - Siri Platform

DEFF Research Database (Denmark)

Thomassen, Kristina; Ibsen, Lars Bo

A grout connection between one of the legs of the offshore platform, Siri, and a water caisson at the seabed is failed. The failure leaves a gap in the grout connection meaning that the stiffness of the connection is disappeared resulting in movements of the platform. These movements cause cracks...... in the caisson, hence, the stiffness of the connection must be re-established. In this report the effect of filling a sand material into the gap in the grout connection is investigated. Four types of sand materials is tested; Sand 0-8 mm, Norit 0-2 mm, Norit 0-5 mm, and Sand 0.4-5.6 mm. The comparison...

Robotic platform for traveling on vertical piping network

Science.gov (United States)

Nance, Thomas A; Vrettos, Nick J; Krementz, Daniel; Marzolf, Athneal D

2015-02-03

This invention relates generally to robotic systems and is specifically designed for a robotic system that can navigate vertical pipes within a waste tank or similar environment. The robotic system allows a process for sampling, cleaning, inspecting and removing waste around vertical pipes by supplying a robotic platform that uses the vertical pipes to support and navigate the platform above waste material contained in the tank.

Transformation optics on a silicon platform

International Nuclear Information System (INIS)

Gabrielli, Lucas H; Lipson, Michal

2011-01-01

Transformation optics allows the creation of innovative devices; however, its implementation in the optical domain remains challenging. We describe here our process to design and fabricate such devices using silicon as a platform for broad band operation in the optical domain. We discuss the approximations and methods employed to overcome the challenges of using dielectric materials as a platform for transformation optics, such as the anisotropy and gradient refractive index implementation. These encompass conformal and quasi-conformal mappings, and a dithering process to discretize and quantize the continuously inhomogeneous index function. We show examples of devices that we fabricated and tested, including the carpet invisibility cloak, a broad bandwidth light concentrator, and a perfect imaging device, known as Maxwell's fish eye lens. Finally, we touch on future directions under investigation to further develop transformation optics based on dielectric materials

Design and simulation of material-integrated distributed sensor processing with a code-based agent platform and mobile multi-agent systems.

Science.gov (United States)

Bosse, Stefan

2015-02-16

Multi-agent systems (MAS) can be used for decentralized and self-organizing data processing in a distributed system, like a resource-constrained sensor network, enabling distributed information extraction, for example, based on pattern recognition and self-organization, by decomposing complex tasks in simpler cooperative agents. Reliable MAS-based data processing approaches can aid the material-integration of structural-monitoring applications, with agent processing platforms scaled to the microchip level. The agent behavior, based on a dynamic activity-transition graph (ATG) model, is implemented with program code storing the control and the data state of an agent, which is novel. The program code can be modified by the agent itself using code morphing techniques and is capable of migrating in the network between nodes. The program code is a self-contained unit (a container) and embeds the agent data, the initialization instructions and the ATG behavior implementation. The microchip agent processing platform used for the execution of the agent code is a standalone multi-core stack machine with a zero-operand instruction format, leading to a small-sized agent program code, low system complexity and high system performance. The agent processing is token-queue-based, similar to Petri-nets. The agent platform can be implemented in software, too, offering compatibility at the operational and code level, supporting agent processing in strong heterogeneous networks. In this work, the agent platform embedded in a large-scale distributed sensor network is simulated at the architectural level by using agent-based simulation techniques.

Design and Simulation of Material-Integrated Distributed Sensor Processing with a Code-Based Agent Platform and Mobile Multi-Agent Systems

Directory of Open Access Journals (Sweden)

Stefan Bosse

2015-02-01

Full Text Available Multi-agent systems (MAS can be used for decentralized and self-organizing data processing in a distributed system, like a resource-constrained sensor network, enabling distributed information extraction, for example, based on pattern recognition and self-organization, by decomposing complex tasks in simpler cooperative agents. Reliable MAS-based data processing approaches can aid the material-integration of structural-monitoring applications, with agent processing platforms scaled to the microchip level. The agent behavior, based on a dynamic activity-transition graph (ATG model, is implemented with program code storing the control and the data state of an agent, which is novel. The program code can be modified by the agent itself using code morphing techniques and is capable of migrating in the network between nodes. The program code is a self-contained unit (a container and embeds the agent data, the initialization instructions and the ATG behavior implementation. The microchip agent processing platform used for the execution of the agent code is a standalone multi-core stack machine with a zero-operand instruction format, leading to a small-sized agent program code, low system complexity and high system performance. The agent processing is token-queue-based, similar to Petri-nets. The agent platform can be implemented in software, too, offering compatibility at the operational and code level, supporting agent processing in strong heterogeneous networks. In this work, the agent platform embedded in a large-scale distributed sensor network is simulated at the architectural level by using agent-based simulation techniques.

Membrane-based biomolecular smart materials

International Nuclear Information System (INIS)

Sarles, Stephen A; Leo, Donald J

2011-01-01

Membrane-based biomolecular materials are a new class of smart material that feature networks of artificial lipid bilayers contained within durable synthetic substrates. Bilayers contained within this modular material platform provide an environment that can be tailored to host an enormous diversity of functional biomolecules, where the functionality of the global material system depends on the type(s) and organization(s) of the biomolecules that are chosen. In this paper, we review a series of biomolecular material platforms developed recently within the Leo Group at Virginia Tech and we discuss several novel coupling mechanisms provided by these hybrid material systems. The platforms developed demonstrate that the functions of biomolecules and the properties of synthetic materials can be combined to operate in concert, and the examples provided demonstrate how the formation and properties of a lipid bilayer can respond to a variety of stimuli including mechanical forces and electric fields

QUALIFICAÇÁO PROFISSIONAL PARA O EMPREENDEDORISMO: uma alternativa ao desemprego?

Directory of Open Access Journals (Sweden)

Geórgia Patrícia Guimarães dos Santos

2006-01-01

Full Text Available The analyse the development of the Qualification State Plan (QSP in the state of Ceará, in Brazil, based on the testimony of some of the involved parIs (education institutioris and the State Secretariat of Labor in its performance. lt includes the performance process of this Plan as of its most important goal: focusing ot lhe vocation education courses on the demand of lhe labor market in the state of Ceará. This study based on lhe articulation between the literature on lhe relationship between labor and education, within the scope of lhe later changes on international capitalism and on lhe organizalion of labor, and lhe reflections lhat approaches labor force education policies, Iocusing on QSP and the elements collected in lhe interviews carried oul with the QSP administralor agencies of lhe state of Ceará and the executor group that took part in the program, as well as those included by means of reading and analysis oflicial documents.

Build platform that provides mechanical engagement with additive manufacturing prints

Science.gov (United States)

Elliott, Amelia M.

2018-03-06

A build platform and methods of fabricating an article with such a platform in an extrusion-type additive manufacturing machine are provided. A platform body 202 includes features 204 that extend outward from the body 202. The features 204 define protrusive areas 206 and recessive areas 208 that cooperate to mechanically engage the extruded material that forms the initial layers 220 of an article when the article is being fabricated by a nozzle 12 of the additive manufacturing machine 10.

Brush-Like Polymers: New Design Platforms for Soft, Dry Materials with Unique Property Relations

Science.gov (United States)

Daniel, William Francis McKemie, Jr.

Elastomers represent a unique class of engineering materials due to their light weight, low cost, and desirable combination of softness (105 -107 Pa) and large extensibilities (up to 1000%). Despite these advantages, there exist applications that require many times softer modulus, greater extensibility, and stronger strain hardening for the purpose of mimicking the mechanical properties of systems such as biological tissues. Until recently, only liquid-filled gels were suitable materials for such applications, including soft robotics and implants. A considerable amount of work has been done to create gels with superior properties, but despite unique strengths they also suffer from unique weaknesses. This class of material displays fundamental limitations in the form of heterogeneous structures, solvent loss and phase transitions at extreme temperatures, and loss of liquid fraction upon high deformations. In gels the solvent fraction also introduces a large solvent/polymer interaction parameter which must be carefully considered when designing the final mechanical properties. These energetic considerations further exaggerate the capacity for inconstant mechanical properties caused by fluctuations of the solvent fraction. In order to overcome these weaknesses, a new platform for single component materials with low modulus (Standard networks have one major control factor outside of chemistry, the network stand length. Brush-like architectures are created from long strands with regularly grafted side chains creating three characteristic length scales which may be independently manipulated. In collaboration with M. Rubinstein, we have utilized bottlebrush polymer architectures (a densely grafted brush-like polymer) to experimentally verify theoretical predictions of disentangled bottlebrush melts. By attaching well-defined side chains onto long polymer backbones, individual polymer strands are separated in space (similar to dilution with solvent) accompanied by a

The mid-IR silicon photonics sensor platform (Conference Presentation)

Science.gov (United States)

Kimerling, Lionel; Hu, Juejun; Agarwal, Anuradha M.

2017-02-01

Advances in integrated silicon photonics are enabling highly connected sensor networks that offer sensitivity, selectivity and pattern recognition. Cost, performance and the evolution path of the so-called `Internet of Things' will gate the proliferation of these networks. The wavelength spectral range of 3-8um, commonly known as the mid-IR, is critical to specificity for sensors that identify materials by detection of local vibrational modes, reflectivity and thermal emission. For ubiquitous sensing applications in this regime, the sensors must move from premium to commodity level manufacturing volumes and cost. Scaling performance/cost is critically dependent on establishing a minimum set of platform attributes for point, wearable, and physical sensing. Optical sensors are ideal for non-invasive applications. Optical sensor device physics involves evanescent or intra-cavity structures for applied to concentration, interrogation and photo-catalysis functions. The ultimate utility of a platform is dependent on sample delivery/presentation modalities; system reset, recalibration and maintenance capabilities; and sensitivity and selectivity performance. The attributes and performance of a unified Glass-on-Silicon platform has shown good prospects for heterogeneous integration on materials and devices using a low cost process flow. Integrated, single mode, silicon photonic platforms offer significant performance and cost advantages, but they require discovery and qualification of new materials and process integration schemes for the mid-IR. Waveguide integrated light sources based on rare earth dopants and Ge-pumped frequency combs have promise. Optical resonators and waveguide spirals can enhance sensitivity. PbTe materials are among the best choices for a standard, waveguide integrated photodetector. Chalcogenide glasses are capable of transmitting mid-IR signals with high transparency. Integrated sensor case studies of i) high sensitivity analyte detection in

Short implants with a nanometer-sized CaP surface provided with either a platform-switched or platform-matched abutment connection in the posterior region : a randomized clinical trial

NARCIS (Netherlands)

Telleman, G.; Meijer, H. J. A.; Vissink, A.; Raghoebar, G. M.

2013-01-01

ObjectiveTo assess the performance of short nanorough implants (8.5mm in length) provided with either a platform-matched or a platform-switched implant-abutment connection, placed in the resorbed posterior region of partially dentate patients. Materials and MethodsA total of 149 implants with a

Contribution of prototypic material tests on the Plinius platform to the study of nuclear reactor severe accident

International Nuclear Information System (INIS)

Journeau, Ch.

2008-01-01

The PLINIUS experimental platform at CEA Cadarache is dedicated to the experimental study of nuclear reactor severe accidents thanks to experiments between 2000 and 3500 K with prototypic corium. Corium is the mixture that would be formed by an hypothetical core melting and its mixing with structural materials. Prototypical corium has the same chemical composition as the corium corresponding to a given accident scenario but has a different isotopic composition (use of depleted uranium,...). Research programs and test series have been performed to study corium thermophysical properties, fission product behaviour, corium spreading, solidification and interaction with concrete as well as its coolability. It was the frame of research training of many students and was realized within national, European and international collaborations. (author)

An Ultra-Efficient Nonlinear Platform: AlGaAs-On-Insulator

DEFF Research Database (Denmark)

Pu, Minhao; Ottaviano, Luisa; Semenova, Elizaveta

The combination of nonlinear and integrated photonics enables applications including optical signal processing, multi-wavelength lasers, metrology, spectroscopy, and quantum information science. Silicon-on-insulator (SOI) has emerged as a promising platform [1, 2] due to its high material...... nonlinearity and its compatibility with the CMOS industry. However, silicon suffers two-photon absorption (TPA) in the telecommunication wavelength band around 1.55 µm, which hampers its applications. Different platforms have been proposed to avoid TPA in the telecom wavelength range such as Si3N4 and Hydex [3...... a nonlinear index (n2) on the order of 10−17 W/m2 and a high refractive index (n ≈3.3), a large transparency window (from near- to mid-infrared), and the ability to engineer the material bandgap to mitigate TPA [5]. In this presentation, we introduce AlGaAson-insulator (AlGaAsOI) platform which combines both...

On the compressive behavior of an FDM Steward Platform part

Directory of Open Access Journals (Sweden)

Nectarios Vidakis

2017-10-01

Full Text Available Acrylonitrile–butadiene–styrene (ABS is commonly used material in the fused deposition modeling (FDM process. In this work, ABS and ABS plus parts were built with different building parameters and they were tested according to the ASTM D695 standard. Compression strength results were compared to stock ABS material values. The fracture surfaces of selected specimens were examined under a Scanning Electron Microscope (SEM, to determine the failure mode of the filament strands. Following this a Steward Platform part was tested under compression in a tensile testing machine. The experimental results were employed to develop a finite element model of the Steward Platform part, in order to determine the maximum force the part can withstand. The Finite Element Model results were in good agreement with the values measured in the Steward Platform part compressive tests, demonstrating that the model developed is reliable. In these experiments, it was found that ABS parts build with a larger layer thickness showed lower compressive strength, which ABS plus did not show. ABS specimens on average developed about half the compressive strength of the ABS plus specimens, while the ABS plus specimens showed lower compressive strength values than stock ABS material.

Payment Platform

DEFF Research Database (Denmark)

Hjelholt, Morten; Damsgaard, Jan

2012-01-01

thoroughly and substitute current payment standards in the decades to come. This paper portrays how digital payment platforms evolve in socio-technical niches and how various technological platforms aim for institutional attention in their attempt to challenge earlier platforms and standards. The paper...... applies a co-evolutionary multilevel perspective to model the interplay and processes between technology and society wherein digital payment platforms potentially will substitute other payment platforms just like the credit card negated the check. On this basis this paper formulate a multilevel conceptual...

Using a blog as an integrated eLearning tool and platform.

Science.gov (United States)

Goh, Poh Sun

2016-06-01

Technology enhanced learning or eLearning allows educators to expand access to educational content, promotes engagement with students and makes it easier for students to access educational material at a time, place and pace which suits them. The challenge for educators beginning their eLearning journey is to decide where to start, which includes the choice of an eLearning tool and platform. This article will share one educator's decision making process, and experience using blogs as a flexible and versatile integrated eLearning tool and platform. Apart from being a cost effective/free tool and platform, blogs offer the possibility of creating a hyperlinked indexed content repository, for both created and curated educational material; as well as a distribution and engagement tool and platform. Incorporating pedagogically sound activities and educational practices into a blog promote a structured templated teaching process, which can be reproduced. Moving from undergraduate to postgraduate training, educational blogs supported by a comprehensive online case-based repository offer the possibility of training beyond competency towards proficiency and expert level performance through a process of deliberate practice. By documenting educational content and the student engagement and learning process, as well as feedback and personal reflection of educational sessions, blogs can also form the basis for a teaching portfolio, and provide evidence and data of scholarly teaching and educational scholarship. Looking into the future, having a collection of readily accessible indexed hyperlinked teaching material offers the potential to do on the spot teaching with illustrative material called up onto smart surfaces, and displayed on holographic interfaces.

Messages with Impact: Creativity in Traditional Outdoor Advertising Platforms in Castellón

OpenAIRE

Breva Franch, Eva; Balado Albiol, Consuelo; Rutherford

2013-01-01

Outdoor advertising is currently undergoing a transformation as both the variety and popularity of digital platforms increases. This will inevitably involve significant changes in both the conception and production of advertising materials designed for digital platforms, including ‘smartboards’. Notwithstanding the technological advantages of outdoor digital advertising platforms (such as the means to incorporate motion) in attracting the attention of audiences, as a consequence of the cost o...

Reduction of Tribocorrosion Products When using the Platform-Switching Concept.

Science.gov (United States)

Alrabeah, G O; Knowles, J C; Petridis, H

2018-03-01

The reduced marginal bone loss observed when using the platform-switching concept may be the result of reduced amounts of tribocorrosion products released to the peri-implant tissues. Therefore, the purpose of this study was to compare the tribocorrosion product release from various platform-matched and platform-switched implant-abutment couplings under cyclic loading. Forty-eight titanium implants were coupled with pure titanium, gold alloy, cobalt-chrome alloy, and zirconia abutments forming either platform-switched or platform-matched groups ( n = 6). The specimens were subjected to cyclic occlusal forces in a wet acidic environment for 24 h followed by static aqueous immersion for 6 d. The amount of metal ions released was measured using inductively coupled plasma mass spectrometry. Microscopic evaluations were performed pre- and postimmersion under scanning electron microscope (SEM) equipped with energy-dispersive spectroscopy X-ray for corrosion assessment at the interface and wear particle characterization. All platform-switched groups showed less metal ion release compared with their platform-matched counterparts within each abutment material group ( P concept in the reduction of tribocorrosion products released from dental implants, which consequently may minimize the adverse tissue reactions that lead to peri-implant bone loss.

A Platform for Manufacturable Stretchable Micro-electrode Arrays

NARCIS (Netherlands)

Khoshfetrat Pakazad, S.; Savov, A.; Braam, S.R.; Dekker, R.

2012-01-01

A platform for the batch fabrication of pneumatically actuated Stretchable Micro-Electrode Arrays (SMEAs) by using state-of-the-art micro-fabrication techniques and materials is demonstrated. The proposed fabrication process avoids the problems normally associated with processing of thin film

Product Platform Performance

DEFF Research Database (Denmark)

Munk, Lone

The aim of this research is to improve understanding of platform-based product development by studying platform performance in relation to internal effects in companies. Platform-based product development makes it possible to deliver product variety and at the same time reduce the needed resources...... engaging in platform-based product development. Similarly platform assessment criteria lack empirical verification regarding relevance and sufficiency. The thesis focuses on • the process of identifying and estimating internal effects, • verification of performance of product platforms, (i...... experienced representatives from the different life systems phase systems of the platform products. The effects are estimated and modeled within different scenarios, taking into account financial and real option aspects. The model illustrates and supports estimation and quantification of internal platform...

Commentary: The Materials Project: A materials genome approach to accelerating materials innovation

Directory of Open Access Journals (Sweden)

Anubhav Jain

2013-07-01

Full Text Available Accelerating the discovery of advanced materials is essential for human welfare and sustainable, clean energy. In this paper, we introduce the Materials Project (www.materialsproject.org, a core program of the Materials Genome Initiative that uses high-throughput computing to uncover the properties of all known inorganic materials. This open dataset can be accessed through multiple channels for both interactive exploration and data mining. The Materials Project also seeks to create open-source platforms for developing robust, sophisticated materials analyses. Future efforts will enable users to perform ‘‘rapid-prototyping’’ of new materials in silico, and provide researchers with new avenues for cost-effective, data-driven materials design.

Reconstruction theorem for a quantum stochastic process

International Nuclear Information System (INIS)

Belavkin, V.P.

1985-01-01

This paper gives a physically interpretable--in real time--definition of a QSP as families of representations of the observable algebra 'B' in a common (large) system by indicating a universal method of constructing such a system from casual correlation operators described by the axioms formulated in the paper. The authors encompass in a unified manner both nonrelativistic and relativistic covariant QSPs describing open quantum systems and fields in a causally ordered region accessible to observation. The principle of nondestruction by successive measurements of a QSP of a given quantum subsystem is also taken into account

Improvement in the amine glass platform by bubbling method for a DNA microarray.

Science.gov (United States)

Jee, Seung Hyun; Kim, Jong Won; Lee, Ji Hyeong; Yoon, Young Soo

2015-01-01

A glass platform with high sensitivity for sexually transmitted diseases microarray is described here. An amino-silane-based self-assembled monolayer was coated on the surface of a glass platform using a novel bubbling method. The optimized surface of the glass platform had highly uniform surface modifications using this method, as well as improved hybridization properties with capture probes in the DNA microarray. On the basis of these results, the improved glass platform serves as a highly reliable and optimal material for the DNA microarray. Moreover, in this study, we demonstrated that our glass platform, manufactured by utilizing the bubbling method, had higher uniformity, shorter processing time, lower background signal, and higher spot signal than the platforms manufactured by the general dipping method. The DNA microarray manufactured with a glass platform prepared using bubbling method can be used as a clinical diagnostic tool.

The Platformization of the Web: Making Web Data Platform Ready

NARCIS (Netherlands)

Helmond, A.

2015-01-01

In this article, I inquire into Facebook’s development as a platform by situating it within the transformation of social network sites into social media platforms. I explore this shift with a historical perspective on, what I refer to as, platformization, or the rise of the platform as the dominant

Paper based electronics platform

KAUST Repository

Nassar, Joanna Mohammad

2017-07-20

A flexible and non-functionalized low cost paper-based electronic system platform fabricated from common paper, such as paper based sensors, and methods of producing paper based sensors, and methods of sensing using the paper based sensors are provided. A method of producing a paper based sensor can include the steps of: a) providing a conventional paper product to serve as a substrate for the sensor or as an active material for the sensor or both, the paper product not further treated or functionalized; and b) applying a sensing element to the paper substrate, the sensing element selected from the group consisting of a conductive material, the conductive material providing contacts and interconnects, sensitive material film that exhibits sensitivity to pH levels, a compressible and/or porous material disposed between a pair of opposed conductive elements, or a combination of two of more said sensing elements. The method of sensing can further include measuring, using the sensing element, a change in resistance, a change in voltage, a change in current, a change in capacitance, or a combination of any two or more thereof.

Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

Science.gov (United States)

Claisse, Jeremy T; Pondella, Daniel J; Love, Milton; Zahn, Laurel A; Williams, Chelsea M; Bull, Ann S

2015-01-01

When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

Directory of Open Access Journals (Sweden)

Jeremy T Claisse

Full Text Available When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes. "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

Knowledge platform for calculating climate impact from construction and building materials. Literature study; Kunnskapsplattform for beregning av klimabelastning fra bygg og byggematerialer. Litteraturstudie

Energy Technology Data Exchange (ETDEWEB)

Roenning, Anne; Lyng, Kari-Anne; Vold, Mie

2011-07-01

Greenhouse gas emissions from building linked today to a large extent to the energy consumption during the operating period. Through increasingly stringent energy requirements and other changes, the energy consumption for the operation could go down over time. This means in this case that the energy required to produce, transport and set up the building, to a greater extent can be relatively more important in a life-cycle analysis. KRD in that regard ha given Oestfoldforskning the commission to conduct a literature study that will provide an overview and assessment of the literature / research papers describing various building materials climate impact and how this translates into a lifetime (LCA - Life Cycle Assessment), and thus describe the knowledge platform these analyzes are based in. It also means a description of the factors that affect the climate and the environment, including the stages of life that are important. Literature study is conducted by searching scientific databases (Springer Link, Science Direct, Google Scholar, Norwegian EPD database of declarations). The literature search is limited to studies that are based on LCA as a methodology for calculating the climate impacts associated with the construction and building materials. Based on the review of literature is also undertaken an analysis focusing on explaining the methodological platform between the studies are based on, in order to explain why the results differ and / or may not be comparable.(eb)

Effectiveness of a digital platform for sharing knowledge on headache management: a two-year experience.

Science.gov (United States)

Raieli, Vincenzo; Correnti, E; Sandullo, A; Romano, M; Marchese, F; Loiacono, C; Brighina, Filippo

It is crucial that all headache specialists receive adequate training. Considering the unsatisfactory results obtained with standard updating courses and the growing need for continuing professional education, a digital platform was developed as a training tool. The platform has been active since 1 October 2014. It is readily accessible to doctors by free registration. Users have access to all the material available on the platform, which includes scientific articles, e-books, presentations and images. Users can share their own material and clinical cases directly. At the time of this study, the platform had 37 users. In the second year following its launch 316 files were downloaded and five discussions were started. These saw 22 contributions. Fifteen of the 37 members did not perform any action on the platform. In total, 74 files were uploaded in the second year of activity, but 90% of the contributions came from a very small group of users. There were no significant differences in use of the platform between members of the Italian Society for the Study of Headache and other specialists. Even though the platform appears to be an easily accessible, interactive and inexpensive instrument, the higher number of downloads than uploads suggests that it is used passively.

OTEC Cold Water Pipe-Platform Subsystem Dynamic Interaction Validation

Energy Technology Data Exchange (ETDEWEB)

Varley, Robert [Lockheed Martin Corporation, Manassas, VA (United States); Halkyard, John [John Halkyard and Associates, Houston, TX (United States); Johnson, Peter [BMT Scientific Marine Services, Inc., Houston, TX (United States); Shi, Shan [Houston Offshore Engineering, Houston, TX (United States); Marinho, Thiago [Federal Univ. of Rio de Janeiro (Brazil). LabOceano

2014-05-09

A commercial floating 100-megawatt (MW) ocean thermal energy conversion (OTEC) power plant will require a cold water pipe (CWP) with a diameter of 10-meter (m) and length of up to 1,000 m. The mass of the cold water pipe, including entrained water, can exceed the mass of the platform supporting it. The offshore industry uses software-modeling tools to develop platform and riser (pipe) designs to survive the offshore environment. These tools are typically validated by scale model tests in facilities able to replicate real at-sea meteorological and ocean (metocean) conditions to provide the understanding and confidence to proceed to final design and full-scale fabrication. However, today’s offshore platforms (similar to and usually larger than those needed for OTEC applications) incorporate risers (or pipes) with diameters well under one meter. Secondly, the preferred construction method for large diameter OTEC CWPs is the use of composite materials, primarily a form of fiber-reinforced plastic (FRP). The use of these material results in relatively low pipe stiffness and large strains compared to steel construction. These factors suggest the need for further validation of offshore industry software tools. The purpose of this project was to validate the ability to model numerically the dynamic interaction between a large cold water-filled fiberglass pipe and a floating OTEC platform excited by metocean weather conditions using measurements from a scale model tested in an ocean basin test facility.

Fiscal 1999 achievement report on interuniversity coordination type research and development of industrial technology. Research and development of highly functional material designing platform; 1999 nendo kokino zairyo sekkei platform no kenkyu kaihatsu seika hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

For the purpose of enabling prediction of structures and properties of polymeric materials by computer-assisted experiments, studies were conducted for putting new simulation technologies to practical application. Simulation technologies underwent research and development with working groups respectively dealing with the coarse-graining molecular dynamic method, dynamic mean field method, dispersed structure simulation, study of verification, and platform. The Faculty of Engineering, Yamagata University, succeeded in the development of a device enabling direct observation of crystallization under shear flow, which was for the construction of a material property database. The Graduate School of Frontier Sciences, University of Tokyo, developed a device for measuring dielectric relaxation under shear flow, by which findings were obtained concerning ion fluctuation and diffusion in a micellar system. The Institute of Industrial Science, University of Tokyo, studied pattern formation dynamics which involved viscoelastic phase separation in a polymeric solution whose composition was near critical. (NEDO)

Cross-Platform Technologies

Directory of Open Access Journals (Sweden)

Maria Cristina ENACHE

2017-04-01

Full Text Available Cross-platform - a concept becoming increasingly used in recent years especially in the development of mobile apps, but this consistently over time and in the development of conventional desktop applications. The notion of cross-platform software (multi-platform or platform-independent refers to a software application that can run on more than one operating system or computing architecture. Thus, a cross-platform application can operate independent of software or hardware platform on which it is execute. As a generic definition presents a wide range of meanings for purposes of this paper we individualize this definition as follows: we will reduce the horizon of meaning and we use functionally following definition: a cross-platform application is a software application that can run on more than one operating system (desktop or mobile identical or in a similar way.

Platform Performance and Challenges - using Platforms in Lego Company

DEFF Research Database (Denmark)

Munk, Lone; Mortensen, Niels Henrik

2009-01-01

needs focus on the incentive of using the platform. This problem lacks attention in literature, as well as industry, where assessment criteria do not cover this aspect. Therefore, we recommend including user incentive in platform assessment criteria to these challenges. Concrete solution elements...... ensuring user incentive in platforms is an object for future research...

The implementation of Moodle platform through lecturer’s perspectives at English department

Directory of Open Access Journals (Sweden)

Tazkiyatunnafs Elhawwa

2017-09-01

Full Text Available Information and Communication Technology is now becoming an essential part of everyday life of most people in the world. This paper analysed the main functionalities and tools available in the Moodle platform and their use through lecturer’s perspectives at English Department of IAIN Palangka Raya. This  study belongs to descriptive qualitative research. In the present study, teachers are expected to implement the Moodle platform of Information, Communication and Technology (ICT in EFL classes, and make the Moodle platform of ICT becoming a complement to conventional teaching in EFL classrooms, especially when developing listening, reading and writing skills in English. The results showed that the Moodle platform contains some of the main tools of the standard Moodle platform like assignments, chats, forums, news and quiz/survey. The most the students purposes of the use of the Moodle platform were ‘download materials’, ‘news’ and ‘deliver assignments’, and the most used information materials are ‘texts’ and ‘slides’.

A review of simulation platforms in surgery of the temporal bone.

Science.gov (United States)

Bhutta, M F

2016-10-01

Surgery of the temporal bone is a high-risk activity in an anatomically complex area. Simulation enables rehearsal of such surgery. The traditional simulation platform is the cadaveric temporal bone, but in recent years other simulation platforms have been created, including plastic and virtual reality platforms. To undertake a review of simulation platforms for temporal bone surgery, specifically assessing their educational value in terms of validity and in enabling transition to surgery. Systematic qualitative review. Search of the Pubmed, CINAHL, BEI and ERIC databases. Assessment of reported outcomes in terms of educational value. A total of 49 articles were included, covering cadaveric, animal, plastic and virtual simulation platforms. Cadaveric simulation is highly rated as an educational tool, but there may be a ceiling effect on educational outcomes after drilling 8-10 temporal bones. Animal models show significant anatomical variation from man. Plastic temporal bone models offer much potential, but at present lack sufficient anatomical or haptic validity. Similarly, virtual reality platforms lack sufficient anatomical or haptic validity, but with technological improvements they are advancing rapidly. At present, cadaveric simulation remains the best platform for training in temporal bone surgery. Technological advances enabling improved materials or modelling mean that in the future plastic or virtual platforms may become comparable to cadaveric platforms, and also offer additional functionality including patient-specific simulation from CT data. © 2015 John Wiley & Sons Ltd.

Platform Constellations

DEFF Research Database (Denmark)

Staykova, Kalina Stefanova; Damsgaard, Jan

2016-01-01

This research paper presents an initial attempt to introduce and explain the emergence of new phenomenon, which we refer to as platform constellations. Functioning as highly modular systems, the platform constellations are collections of highly connected platforms which co-exist in parallel and a......’ acquisition and users’ engagement rates as well as unlock new sources of value creation and diversify revenue streams....

Design and Promotion Strategy of Marketing Platform of Aquatic Auction based on Internet

Science.gov (United States)

Peng, Jianliang

For the online trade and promotion of aquatic products and related materials through the network between supply and demand, the design content and effective promotional strategies of aquatic auctions online marketing platform is proposed in this paper. Design elements involve the location of customer service, the basic function of the platform including the purchase of general orders, online auctions, information dissemination, and recommendation of fine products, human services, and payment preferences. Based on network and mobile e-commerce transaction support, the auction platform makes the transaction of aquatic products well in advance. The results are important practical value for the design and application of online marketing platform of aquatic auction.

Novel Robotic Platforms for the Accurate Sampling and Monitoring of Water Columns

Directory of Open Access Journals (Sweden)

Roemi Fernández

2016-08-01

Full Text Available The hydrosphere contains large amounts of suspended particulate material, including living and non-living material that can be found in different compositions and concentrations, and that can be composed of particles of different sizes. The study of this particulate material along water columns plays a key role in understanding a great variety of biological, chemical, and physical processes. This paper presents the conceptual design of two patented robotic platforms that have been conceived for carrying out studies of water properties at desired depths with very high accuracy in the vertical positioning. One platform has been specially designed for operating near to a reservoir bottom, while the other is intended to be used near the surface. Several experimental tests have been conducted in order to validate the proposed approaches.

Continuous Platform Development

DEFF Research Database (Denmark)

Nielsen, Ole Fiil

low risks and investments but also with relatively fuzzy results. When looking for new platform projects, it is important to make sure that the company and market is ready for the introduction of platforms, and to make sure that people from marketing and sales, product development, and downstream......, but continuous product family evolution challenges this strategy. The concept of continuous platform development is based on the fact that platform development should not be a one-time experience but rather an ongoing process of developing new platforms and updating existing ones, so that product family...

Comparison of two lecture delivery platforms in a hybrid distance education program.

Science.gov (United States)

Ried, L Douglas; Byers, Katherine

2009-08-28

To compare students' preferences for and academic performance using 2 different distance education course content delivery platforms. A randomized, crossover research design was used to compare traditional video with a 4-panel platform among learners on multiple campuses within 1 college of pharmacy.(1) The outcomes were students' preferences for delivery platform and examination scores. Rasch analysis was used to assess unidimensionality and the difficulty of examination items. Hierarchical logistic and multiple regression models were used to assess students' preferences and academic performance. The logistic model predicting preference for the 4-panel or traditional platform was not significant, but African-Americans and Hispanics were more likely to prefer the 4-panel platform than Caucasian and Asian students. The delivery platform did not impact students' academic performance. Students who did well on the semester's previous 2 examinations scored higher on the questions related to schizophrenia. Students with higher Pharmacy College Admission Test (PCAT) scores performed better on the bipolar questions than students who preferred the traditional video platform. The additional faculty time, effort, and cost invested in presenting the class material in a 4-panel platform, and the students' extra time and effort spent viewing the 4-panel platform did not produce a comparable benefit in student preference and performance.

Challenges in Implementing IAEA National Nuclear Safety Knowledge Platforms

International Nuclear Information System (INIS)

Samba, R.N.; Simo, A.

2016-01-01

Full text: Integrated Management Systems and human resource development of nuclear knowledge have always been a challenge for developing countries. NRPA staff when trained by IAEA return and restitute with all colleagues the themes acquired in nuclear knowledge. NRPA became a member of Forum for Nuclear Regulatory Bodies in Africa (FNRBA) in 2009. FNRBA organized with IAEA a workshop from 14th to 18th October 2013 in Nairobi, Kenya on Knowledge Safety Network. NRPA of Cameroon created the first National Nuclear Portail under FNRBA. This was linked to other national websites. During the IAEA review missions, most counterparts took opportunity from the thermatic site to share information and develop advance reference materials. The IAEA Integrated Regulatory Review Service (IRRS) team also shared materials that could not be transferred through email with national counterparts using the Global Nuclear Safety and Security Network (GNSSN) sharepoint website due to large file sizes.The regulatory documents have been uploaded on the platform and can be accessed through FNRBA and NRPA website (www.anrp.cm). UN organizations implementing projects in Cameroon are also linked to the platform. The action plans and progress reports for IAEA/AFRA projects are also available. Moreover, NRPA regulatory activities and licensing sources are available on this platform. (author

Apparatus and method for materials processing utilizing a rotating magnetic field

Science.gov (United States)

Muralidharan, Govindarajan; Angelini, Joseph A.; Murphy, Bart L.; Wilgen, John B.

2017-04-11

An apparatus for materials processing utilizing a rotating magnetic field comprises a platform for supporting a specimen, and a plurality of magnets underlying the platform. The plurality of magnets are configured for rotation about an axis of rotation intersecting the platform. A heat source is disposed above the platform for heating the specimen during the rotation of the plurality of magnets. A method for materials processing utilizing a rotating magnetic field comprises providing a specimen on a platform overlying a plurality of magnets; rotating the plurality of magnets about an axis of rotation intersecting the platform, thereby applying a rotating magnetic field to the specimen; and, while rotating the plurality of magnets, heating the specimen to a desired temperature.

Fiscal 1999 achievement report on interuniversity coordination type research and development of industrial technology. Research and development of highly functional material designing platform; 1999 nendo kokino zairyo sekkei platform no kenkyu kaihatsu seika hokokusho. Energy shiyo gorika gijutsu kaihatsu

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

For the purpose of enabling prediction of structures and properties of polymeric materials by computer-assisted experiments, studies were conducted for putting new simulation technologies to practical application. With the coarse-graining molecular dynamic method working group, a coarse-graining molecular dynamic engine high in generality and augmentability was developed so that an optimum coarse-graining model might be chosen and constructed to achieve any given purpose, and its installation was almost completed. The dynamic mean field method working group fabricated a new general-purpose simulator with its interface simplified and function improved. A simulation technique was also developed, which would be incorporated into the general-purpose simulator. The dispersed structure simulation working group developed a group of class libraries for use in continuum simulation. The platform working group, making use of Java excellent in general-purpose feature, worked out a function verification platform to run on Windows95/98/NT. (NEDO)

OrbusNeich fully absorbable coronary stent platform incorporating dual partitioned coatings.

Science.gov (United States)

Cottone, Robert J; Thatcher, G Lawrence; Parker, Sherry P; Hanks, Laurence; Kujawa, David A; Rowland, Stephen M; Costa, Marco; Schwartz, Robert S; Onuma, Yoshinobu

2009-12-15

The field of stent based tissue engineering continues to revolutionise modern medicine by designing novel materials to restore vascular tissue function. Accordingly, the following discussion examines a novel, absorbable, polymeric scaffold engineered in combination with dual therapeutic coating, enabling locally administered temporary scaffolding in the coronary arteries for long term vascular patency and repair. This coronary stent platform consists of an absorbable polymeric material stent structure that incorporates a dual partitioned coating, by means of pro-healing EPC (endothelial progenitor cell) capture technology allowing for rapid endothelial coverage, and an absorbable polymer matrix with sustained elution of sirolimus, a drug controlling neointimal proliferation. This paper provides a brief overview of the various innovations developed by OrbusNeich to create this fully absorbable coronary device platform.

The Jules Horowitz nuclear complex a plat-form for research and development on nuclear fuel and materials for the 21st century

International Nuclear Information System (INIS)

Ballagny, A.; Bouilloux, Y.; Chantoin, P.; Iracane, D.

2001-01-01

The CEA intends to build a material test reactor at Cadarache (South of France). This reactor would be the central piece of a wider complex which would include experimental fuel fabrication, destructive and non destructive examinations, in-reactor on line measurement advanced methods and modelling. For 50 years this platform would provide the necessary knowledge to the nuclear industry, the safety authority and to the national decision makers. This material test reactor called Jules Horowitz reactor (JHR) could be a key facility for industry and the central component of the European research area on nuclear fission from 2010. In this paper an overview of the research complex is given and a first approach of the development effort undertaken to meet the requirements in term of : ''time to result, experimental cost, experiment quality and international co-operation. Finally are given several ways of technical development undertaken to meet the above requirements. (orig.)

Biomolecule-embedded metal-organic frameworks as an innovative sensing platform.

Science.gov (United States)

Kempahanumakkagari, Sureshkumar; Kumar, Vanish; Samaddar, Pallabi; Kumar, Pawan; Ramakrishnappa, Thippeswamy; Kim, Ki-Hyun

Technological advancements combined with materials research have led to the generation of enormous types of novel substrates and materials for use in various biological/medical, energy, and environmental applications. Lately, the embedding of biomolecules in novel and/or advanced materials (e.g., metal-organic frameworks (MOFs), nanoparticles, hydrogels, graphene, and their hybrid composites) has become a vital research area in the construction of an innovative platform for various applications including sensors (or biosensors), biofuel cells, and bioelectronic devices. Due to the intriguing properties of MOFs (e.g., framework architecture, topology, and optical properties), they have contributed considerably to recent progresses in enzymatic catalysis, antibody-antigen interactions, or many other related approaches. Here, we aim to describe the different strategies for the design and synthesis of diverse biomolecule-embedded MOFs for various sensing (e.g., optical, electrochemical, biological, and miscellaneous) techniques. Additionally, the benefits and future prospective of MOFs-based biomolecular immobilization as an innovative sensing platform are discussed along with the evaluation on their performance to seek for further development in this emerging research area. Copyright © 2018. Published by Elsevier Inc.

Mobile platform security

CERN Document Server

Asokan, N; Dmitrienko, Alexandra

2013-01-01

Recently, mobile security has garnered considerable interest in both the research community and industry due to the popularity of smartphones. The current smartphone platforms are open systems that allow application development, also for malicious parties. To protect the mobile device, its user, and other mobile ecosystem stakeholders such as network operators, application execution is controlled by a platform security architecture. This book explores how such mobile platform security architectures work. We present a generic model for mobile platform security architectures: the model illustrat

Platform-based production development

DEFF Research Database (Denmark)

Bossen, Jacob; Brunoe, Thomas Ditlev; Nielsen, Kjeld

2015-01-01

Platforms as a means for applying modular thinking in product development is relatively well studied, but platforms in the production system has until now not been given much attention. With the emerging concept of platform-based co-development the importance of production platforms is though...

Omnidirectional holonomic platforms

International Nuclear Information System (INIS)

Pin, F.G.; Killough, S.M.

1994-01-01

This paper presents the concepts for a new family of wheeled platforms which feature full omnidirectionality with simultaneous and independently controlled rotational and translational motion capabilities. The authors first present the orthogonal-wheels concept and the two major wheel assemblies on which these platforms are based. They then describe how a combination of these assemblies with appropriate control can be used to generate an omnidirectional capability for mobile robot platforms. The design and control of two prototype platforms are then presented and their respective characteristics with respect to rotational and translational motion control are discussed

Platform decommissioning costs

International Nuclear Information System (INIS)

Rodger, David

1998-01-01

There are over 6500 platforms worldwide contributing to the offshore oil and gas production industry. In the North Sea there are around 500 platforms in place. There are many factors to be considered in planning for platform decommissioning and the evaluation of options for removal and disposal. The environmental impact, technical feasibility, safety and cost factors all have to be considered. This presentation considers what information is available about the overall decommissioning costs for the North Sea and the costs of different removal and disposal options for individual platforms. 2 figs., 1 tab

A Model Collaborative Platform for Geoscience Education

Science.gov (United States)

Fox, S.; Manduca, C. A.; Iverson, E. A.

2012-12-01

Over the last decade SERC at Carleton College has developed a collaborative platform for geoscience education that has served dozens of projects, thousands of community authors and millions of visitors. The platform combines a custom technical infrastructure: the SERC Content Management system (CMS), and a set of strategies for building web-resources that can be disseminated through a project site, reused by other projects (with attribution) or accessed via an integrated geoscience education resource drawing from all projects using the platform. The core tools of the CMS support geoscience education projects in building project-specific websites. Each project uses the CMS to engage their specific community in collecting, authoring and disseminating the materials of interest to them. At the same time the use of a shared central infrastructure allows cross-fertilization among these project websites. Projects are encouraged to use common templates and common controlled vocabularies for organizing and displaying their resources. This standardization is then leveraged through cross-project search indexing which allow projects to easily incorporate materials from other projects within their own collection in ways that are relevant and automated. A number of tools are also in place to help visitors move among project websites based on their personal interests. Related links help visitors discover content related topically to their current location that is in a 'separate' project. A 'best bets' feature in search helps guide visitors to pages that are good starting places to explore resources on a given topic across the entire range of hosted projects. In many cases these are 'site guide' pages created specifically to promote a cross-project view of the available resources. In addition to supporting the cross-project exploration of specific themes the CMS also allows visitors to view the combined suite of resources authored by any particular community member. Automatically

Moodle platform as na effective tool in preparing a basic portuguese as a foreign language course

Directory of Open Access Journals (Sweden)

Eduardo Rodrigues Goes

2017-11-01

Full Text Available The research, currently in development, proposes to analyze the platform Moodle-Unesp in an online course of Portuguese as a foreign language (PLE. The Moodle platform is a Virtual Learning Environment (AVA that allows, among many actions, the creation and management of courses, feasibility of didactic material and student evaluations. The interaction in the virtual environment can be created by activities proposed by the teacher (administrator using the tools available in the "Activities" and "Resources" fields, available in the platform. Likewise, the association of tools of the "Activities" and "Resources" fields with digital didactic materials and adequate procedures for the teaching of Portuguese as a foreign language (PLE are presented. The results show that the Moodle-Unesp modules allow the insertion of a wide variety of tasks and content in different formats for the development of speech, writing, listening, reading and culture skills, thus demonstrating the effectiveness of the platform in teaching PLE.

Research on acceleration method of reactor physics based on FPGA platforms

International Nuclear Information System (INIS)

Li, C.; Yu, G.; Wang, K.

2013-01-01

The physical designs of the new concept reactors which have complex structure, various materials and neutronic energy spectrum, have greatly improved the requirements to the calculation methods and the corresponding computing hardware. Along with the widely used parallel algorithm, heterogeneous platforms architecture has been introduced into numerical computations in reactor physics. Because of the natural parallel characteristics, the CPU-FPGA architecture is often used to accelerate numerical computation. This paper studies the application and features of this kind of heterogeneous platforms used in numerical calculation of reactor physics through practical examples. After the designed neutron diffusion module based on CPU-FPGA architecture achieves a 11.2 speed up factor, it is proved to be feasible to apply this kind of heterogeneous platform into reactor physics. (authors)

Product Platform Replacements

DEFF Research Database (Denmark)

Sköld, Martin; Karlsson, Christer

2012-01-01

. To shed light on this unexplored and growing managerial concern, the purpose of this explorative study is to identify operational challenges to management when product platforms are replaced. Design/methodology/approach – The study uses a longitudinal field-study approach. Two companies, Gamma and Omega...... replacement was chosen in each company. Findings – The study shows that platform replacements primarily challenge managers' existing knowledge about platform architectures. A distinction can be made between “width” and “height” in platform replacements, and it is crucial that managers observe this in order...... to challenge their existing knowledge about platform architectures. Issues on technologies, architectures, components and processes as well as on segments, applications and functions are identified. Practical implications – Practical implications are summarized and discussed in relation to a framework...

A not-so-short description of the PERFECT platform

International Nuclear Information System (INIS)

Bugat, S.; Zeghadi, A.; Adjanor, G.

2010-01-01

This article describes the building of the so-called 'PERFECT platform', which main issue was to allow the development of the PERFECT end-products dedicated to the prediction of the degradation of material properties due to irradiation. First, the general principles used to build the platform are detailed. Such principles guided the choices of preferential development language, architecture, and operating system. The architecture of the platform is then described. It allows an easy development of the end-products, and a 'black-box' integration of the codes developed during the project. Each end-product can be seen as a sequence of modules, each module representing a physical phenomenon in time and space. The platform is very flexible, so that different methodologies can be tested and compared inside an end-product. The second part is devoted to the description of a classical PERFECT study, defined thanks to the graphical user interface developed in the project. Focus is made in particular on how a selection of modules is done, how the input data can be entered, and how the study execution is fully controlled by the user. A final description of the post-processing facilities on the results is exposed.

Plasmonic Modulator Using CMOS Compatible Material Platform

DEFF Research Database (Denmark)

Babicheva, Viktoriia; Kinsey, Nathaniel; Naik, Gururaj V.

2014-01-01

In this work, a design of ultra-compact plasmonic modulator is proposed and numerically analyzed. The device l ayout utilizes alternative plas monic materials such as tr ansparent conducting oxides and titanium nitride which potentially can be applied for CMOS compatible process. The modulation i...... for integration with existing insulator-metal-insu lator plasmonic waveguides as well as novel photonic/electronic hybrid circuits...

Product Platform Modeling

DEFF Research Database (Denmark)

Pedersen, Rasmus

for customisation of products. In many companies these changes in the business environment have created a controversy between the need for a wide variety of products offered to the marketplace and a desire to reduce variation within the company in order to increase efficiency. Many companies use the concept...... other. These groups can be varied and combined to form different product variants without increasing the internal variety in the company. Based on the Theory of Domains, the concept of encapsulation in the organ domain is introduced, and organs are formulated as platform elements. Included......This PhD thesis has the title Product Platform Modelling. The thesis is about product platforms and visual product platform modelling. Product platforms have gained an increasing attention in industry and academia in the past decade. The reasons are many, yet the increasing globalisation...

Improvement in the amine glass platform by bubbling method for a DNA microarray

Directory of Open Access Journals (Sweden)

Jee SH

2015-10-01

Full Text Available Seung Hyun Jee,1 Jong Won Kim,2 Ji Hyeong Lee,2 Young Soo Yoon11Department of Chemical and Biological Engineering, Gachon University, Seongnam, Gyeonggi, Republic of Korea; 2Genomics Clinical Research Institute, LabGenomics Co., Ltd., Bundang-gu, Seongnam-si, Gyeonggi-do, Republic of KoreaAbstract: A glass platform with high sensitivity for sexually transmitted diseases microarray is described here. An amino-silane-based self-assembled monolayer was coated on the surface of a glass platform using a novel bubbling method. The optimized surface of the glass platform had highly uniform surface modifications using this method, as well as improved hybridization properties with capture probes in the DNA microarray. On the basis of these results, the improved glass platform serves as a highly reliable and optimal material for the DNA microarray. Moreover, in this study, we demonstrated that our glass platform, manufactured by utilizing the bubbling method, had higher uniformity, shorter processing time, lower background signal, and higher spot signal than the platforms manufactured by the general dipping method. The DNA microarray manufactured with a glass platform prepared using bubbling method can be used as a clinical diagnostic tool. Keywords: DNA microarray, glass platform, bubbling method, self-assambled monolayer

Introducing Platform Interactions Model for Studying Multi-Sided Platforms

DEFF Research Database (Denmark)

Staykova, Kalina; Damsgaard, Jan

2018-01-01

Multi-Sided Platforms (MSPs) function as socio-technical entities that facilitate direct interactions between various affiliated to them constituencies through developing and managing IT architecture. In this paper, we aim to explain the nature of the platform interactions as key characteristic o...

Novel peptide-based platform for the dual presentation of biologically active peptide motifs on biomaterials.

Science.gov (United States)

Mas-Moruno, Carlos; Fraioli, Roberta; Albericio, Fernando; Manero, José María; Gil, F Javier

2014-05-14

Biofunctionalization of metallic materials with cell adhesive molecules derived from the extracellular matrix is a feasible approach to improve cell-material interactions and enhance the biointegration of implant materials (e.g., osseointegration of bone implants). However, classical biomimetic strategies may prove insufficient to elicit complex and multiple biological signals required in the processes of tissue regeneration. Thus, newer strategies are focusing on installing multifunctionality on biomaterials. In this work, we introduce a novel peptide-based divalent platform with the capacity to simultaneously present distinct bioactive peptide motifs in a chemically controlled fashion. As a proof of concept, the integrin-binding sequences RGD and PHSRN were selected and introduced in the platform. The biofunctionalization of titanium with this platform showed a positive trend towards increased numbers of cell attachment, and statistically higher values of spreading and proliferation of osteoblast-like cells compared to control noncoated samples. Moreover, it displayed statistically comparable or improved cell responses compared to samples coated with the single peptides or with an equimolar mixture of the two motifs. Osteoblast-like cells produced higher levels of alkaline phosphatase on surfaces functionalized with the platform than on control titanium; however, these values were not statistically significant. This study demonstrates that these peptidic structures are versatile tools to convey multiple biofunctionality to biomaterials in a chemically defined manner.

Silicon Nitride Photonic Integration Platforms for Visible, Near-Infrared and Mid-Infrared Applications

Science.gov (United States)

Micó, Gloria; Pastor, Daniel; Pérez, Daniel; Doménech, José David; Fernández, Juan; Baños, Rocío; Alemany, Rubén; Sánchez, Ana M.; Cirera, Josep M.; Mas, Roser

2017-01-01

Silicon nitride photonics is on the rise owing to the broadband nature of the material, allowing applications of biophotonics, tele/datacom, optical signal processing and sensing, from visible, through near to mid-infrared wavelengths. In this paper, a review of the state of the art of silicon nitride strip waveguide platforms is provided, alongside the experimental results on the development of a versatile 300 nm guiding film height silicon nitride platform. PMID:28895906

[Dental education for college students based on WeChat public platform].

Science.gov (United States)

Chen, Chuan-Jun; Sun, Tan

2016-06-01

The authors proposed a model for dental education based on WeChat public platform. In this model, teachers send various kinds of digital teaching information such as PPT，word and video to the WeChat public platform and students share the information for preview before class and differentiate the key-point knowledge from those information for in-depth learning in class. Teachers also send reference materials for expansive learning after class. Questionaire through the WeChat public platform is used to evaluate teaching effect of teachers and improvement may be taken based on the feedback questionnaire. A discussion and interaction based on WeCchat between students and teacher can be aroused on a specific topic to reach a proper solution. With technique development of mobile terminal, mobile class will come true in near future.

Fiscal 2000 report on results of project for R and D of industrial science and technology in cooperation with universities, and R and D of platform for designing high functional materials (development of energy use rationalization technology); 2000 nendo kokino zairyo sekkei platform no kenkyu kaihatsu seika hokokusho. Energy shiyo gorika gijutsu kaihatsu

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

R and D was conducted concerning sophistication and high speeding in designing materials by simulation technology utilizing a new calculation method, with fiscal 2000 results compiled. A group working on coarse-grained molecular dynamics have tackled three problems such as the development and application of a multi-purpose coarse-grained molecular dynamics engine called COGNAC. A group on dynamic average domain method added various functions to a new multi-purpose dynamic average domain simulator called SUSI, and also achieved a variety of results by simulations using this simulator. A group on dispersed structure simulation has been proceeding with the development and application study of a multi-phase dynamics simulator called MUFFIN. A verification research group carried out verification of predictability, with the accuracy intended by each program, on thermal properties, optical properties, formability, etc., using polyethylene as the verification material. A platform group prepared a new high-speed platform that used less memory. (NEDO)

A MEMS platform for in situ, real-time monitoring of electrochemically induced mechanical changes in lithium-ion battery electrodes

International Nuclear Information System (INIS)

Pomerantseva, Ekaterina; Jung, Hyun; Gnerlich, Markus; Baron, Sergio; Gerasopoulos, Konstantinos; Ghodssi, Reza

2013-01-01

We report the first successful demonstration of an optical microelectromechanical systems (MEMS) sensing platform for the in situ characterization of electrochemically induced reversible mechanical changes in lithium-ion battery (LIB) electrodes. The platform consists of an array of flexible membranes with a reflective surface on one side and a thin-film LIB electrode on the other side. The membranes deflect due to the active battery material volume change caused by lithium intercalation (expansion) and extraction (contraction). This deflection is monitored using the Fabry–Perot optical interferometry principle. The active material volume change causes high internal stresses and mechanical degradation of the electrodes. The stress evolution observed in a silicon thin-film electrode incorporated into this MEMS platform follows a ‘first elastic, then plastic’ deformation scheme. Understanding of the internal stresses in battery electrodes during discharge/charge is important for improving the reliability and cycle lifetime of LIBs. The developed MEMS platform presents a new method for in situ diagnostics of thin-film LIB electrodes to aid the development of new materials, optimization of electrode performance, and prevention of battery failure. (paper)

Evaluating the effects of bedding materials and elevated platforms on contact dermatitis and plumage cleanliness of commercial broilers and on litter condition in broiler houses.

Science.gov (United States)

Kaukonen, E; Norring, M; Valros, A

2017-10-01

1. Experiment 1, comparing wood shavings and ground straw bedding with peat, was performed on 7 broiler farms over two consecutive batches during the winter season. Experiment 2, assessing the effect of elevated (30 cm) platforms, was conducted in three farms replicated with 6 consecutive batches. 2. Footpad lesions were inspected at slaughter following the Welfare Quality® (WQ) assessment and official programme. Hock lesions, plumage cleanliness and litter condition were assessed using the WQ assessment. Litter height, pH, moisture and ammonia were determined. 3. Footpad condition on wood shavings appeared to be worse compared with peat using both methods of assessment and was accompanied by inferior hock skin health. WQ assessment resulted in poorer footpad and hock skin condition on ground straw compared with peat. Farms differed in footpad and hock skin condition. Footpad and hock lesions were not affected by platform treatment. Peat appeared more friable than ground straw. The initial pH of wood shavings was higher and moisture was lower than in peat, but at the end of production period there were no differences. Ground straw exhibited higher initial and lower end pH, and was drier in the beginning than peat. Litter condition and quality were not affected by platform treatment. 4. This study provides new knowledge about the applicability of peat as broiler bedding and shows no negative effects of elevated platforms on litter condition or the occurrence of contact dermatitis in commercial environments. The results suggest a complicated relationship between litter condition, moisture and contact dermatitis. Furthermore, it is concluded that the farmer's ability to manage litter conditions is important, regardless of the chosen litter material. Peat bedding was beneficial for footpad and hock skin health compared with wood shavings and ground straw.

Optimal design and experimental analyses of a new micro-vibration control payload-platform

Science.gov (United States)

Sun, Xiaoqing; Yang, Bintang; Zhao, Long; Sun, Xiaofen

2016-07-01

This paper presents a new payload-platform, for precision devices, which possesses the capability of isolating the complex space micro-vibration in low frequency range below 5 Hz. The novel payload-platform equipped with smart material actuators is investigated and designed through optimization strategy based on the minimum energy loss rate, for the aim of achieving high drive efficiency and reducing the effect of the magnetic circuit nonlinearity. Then, the dynamic model of the driving element is established by using the Lagrange method and the performance of the designed payload-platform is further discussed through the combination of the controlled auto regressive moving average (CARMA) model with modified generalized prediction control (MGPC) algorithm. Finally, an experimental prototype is developed and tested. The experimental results demonstrate that the payload-platform has an impressive potential of micro-vibration isolation.

Suspended HfO2 photonic crystal slab on III-nitride/Si platform

International Nuclear Information System (INIS)

Wang, Yongjin; Feng, Jiao; Cao, Ziping; Zhu, Hongbo

2014-01-01

We present here the fabrication of suspended hafnium oxide (HfO 2 ) photonic crystal slab on a III-nitride/Si platform. The calculations are performed to model the suspended HfO 2 photonic crystal slab. Aluminum nitride (AlN) film is employed as the sacrificial layer to form air gap. Photonic crystal patterns are defined by electron beam lithography and transferred into HfO 2 film, and suspended HfO 2 photonic crystal slab is achieved on a III-nitride/Si platform through wet-etching of AlN layer in the alkaline solution. The method is promising for the fabrication of suspended HfO 2 nanostructures incorporating into a III-nitride/Si platform, or acting as the template for epitaxial growth of III-nitride materials. (orig.)

ADMS Evaluation Platform

Energy Technology Data Exchange (ETDEWEB)

2018-01-23

Deploying an ADMS or looking to optimize its value? NREL offers a low-cost, low-risk evaluation platform for assessing ADMS performance. The National Renewable Energy Laboratory (NREL) has developed a vendor-neutral advanced distribution management system (ADMS) evaluation platform and is expanding its capabilities. The platform uses actual grid-scale hardware, large-scale distribution system models, and advanced visualization to simulate realworld conditions for the most accurate ADMS evaluation and experimentation.

A versatile automated platform for micro-scale cell stimulation experiments.

Science.gov (United States)

Sinha, Anupama; Jebrail, Mais J; Kim, Hanyoup; Patel, Kamlesh D; Branda, Steven S

2013-08-06

Study of cells in culture (in vitro analysis) has provided important insight into complex biological systems. Conventional methods and equipment for in vitro analysis are well suited to study of large numbers of cells (≥ 10(5)) in milliliter-scale volumes (≥ 0.1 ml). However, there are many instances in which it is necessary or desirable to scale down culture size to reduce consumption of the cells of interest and/or reagents required for their culture, stimulation, or processing. Unfortunately, conventional approaches do not support precise and reproducible manipulation of micro-scale cultures, and the microfluidics-based automated systems currently available are too complex and specialized for routine use by most laboratories. To address this problem, we have developed a simple and versatile technology platform for automated culture, stimulation, and recovery of small populations of cells (100-2,000 cells) in micro-scale volumes (1-20 μl). The platform consists of a set of fibronectin-coated microcapillaries ("cell perfusion chambers"), within which micro-scale cultures are established, maintained, and stimulated; a digital microfluidics (DMF) device outfitted with "transfer" microcapillaries ("central hub"), which routes cells and reagents to and from the perfusion chambers; a high-precision syringe pump, which powers transport of materials between the perfusion chambers and the central hub; and an electronic interface that provides control over transport of materials, which is coordinated and automated via pre-determined scripts. As an example, we used the platform to facilitate study of transcriptional responses elicited in immune cells upon challenge with bacteria. Use of the platform enabled us to reduce consumption of cells and reagents, minimize experiment-to-experiment variability, and re-direct hands-on labor. Given the advantages that it confers, as well as its accessibility and versatility, our platform should find use in a wide variety of

Room-temperature ionic liquids and composite materials: platform technologies for CO(2) capture.

Science.gov (United States)

Bara, Jason E; Camper, Dean E; Gin, Douglas L; Noble, Richard D

2010-01-19

Clean energy production has become one of the most prominent global issues of the early 21st century, prompting social, economic, and scientific debates regarding energy usage, energy sources, and sustainable energy strategies. The reduction of greenhouse gas emissions, specifically carbon dioxide (CO(2)), figures prominently in the discussions on the future of global energy policy. Billions of tons of annual CO(2) emissions are the direct result of fossil fuel combustion to generate electricity. Producing clean energy from abundant sources such as coal will require a massive infrastructure and highly efficient capture technologies to curb CO(2) emissions. Current technologies for CO(2) removal from other gases, such as those used in natural gas sweetening, are also capable of capturing CO(2) from power plant emissions. Aqueous amine processes are found in the vast majority of natural gas sweetening operations in the United States. However, conventional aqueous amine processes are highly energy intensive; their implementation for postcombustion CO(2) capture from power plant emissions would drastically cut plant output and efficiency. Membranes, another technology used in natural gas sweetening, have been proposed as an alternative mechanism for CO(2) capture from flue gas. Although membranes offer a potentially less energy-intensive approach, their development and industrial implementation lags far behind that of amine processes. Thus, to minimize the impact of postcombustion CO(2) capture on the economics of energy production, advances are needed in both of these areas. In this Account, we review our recent research devoted to absorptive processes and membranes. Specifically, we have explored the use of room-temperature ionic liquids (RTILs) in absorptive and membrane technologies for CO(2) capture. RTILs present a highly versatile and tunable platform for the development of new processes and materials aimed at the capture of CO(2) from power plant flue gas and

Hybrid Photonic Integration on a Polymer Platform

Directory of Open Access Journals (Sweden)

Ziyang Zhang

2015-09-01

Full Text Available To fulfill the functionality demands from the fast developing optical networks, a hybrid integration approach allows for combining the advantages of various material platforms. We have established a polymer-based hybrid integration platform (polyboard, which provides flexible optical input/ouptut interfaces (I/Os that allow robust coupling of indium phosphide (InP-based active components, passive insertion of thin-film-based optical elements, and on-chip attachment of optical fibers. This work reviews the recent progress of our polyboard platform. On the fundamental level, multi-core waveguides and polymer/silicon nitride heterogeneous waveguides have been fabricated, broadening device design possibilities and enabling 3D photonic integration. Furthermore, 40-channel optical line terminals and compact, bi-directional optical network units have been developed as highly functional, low-cost devices for the wavelength division multiplexed passive optical network. On a larger scale, thermo-optic elements, thin-film elements and an InP gain chip have been integrated on the polyboard to realize a colorless, dual-polarization optical 90° hybrid as the frontend of a coherent receiver. For high-end applications, a wavelength tunable 100Gbaud transmitter module has been demonstrated, manifesting the joint contribution from the polyboard technology, high speed polymer electro-optic modulator, InP driver electronics and ceramic electronic interconnects.

Towards a Participatory Memory: Multi-platform Storytelling in Historical Television Documentary

NARCIS (Netherlands)

Hagedoorn, B.|info:eu-repo/dai/nl/341477826

2015-01-01

This article explores strategies used by television programme makers in the multi-platform era, principally concerning personal memories of historical events. The availability and use of televisual materials has increased in the current ‘post-scarcity culture’, especially through the digitization of

Oxidation behavior analysis of cladding during severe accidents with combined codes for Qinshan Phase II Nuclear Power Plant

International Nuclear Information System (INIS)

Shi, Xingwei; Cao, Xinrong; Liu, Zhengzhi

2013-01-01

Highlights: • A new verified oxidation model of cladding has been added in Severe Accident Program (SAP). • A coupled analysis method utilizing RELAP5 and SAP codes has been developed and applied to analyze a SA caused by LBLOCA. • Analysis of cladding oxidation under a SA for Qinshan Phase II Nuclear Power Plant (QSP-II NPP) has been performed by SAP. • Estimation of the production of hydrogen has been achieved by coupled codes. - Abstract: Core behavior at a high temperature is extremely complicated during transition from Design Basic Accident (DBA) to the severe accident (SA) in Light Water Reactors (LWRs). The progression of core damage is strongly affected by the behavior of fuel cladding (oxidation, embrittlement and burst). A Severe Accident Program (SAP) is developed to simulate the process of fuel cladding oxidation, rupture and relocation of core debris based on the oxidation models of cladding, candling of melted material and mechanical slumping of core components. Relying on the thermal–hydraulic boundary parameters calculated by RELAP5 code, analysis of a SA caused by the large break loss-of-coolant accident (LBLOCA) without mitigating measures for Qinshan Phase II Nuclear Power Plant (QSP-II NPP) was performed by SAP for finding the key sequences of accidents, estimating the amount of hydrogen generation and oxidation behavior of the cladding

Data Platforms and Cities

DEFF Research Database (Denmark)

Blok, Anders; Courmont, Antoine; Hoyng, Rolien

2017-01-01

This section offers a series of joint reflections on (open) data platform from a variety of cases, from cycling, traffic and mapping to activism, environment and data brokering. Data platforms play a key role in contemporary urban governance. Linked to open data initiatives, such platforms are of...

Mobile Platforms and Development Environments

CERN Document Server

Helal, Sumi; Li, Wengdong

2012-01-01

Mobile platform development has lately become a technological war zone with extremely dynamic and fluid movement, especially in the smart phone and tablet market space. This Synthesis lecture is a guide to the latest developments of the key mobile platforms that are shaping the mobile platform industry. The book covers the three currently dominant native platforms -- iOS, Android and Windows Phone -- along with the device-agnostic HTML5 mobile web platform. The lecture also covers location-based services (LBS) which can be considered as a platform in its own right. The lecture utilizes a sampl

ITS Platform North Denmark

DEFF Research Database (Denmark)

Lahrmann, Harry; Agerholm, Niels; Juhl, Jens

2012-01-01

This paper presents the project entitled “ITS Platform North Denmark” which is used as a test platform for Intelligent Transportation System (ITS) solutions. The platform consists of a newly developed GNSS/GPRS On Board Unit (OBU) to be installed in 500 cars, a backend server and a specially...

Platform development supportedby gaming

DEFF Research Database (Denmark)

Mikkola, Juliana Hsuan; Hansen, Poul H. Kyvsgård

2007-01-01

The challenge of implementing industrial platforms in practice can be described as a configuration problem caused by high number of variables, which often have contradictory influences on the total performance of the firm. Consequently, the specific platform decisions become extremely complex......, possibly increasing the strategic risks for the firm. This paper reports preliminary findings on platform management process at LEGO, a Danish toy company.  Specifically, we report the process of applying games combined with simulations and workshops in the platform development. We also propose a framework...

Behind the scenes of GS: cross-platform

CERN Multimedia

Katarina Anthony

2014-01-01

The year was 1989: the dawn of administrative computing. In a laboratory filled to the rafters with paperwork, CERN's then Director-General Carlo Rubbia saw an opportunity for a complete administrative overhaul. He established the Advanced Information Systems (AIS) project to analyse CERN's administration, which in turn suggested the Electronic Document Handling (EDH) system. By 1992, EDH was up and running - the start of a new chapter in CERN history.   If you think you've never come accross EDH, think again. The system is an integral part of CERN life, handling everything from the purchase of materials to leave requests. EDH sees you through your entire CERN life: from your first CERN job application to your final retirement checklist. One platform, sixty-five functions What makes EDH so special is its solitary nature: it is one platform that carries out dozens of varied functions. "Most companies organise their administration in 'vertical' ...

VERAM - Vision and Roadmap for European Raw Materials

Science.gov (United States)

Baumgarten, Wibke; Vashev, Boris

2017-04-01

The overall objective of VERAM project is to produce a Vision and Roadmap for European Raw Materials in 2050 based on raw materials research and innovation (R&I) coordination. Two leading European Technology Platforms (ETPs): ETP SMR (Sustainable Minerals Resources) and FTP (Forest Technology Platform) are joining forces to develop a common vison and roadmap with the support of ECTP (European Construction Technology Platform), represented by UNIVPM, SusChem (ETP for Sustainable Chemistry), represented by Cefic, EuMaT (Advanced Materials ETP), represented by VITO, ERAMIN 2, represented by Research Centre JUELICH and WoodWisdom Network Plus represented by the Agency for Renewable Resources (FNR). This partnership provides VERAM with expertise from downstream applications and additional knowledge on non-biotic and biotic raw materials. The project encourages capacity building as well as transfer of knowledge. It expects to provide an innovation reference point for the European Institute of Innovation & Technology (EIT) Raw Materials (formerly the KIC Raw MatTERS), to coordinate the network involved in the European Innovation Partnership (EIP) on Raw Materials Commitments and relevant proposals funded under Horizon 2020. It provides a platform for identifying gaps and complementarities and enables their bridging. VERAM will be able to advise the European Commission and Member States on future research needs and policies to stimulate innovation and assist in overcoming fragmentation in the implementing the EIP Raw Materials Strategic Implementation Plan. VERAM looks for mutually beneficial information exchange, encourages cross-fertilization between actions undertaken by different raw material industries, and expects to accelerate exploitation of breakthrough innovations. One of the main outcomes of the project is the presentation of a common long term 2050 Vision and Roadmap for relevant raw materials including metals, industrial minerals and aggregates and wood. The

A new e-learning platform for radiology education (RadEd).

Science.gov (United States)

Xiberta, Pau; Boada, Imma

2016-04-01

One of the key elements of e-learning platforms is the content provided to the students. Content creation is a time demanding task that requires teachers to prepare material taking into account that it will be accessed on-line. Moreover, the teacher is restricted by the functionalities provided by the e-learning platforms. In contexts such as radiology where images have a key role, the required functionalities are still more specific and difficult to be provided by these platforms. Our purpose is to create a framework to make teacher's tasks easier, specially when he has to deal with contents where images have a main role. In this paper, we present RadEd, a new web-based teaching framework that integrates a smart editor to create case-based exercises that support image interaction such as changing the window width and the grey scale used to render the image, taking measurements on the image, attaching labels to images and selecting parts of the images, amongst others. It also provides functionalities to prepare courses with different topics, exercises and theory material, and also functionalities to control students' work. Different experts have used RadEd and all of them have considered it a very useful and valuable tool to prepare courses where radiological images are the main component. RadEd provides teachers functionalities to prepare more realistic cases and students the ability to make a more specific diagnosis. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Platform Expansion Design as Strategic Choice

DEFF Research Database (Denmark)

Staykova, Kalina S.; Damsgaard, Jan

2016-01-01

In this paper, we address how the strategic choice of platform expansion design impacts the subse-quent platform strategy. We identify two distinct approaches to platform expansion – platform bun-dling and platform constellations, which currently co-exist. The purpose of this paper is to outline...

A Typology of Multi-sided Platforms

DEFF Research Database (Denmark)

Staykova, Kalina Stefanova; Damsgaard, Jan

2015-01-01

In this paper we address how the composition of a platform impacts the platform’s business model. By platform’s business model we mean platform features, platform architecture and platform governance. To this end, we construct the Platform Business Model Framework. We apply the framework to three...

Dynamic Gaming Platform (DGP)

Science.gov (United States)

2009-04-01

GAMING PLATFORM (DGP) Lockheed Martin Corporation...YYYY) APR 09 2. REPORT TYPE Final 3. DATES COVERED (From - To) Jul 07 – Mar 09 4. TITLE AND SUBTITLE DYNAMIC GAMING PLATFORM (DGP) 5a...CMU Carnegie Mellon University DGP Dynamic Gaming Platform GA Genetic Algorithm IARPA Intelligence Advanced Research Projects Activity LM ATL Lockheed Martin Advanced Technology Laboratories PAINT ProActive INTelligence

Sandwich type plasmonic platform for MEF using silver fractals

DEFF Research Database (Denmark)

Raut, Sangram L.; Rich, Ryan; Shtoyko, Tanya

2015-01-01

was studied with the N-methyl-azadioxatriangulenium chloride salt (Me-ADOTA·Cl) in PVA films made from 0.2% PVA (w/v) solution spin-coated on a clean glass coverslip. The Plasmonic Platforms (PP) were assembled by pressing together silver fractals on one glass slide and a separate glass coverslip spin-coated...... with a uniform Me-ADOTA·Cl in PVA film. In addition, we also tested ADOTA labeled human serum albumin (HSA) deposited on a glass slide for potential PP bioassay applications. Using the new PP, we could achieve more than a 20-fold fluorescence enhancement (bright spots) accompanied by a decrease...... of PP can be a convenient approach for constructing assays utilizing metal enhanced fluorescence (MEF) without the need for depositing the material directly on metal structures platforms....

EURESCOM Services Platform

NARCIS (Netherlands)

Nieuwenhuis, Lambertus Johannes Maria; van Halteren, Aart

1999-01-01

This paper presents the results of the EURESCOM Project 715. In February 1999, a large team of researchers from six European public network operators completed a two year period of cooperative experiments on a TINA-based environment, called the EURESCOM Services Platform (ESP). This platform

A Novel Platform for Evaluating the Environmental Impacts on Bacterial Cellulose Production.

Science.gov (United States)

Basu, Anindya; Vadanan, Sundaravadanam Vishnu; Lim, Sierin

2018-04-10

Bacterial cellulose (BC) is a biocompatible material with versatile applications. However, its large-scale production is challenged by the limited biological knowledge of the bacteria. The advent of synthetic biology has lead the way to the development of BC producing microbes as a novel chassis. Hence, investigation on optimal growth conditions for BC production and understanding of the fundamental biological processes are imperative. In this study, we report a novel analytical platform that can be used for studying the biology and optimizing growth conditions of cellulose producing bacteria. The platform is based on surface growth pattern of the organism and allows us to confirm that cellulose fibrils produced by the bacteria play a pivotal role towards their chemotaxis. The platform efficiently determines the impacts of different growth conditions on cellulose production and is translatable to static culture conditions. The analytical platform provides a means for fundamental biological studies of bacteria chemotaxis as well as systematic approach towards rational design and development of scalable bioprocessing strategies for industrial production of bacterial cellulose.

Textile materials trading center formally launched online

Institute of Scientific and Technical Information of China (English)

无

2012-01-01

Textile materials trading center was formally launched online in Wuxi City,Jiangsu Province. This is the first third-party electronic trading platform for spot trading in China textile materials professional market. The project will strive to build the most influential textile materials trading center of East China,the whole country and even the whole world China textile materials trading center will be

Microfluidic platform for efficient Nanodisc assembly, membrane protein incorporation, and purification.

Science.gov (United States)

Wade, James H; Jones, Joshua D; Lenov, Ivan L; Riordan, Colleen M; Sligar, Stephen G; Bailey, Ryan C

2017-08-22

The characterization of integral membrane proteins presents numerous analytical challenges on account of their poor activity under non-native conditions, limited solubility in aqueous solutions, and low expression in most cell culture systems. Nanodiscs are synthetic model membrane constructs that offer many advantages for studying membrane protein function by offering a native-like phospholipid bilayer environment. The successful incorporation of membrane proteins within Nanodiscs requires experimental optimization of conditions. Standard protocols for Nanodisc formation can require large amounts of time and input material, limiting the facile screening of formation conditions. Capitalizing on the miniaturization and efficient mass transport inherent to microfluidics, we have developed a microfluidic platform for efficient Nanodisc assembly and purification, and demonstrated the ability to incorporate functional membrane proteins into the resulting Nanodiscs. In addition to working with reduced sample volumes, this platform simplifies membrane protein incorporation from a multi-stage protocol requiring several hours or days into a single platform that outputs purified Nanodiscs in less than one hour. To demonstrate the utility of this platform, we incorporated Cytochrome P450 into Nanodiscs of variable size and lipid composition, and present spectroscopic evidence for the functional active site of the membrane protein. This platform is a promising new tool for membrane protein biology and biochemistry that enables tremendous versatility for optimizing the incorporation of membrane proteins using microfluidic gradients to screen across diverse formation conditions.

Towards a Disruptive Digital Platform Model

DEFF Research Database (Denmark)

Kazan, Erol

that digital platforms leverage on three strategic design elements (i.e., business, architecture, and technology design) to create supportive conditions for facilitating disruption. To shed light on disruptive digital platforms, I opted for payment platforms as my empirical context and unit of analysis......Digital platforms are layered modular information technology architectures that support disruption. Digital platforms are particularly disruptive, as they facilitate the quick release of digital innovations that may replace established innovations. Yet, despite their support for disruption, we have...... not fully understood how such digital platforms can be strategically designed and configured to facilitate disruption. To that end, this thesis endeavors to unravel disruptive digital platforms from the supply perspective that are grounded on strategic digital platform design elements. I suggest...

Development of gamma-ray absorption and scattering simulation platform based on MCNP

International Nuclear Information System (INIS)

Lai Wanchang; Chen Henggui; Zhang Zhen; Chen Xiaoqiang

2010-01-01

It describes a γ-ray absorption and scattering simulation platform centering on MCNP, and developed corresponding accessories on the basis of the MCNP. Simulation of this simulation platform can be 93 kinds of single-quality materials and 2-3 kinds of multi-element mixture absorption experiment, simulating the absorption thickness of 0-100cm, and the thickness increment in 0.001cm. The media of Scattering Simulation is from the Li to the Am, the angle between the simulation measuring degree and incident ray direction is from-90 to 90, the angle in increments in 1 degree. (authors)

Groundwater Assessment Platform

OpenAIRE

Podgorski, Joel; Berg, Michael

2018-01-01

The Groundwater Assessment Platform is a free, interactive online GIS platform for the mapping, sharing and statistical modeling of groundwater quality data. The modeling allows users to take advantage of publicly available global datasets of various environmental parameters to produce prediction maps of their contaminant of interest.

Preparing for a Product Platform

DEFF Research Database (Denmark)

Fiil-Nielsen, Ole; Munk, Lone; Mortensen, Niels Henrik

2005-01-01

on commonalities and similarities in the product family, and variance should be based on customer demands. To relate these terms and to improve the basis on which decisions are made, we need a way of visualizing the hierarchy of the product family as well as the commonality and variance. This visualization method...... of the platform or ensuring that the platform can meet future demands will be very useful in the preparation process of a platform synthesis as well as in the updating or reengineering of an existing product development platform.......Experience in the industry as well as recent related scientific publications show the benefits of product development platforms. Companies use platforms to develop not a single but multiple products (i.e. a product family) simultaneously. When these product development projects are coordinated...

Hybrid Integrated Platforms for Silicon Photonics

Science.gov (United States)

Liang, Di; Roelkens, Gunther; Baets, Roel; Bowers, John E.

2010-01-01

A review of recent progress in hybrid integrated platforms for silicon photonics is presented. Integration of III-V semiconductors onto silicon-on-insulator substrates based on two different bonding techniques is compared, one comprising only inorganic materials, the other technique using an organic bonding agent. Issues such as bonding process and mechanism, bonding strength, uniformity, wafer surface requirement, and stress distribution are studied in detail. The application in silicon photonics to realize high-performance active and passive photonic devices on low-cost silicon wafers is discussed. Hybrid integration is believed to be a promising technology in a variety of applications of silicon photonics.

A new material platform of Si photonics for implementing architecture of dense wavelength division multiplexing on Si bulk wafer

Science.gov (United States)

Zhang, Ziyi; Yako, Motoki; Ju, Kan; Kawai, Naoyuki; Chaisakul, Papichaya; Tsuchizawa, Tai; Hikita, Makoto; Yamada, Koji; Ishikawa, Yasuhiko; Wada, Kazumi

2017-12-01

A new materials group to implement dense wavelength division multiplexing (DWDM) in Si photonics is proposed. A large thermo-optic (TO) coefficient of Si malfunctions multiplexer/demultiplexer (MUX/DEMUX) on a chip under thermal fluctuation, and thus DWDM implementation, has been one of the most challenging targets in Si photonics. The present study specifies an optical materials group for DWDM by a systematic survey of their TO coefficients and refractive indices. The group is classified as mid-index contrast optics (MiDex) materials, and non-stoichiometric silicon nitride (SiNx) is chosen to demonstrate its significant thermal stability. The TO coefficient of non-stoichiometric SiNx is precisely measured in the temperature range 24-76 °C using the SiNx rings prepared by two methods: chemical vapor deposition (CVD) and physical vapor deposition (PVD). The CVD-SiNx ring reveals nearly the same TO coefficient reported for stoichiometric CVD-Si3N4, while the value for the PVD-SiNx ring is slightly higher. Both SiNx rings lock their resonance frequencies within 100 GHz in this temperature range. Since CVD-SiNx needs a high temperature annealing to reduce N-H bond absorption, it is concluded that PVD-SiNx is suited as a MiDex material introduced in the CMOS back-end-of-line. Further stabilization is required, considering the crosstalk between two channels; a 'silicone' polymer is employed to compensate for the temperature fluctuation using its negative TO coefficient, called athermalization. This demonstrates that the resonance of these SiNx rings is locked within 50 GHz at the same temperature range in the wavelength range 1460-1620 nm (the so-called S, C, and L bands in optical fiber communication networks). A further survey on the MiDex materials strongly suggests that Al2O3, Ga2O3 Ta2O5, HfO2 and their alloys should provide even more stable platforms for DWDM implementation in MiDex photonics. It is discussed that the MiDex photonics will find various applications

A new material platform of Si photonics for implementing architecture of dense wavelength division multiplexing on Si bulk wafer.

Science.gov (United States)

Zhang, Ziyi; Yako, Motoki; Ju, Kan; Kawai, Naoyuki; Chaisakul, Papichaya; Tsuchizawa, Tai; Hikita, Makoto; Yamada, Koji; Ishikawa, Yasuhiko; Wada, Kazumi

2017-01-01

A new materials group to implement dense wavelength division multiplexing (DWDM) in Si photonics is proposed. A large thermo-optic (TO) coefficient of Si malfunctions multiplexer/demultiplexer (MUX/DEMUX) on a chip under thermal fluctuation, and thus DWDM implementation, has been one of the most challenging targets in Si photonics. The present study specifies an optical materials group for DWDM by a systematic survey of their TO coefficients and refractive indices. The group is classified as mid-index contrast optics (MiDex) materials, and non-stoichiometric silicon nitride (SiN x ) is chosen to demonstrate its significant thermal stability. The TO coefficient of non-stoichiometric SiN x is precisely measured in the temperature range 24-76 °C using the SiN x rings prepared by two methods: chemical vapor deposition (CVD) and physical vapor deposition (PVD). The CVD-SiN x ring reveals nearly the same TO coefficient reported for stoichiometric CVD-Si 3 N 4 , while the value for the PVD-SiN x ring is slightly higher. Both SiN x rings lock their resonance frequencies within 100 GHz in this temperature range. Since CVD-SiN x needs a high temperature annealing to reduce N-H bond absorption, it is concluded that PVD-SiN x is suited as a MiDex material introduced in the CMOS back-end-of-line. Further stabilization is required, considering the crosstalk between two channels; a 'silicone' polymer is employed to compensate for the temperature fluctuation using its negative TO coefficient, called athermalization. This demonstrates that the resonance of these SiN x rings is locked within 50 GHz at the same temperature range in the wavelength range 1460-1620 nm (the so-called S, C, and L bands in optical fiber communication networks). A further survey on the MiDex materials strongly suggests that Al 2 O 3 , Ga 2 O 3 Ta 2 O 5 , HfO 2 and their alloys should provide even more stable platforms for DWDM implementation in MiDex photonics. It is discussed that the MiDex photonics

Mesophilic and thermophilic conditions select for unique but highly parallel microbial communities to perform carboxylate platform biomass conversion.

Directory of Open Access Journals (Sweden)

Emily B Hollister

Full Text Available The carboxylate platform is a flexible, cost-effective means of converting lignocellulosic materials into chemicals and liquid fuels. Although the platform's chemistry and engineering are well studied, relatively little is known about the mixed microbial communities underlying its conversion processes. In this study, we examined the metagenomes of two actively fermenting platform communities incubated under contrasting temperature conditions (mesophilic 40°C; thermophilic 55 °C, but utilizing the same inoculum and lignocellulosic feedstock. Community composition segregated by temperature. The thermophilic community harbored genes affiliated with Clostridia, Bacilli, and a Thermoanaerobacterium sp, whereas the mesophilic community metagenome was composed of genes affiliated with other Clostridia and Bacilli, Bacteriodia, γ-Proteobacteria, and Actinobacteria. Although both communities were able to metabolize cellulosic materials and shared many core functions, significant differences were detected with respect to the abundances of multiple Pfams, COGs, and enzyme families. The mesophilic metagenome was enriched in genes related to the degradation of arabinose and other hemicellulose-derived oligosaccharides, and the production of valerate and caproate. In contrast, the thermophilic community was enriched in genes related to the uptake of cellobiose and the transfer of genetic material. Functions assigned to taxonomic bins indicated that multiple community members at either temperature had the potential to degrade cellulose, cellobiose, or xylose and produce acetate, ethanol, and propionate. The results of this study suggest that both metabolic flexibility and functional redundancy contribute to the platform's ability to process lignocellulosic substrates and are likely to provide a degree of stability to the platform's fermentation processes.

High content analysis platform for optimization of lipid mediated CRISPR-Cas9 delivery strategies in human cells.

Science.gov (United States)

Steyer, Benjamin; Carlson-Stevermer, Jared; Angenent-Mari, Nicolas; Khalil, Andrew; Harkness, Ty; Saha, Krishanu

2016-04-01

Non-viral gene-editing of human cells using the CRISPR-Cas9 system requires optimized delivery of multiple components. Both the Cas9 endonuclease and a single guide RNA, that defines the genomic target, need to be present and co-localized within the nucleus for efficient gene-editing to occur. This work describes a new high-throughput screening platform for the optimization of CRISPR-Cas9 delivery strategies. By exploiting high content image analysis and microcontact printed plates, multi-parametric gene-editing outcome data from hundreds to thousands of isolated cell populations can be screened simultaneously. Employing this platform, we systematically screened four commercially available cationic lipid transfection materials with a range of RNAs encoding the CRISPR-Cas9 system. Analysis of Cas9 expression and editing of a fluorescent mCherry reporter transgene within human embryonic kidney cells was monitored over several days after transfection. Design of experiments analysis enabled rigorous evaluation of delivery materials and RNA concentration conditions. The results of this analysis indicated that the concentration and identity of transfection material have significantly greater effect on gene-editing than ratio or total amount of RNA. Cell subpopulation analysis on microcontact printed plates, further revealed that low cell number and high Cas9 expression, 24h after CRISPR-Cas9 delivery, were strong predictors of gene-editing outcomes. These results suggest design principles for the development of materials and transfection strategies with lipid-based materials. This platform could be applied to rapidly optimize materials for gene-editing in a variety of cell/tissue types in order to advance genomic medicine, regenerative biology and drug discovery. CRISPR-Cas9 is a new gene-editing technology for "genome surgery" that is anticipated to treat genetic diseases. This technology uses multiple components of the Cas9 system to cut out disease-causing mutations

The Logic of Digital Platform Disruption

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.

Digital platforms are disruptive IT artifacts, because they facilitate the quick release of innovative platform derivatives from third parties (e.g., apps). This study endeavours to unravel the disruptive potential, caused by distinct designs and configurations of digital platforms on market...... environments. We postulate that the disruptive potential of digital platforms is determined by the degree of alignment among the business, technology and platform profiles. Furthermore, we argue that the design and configuration of the aforementioned three elements dictates the extent to which open innovation...... is permitted. To shed light on the disruptive potential of digital platforms, we opted for payment platforms as our unit of analysis. Through interviews with experts and payment providers, we seek to gain an in-depth appreciation of how contemporary digital payment platforms are designed and configured...

Transactional Network Platform: Applications

Energy Technology Data Exchange (ETDEWEB)

Katipamula, Srinivas; Lutes, Robert G.; Ngo, Hung; Underhill, Ronald M.

2013-10-31

In FY13, Pacific Northwest National Laboratory (PNNL) with funding from the Department of Energy’s (DOE’s) Building Technologies Office (BTO) designed, prototyped and tested a transactional network platform to support energy, operational and financial transactions between any networked entities (equipment, organizations, buildings, grid, etc.). Initially, in FY13, the concept demonstrated transactions between packaged rooftop air conditioners and heat pump units (RTUs) and the electric grid using applications or "agents" that reside on the platform, on the equipment, on a local building controller or in the Cloud. The transactional network project is a multi-lab effort with Oakridge National Laboratory (ORNL) and Lawrence Berkeley National Laboratory (LBNL) also contributing to the effort. PNNL coordinated the project and also was responsible for the development of the transactional network (TN) platform and three different applications associated with RTUs. This document describes two applications or "agents" in details, and also summarizes the platform. The TN platform details are described in another companion document.

Vertical Relationships within Platform Marketplaces

Directory of Open Access Journals (Sweden)

Mark J. Tremblay

2016-07-01

Full Text Available In two-sided markets a platform allows consumers and sellers to interact by creating sub-markets within the platform marketplace. For example, Amazon has sub-markets for all of the different product categories available on its site, and smartphones have sub-markets for different types of applications (gaming apps, weather apps, map apps, ridesharing apps, etc.. The network benefits between consumers and sellers depend on the mode of competition within the sub-markets: more competition between sellers lowers product prices, increases the surplus consumers receive from a sub-market, and makes platform membership more desirable for consumers. However, more competition also lowers profits for a seller which makes platform membership less desirable for a seller and reduces seller entry and the number of sub-markets available on the platform marketplace. This dynamic between seller competition within a sub-market and agents’ network benefits leads to platform pricing strategies, participation decisions by consumers and sellers, and welfare results that depend on the mode of competition. Thus, the sub-market structure is important when investigating platform marketplaces.

The vacuum platform

Science.gov (United States)

McNab, A.

2017-10-01

This paper describes GridPP’s Vacuum Platform for managing virtual machines (VMs), which has been used to run production workloads for WLCG and other HEP experiments. The platform provides a uniform interface between VMs and the sites they run at, whether the site is organised as an Infrastructure-as-a-Service cloud system such as OpenStack, or an Infrastructure-as-a-Client system such as Vac. The paper describes our experience in using this platform, in developing and operating VM lifecycle managers Vac and Vcycle, and in interacting with VMs provided by LHCb, ATLAS, ALICE, CMS, and the GridPP DIRAC service to run production workloads.

Evaluating the E-Learning Platform from the Perspective of Knowledge Management: The AHP Approach

Directory of Open Access Journals (Sweden)

I-Chin Wu

2013-06-01

Full Text Available A growing number of higher education institutions have adopted asynchronous and synchronous Web-based learning platforms to improve students’ learning efficiency and increase learning satisfaction in the past decade. Unlike traditional face-to-face learning methods, e-learning platforms allow teachers to communicate with students and discuss course content anytime or anywhere. In addition, the teaching material can be reused via the e-learning platforms. To understand how students use e-learning platforms and what the implications are, we conducted an empirical study of the iCAN e-learning platform, which has been widely used in Fu-Jen Catholic University since 2005. We use the Analytic Hierarchy Process (AHP, a well-known multi-criteria evaluation approach, to compare five practices, i.e. the functions of the iCAN teaching platform. We adopted a brainstorming approach to design a questionnaire to measure learners’ perception of the e-learning platform based on the theory of knowledge transforming process in knowledge management. Accordingly, the model considers functioning and objectivity in terms of the following three attributes of learning effectiveness: individual learning, group sharing and learning performance. Twelve criteria with twelve evaluation items were used to investigate the effectiveness of the five practices. We also evaluated the strengths and weaknesses of the functions based on the types of courses in the iCan platform. We expect that the empirical evaluation results will provide teachers with suggestions and guidelines for using the e-learning platform effectively to facilitate their teaching activities and promote students’ learning efficiency and satisfaction.

Tectonic resemblance of the Indian Platform, Pakistan with the Moesian Platform, Romania and strategy for exploration of hydrocarbons

International Nuclear Information System (INIS)

Memon, A.D.

1994-01-01

There is a remarkable tectonic resemblance between the indian Platform (Pakistan) and the Moesian Platform (Romania). As viewed in global tectonic perspective Moeslan and Indian Plates have played important role in Alpine Himalayan Orogeny; Moesian and Indian Platforms are extension of these respective plates. Characteristics features of both the platforms are block faulting which has effected not only the general tectonic framework but has also played important role in oil accumulation. Main producing rocks in the Moesian platform are Jurassic sandstones and cretaceous limestones while in the indian platform cretaceous sandstones are important reservoirs. The average geothermal gradient in the indian platform is 2.45 C/100m with the higher gradients in the central gas producing region. Geothermal gradients in the Moesian platform have an average value of 3 C/100m with higher gradients in the northern in the northern part. Some of the producing structures in both the platforms are remarkably similar, traps associated with normal faults are very important. Extensive exploration carried in the Moesian Platform makes it very important oil producing region of Romania. After the discovery of oil lower Sindh, serious exploration is being carried in the Indian platform. The paper deals with the similarities between these two important platforms. In the light of the studies of the Moesian platform, strategies or exploration of oil and gas in the Indian Platform are suggested. (author)

Utilizing platforms in industrialized construction

DEFF Research Database (Denmark)

Bonev, Martin; Wörösch, Michael; Hvam, Lars

2015-01-01

platform strategies, this researchhighlights key aspects of adapting platform-based developed theory to industrialised construction.Building projects use different layers of product, process and logistics platforms to form the right cost– value ratio for the target market application, while modelling...

Fiscal 2000 report on result of R and D project for industrial science and technology in cooperation with universities, and R and D of platform for designing high functional material; 2000 nendo kokino zairyo seikkei platform no kenkyu kaihatsu seika hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

1991-03-01

R and D was conducted concerning sophistication and high speeding in designing materials by simulation technology utilizing a new calculation method, with fiscal 2000 results compiled. In each working group, research was carried out respectively on coarse-grained molecular dynamics, dynamic average domain method, dispersed structure simulation, verification study, and platforms. Also, Tokyo University, Graduate School of Frontier Sciences, examined structures and physical properties of polymeric materials at nano-scale, making comparisons with expected values by simulation. Tokyo University, Institute of Industrial Science conducted an experimental research in order to elucidate the whole picture of viscoelastic phase separation in a polymeric solution system at quantitative level. Tokyo Institute of Technology, Graduate School, made a comparison between a simulation and an experiment concerning polymer micelles by molecular association and polymerization-induced phase separation. Meantime, Kyoto University, Graduate School, carried out research on dynamics of complex phase transition of multi-component polymer mixtures and its self-assembling processes. (NEDO)

Achievement report for fiscal 1998 on research and development project for university coordinated type industrial science technologies. Research and development on platform for designing high functional materials (development for practical use of technologies related to rationalization of energy use); 1998 nendo kokino zairyo sekkei platform no kenkyu kaihatsu. Energy shiyo gorikia kankei gijutsu jitsuyoka kaihatsu

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

This paper reports research achievements in fiscal 1998 for a platform for designing high functional materials. Since coarse-grained models used in molecular dynamics (MD) simulation are diversified depending on materials, phenomena and properties, a general purpose MD engine that can simulate them freely was designed. Methods were developed to determine the potentials of coarse-grained models from the atomistic models. In polymer melts, very slow movements caused by entanglements have a substantially important role, which are difficult to be studied by usual MD simulations. Therefore, fiscal 1998 has devised a coarse-grained model to handle slow movements of straight-chain polymers, and a rheological forecast program was prepared. Studies are also being made on meso-scale structures sufficiently large as compared to atoms and on dynamic property forecast. Works were carried out to develop a simulator, in which polymeric phenomena with large spatio-temporal scale are applied with a continuity model to solve the equation thereof. Improvements were given on the hardware/software environments required for developing simulation engines and platforms for mesoscopic region. (NEDO)

IMPROVEMENT OF THE SUPPORTING STRUCTURE OF PLATFORM CAR FOR HIGHER EFFICIENCY OF CONTAINER TRANSPORTATIONS

Directory of Open Access Journals (Sweden)

A. O. Lovska

2017-02-01

Full Text Available Purpose. The article is aimed to improve supporting structures of the platform car to increase the efficiency of container transportations. Methodology. In order to achieve the objective, the strength investigations of the universal platform car of the model 13-401 were conducted, strength reserves of the supporting elements were defined, and more optimal profiles of basic longitudinal beams of the frame in terms of the minimum material capacity were proposed. Decision correctness was confirmed by the strength calculation of the platform car supporting structure at basic loading operational modes and fatigue taking into account the research database of 107 cycles. It has been proposed to equip a platform car with swing fitting stops for fastening containers on the frame, which allows transportation of 20ft and 40ft containers. In order to improve container transportation efficiency along international transport corridors running through Ukraine, a platform car of articulated type has been designed on the base of the improved platform car structure. The mathematical simulation of dynamic loads of the platform car with containers (two 1CC containers at operational loading modes has been carried out, the maximum accelerations influencing the support structure have been defined, and their multiple values have been considered in computer simulation of the strength of the platform car of articulated type. Findings. The support structure of the platform car of articulated type on the basis of the standard platform car has been developed. Refined values of dynamic loads influencing supporting structure the platform car of articulated type with containers at operational loading modes have been obtained; the maximum equivalent stresses in the platform car support structure have been defined. Originality and practical value. A mathematical model of displacements for a platform car of articulated type with containers at operational loading modes of

Stratospheric Platforms for Monitoring Purposes

International Nuclear Information System (INIS)

Konigorski, D.; Gratzel, U.; Obersteiner, M.; Schneidereit, M.

2010-01-01

Stratospheric platforms are emerging systems based on challenging technology. Goal is to create a platform, payload, and mission design which is able to complement satellite services on a local scale. Applications are close to traditional satellite business in telecommunication, navigation, science, and earth observation and include for example mobile telecommunications, navigation augmentation, atmospheric research, or border control. Stratospheric platforms could potentially support monitoring activities related to safeguards, e.g. by imagery of surfaces, operational conditions of nuclear facilities, and search for undeclared nuclear activities. Stratospheric platforms are intended to be flown in an altitude band between 16 and 30 km, above 16-20 km to take advantage of usually lower winds facilitating station keeping, below 30 km to limit the challenges to achieve a reasonable payload at acceptable platform sizes. Stratospheric platforms could substitute satellites which are expensive and lack upgrade capabilities for new equipment. Furthermore they have practically an unlimited time over an area of interest. It is intended to keep the platforms operational and maintenance free on a 24/7 basis with an average deployment time of 3 years. Geostationary satellites lack resolution. Potential customers like Armed Forces, National Agencies and commercial customers have indicated interest in the use of stratospheric platforms. Governmental entities are looking for cheaper alternatives to communications and surveillance satellites and stratospheric platforms could offer the following potential advantages: Lower operational cost than satellite or UAV (Unmanned Aerial Vehicles) constellation (fleet required); Faster deployment than satellite constellation; Repositioning capability and ability to loiter as required; Persistent long-term real-time services over a fairly large regional spot; Surge capability: Able to extend capability (either monitoring or communications

Adoption of Mobile Payment Platforms

DEFF Research Database (Denmark)

Staykova, Kalina Stefanova; Damsgaard, Jan

2016-01-01

Numerous mobile payment solutions, which rely on new disruptive technologies, have been launched on the payment market in recent years. But despite the growing number of mobile payment apps, very few solutions have turned to be successful as the majority of them fail to gain a critical mass...... of users. In this paper, we investigate successful platform adoption strategies by using the Reach and Range Framework for Multi-Sided Platforms as a strategic tool to which mobile payment providers can adhere in order to tackle some of the main challenges they face throughout the evolution...... of their platforms. The analysis indicates that successful mobile payment solutions tend to be launched as one-sided platforms and then gradually be expanded into being two-sided. Our study showcases that the success of mobile payment platforms lies with the ability of the platform to balance the reach (number...

National symposium and workshop on optical platforms, Huntsville, AL, June 12-14, 1984, Proceedings

International Nuclear Information System (INIS)

Wyman, C.L.

1984-01-01

The conference is concerned with space-based observatories (including future systems), interplanetary observation platforms, Space Station optical utilization, orbital earth viewing systems, and Spacelab's use as an observations platform. Attention is given to the pointing system for the space telescope, the Advanced X-ray Astrophysics Facility, the conceptual definition of the Space IR Telescope Facility's spacecraft, satellite servicing in light of the Solar Maximum Repair Mission, a large deployable reflector telescope concept, moon-based astronomical observatories, Space Station-based remote sensing of the earth, optical systems is geosynchronous orbit, multispectral linear array detector technology, Spacelab-based space plasma and materials processing investigations, and space construction technology for large space observatories. Also discussed are military optical platforms for sea, land and air stationing

The Dynamics of Digital Platform Innovation

DEFF Research Database (Denmark)

Eaton, Ben

2016-01-01

Curated platforms provide an architectural basis for third parties to develop platform complements and for platform owners to control their implementation as a form of open innovation. The refusal to implement complements as innovations can cause tension between platform owners and developers. Th...

A testing platform for durability studies of polymers and fiber-reinforced polymer composites under concurrent hygrothermo-mechanical stimuli.

Science.gov (United States)

Gomez, Antonio; Pires, Robert; Yambao, Alyssa; La Saponara, Valeria

2014-12-11

The durability of polymers and fiber-reinforced polymer composites under service condition is a critical aspect to be addressed for their robust designs and condition-based maintenance. These materials are adopted in a wide range of engineering applications, from aircraft and ship structures, to bridges, wind turbine blades, biomaterials and biomedical implants. Polymers are viscoelastic materials, and their response may be highly nonlinear and thus make it challenging to predict and monitor their in-service performance. The laboratory-scale testing platform presented herein assists the investigation of the influence of concurrent mechanical loadings and environmental conditions on these materials. The platform was designed to be low-cost and user-friendly. Its chemically resistant materials make the platform adaptable to studies of chemical degradation due to in-service exposure to fluids. An example of experiment was conducted at RT on closed-cell polyurethane foam samples loaded with a weight corresponding to ~50% of their ultimate static and dry load. Results show that the testing apparatus is appropriate for these studies. Results also highlight the larger vulnerability of the polymer under concurrent loading, based on the higher mid-point displacements and lower residual failure loads. Recommendations are made for additional improvements to the testing apparatus.

A Testing Platform for Durability Studies of Polymers and Fiber-reinforced Polymer Composites under Concurrent Hygrothermo-mechanical Stimuli

Science.gov (United States)

Gomez, Antonio; Pires, Robert; Yambao, Alyssa; La Saponara, Valeria

2014-01-01

The durability of polymers and fiber-reinforced polymer composites under service condition is a critical aspect to be addressed for their robust designs and condition-based maintenance. These materials are adopted in a wide range of engineering applications, from aircraft and ship structures, to bridges, wind turbine blades, biomaterials and biomedical implants. Polymers are viscoelastic materials, and their response may be highly nonlinear and thus make it challenging to predict and monitor their in-service performance. The laboratory-scale testing platform presented herein assists the investigation of the influence of concurrent mechanical loadings and environmental conditions on these materials. The platform was designed to be low-cost and user-friendly. Its chemically resistant materials make the platform adaptable to studies of chemical degradation due to in-service exposure to fluids. An example of experiment was conducted at RT on closed-cell polyurethane foam samples loaded with a weight corresponding to ~50% of their ultimate static and dry load. Results show that the testing apparatus is appropriate for these studies. Results also highlight the larger vulnerability of the polymer under concurrent loading, based on the higher mid-point displacements and lower residual failure loads. Recommendations are made for additional improvements to the testing apparatus. PMID:25548950

The European Photovoltaic Technology Platform

International Nuclear Information System (INIS)

Nowak, S.; Aulich, H.; Bal, J.L.; Dimmler, B.; Garnier, A.; Jongerden, G.; Luther, J.; Luque, A.; Milner, A.; Nelson, D.; Pataki, I.; Pearsall, N.; Perezagua, E.; Pietruszko, S.; Rehak, J.; Schellekens, E.; Shanker, A.; Silvestrini, G.; Sinke, W.; Willemsen, H.

2006-05-01

The European Photovoltaic Technology Platform is one of the European Technology Platforms, a new instrument proposed by the European Commission. European Technology Platforms (ETPs) are a mechanism to bring together all interested stakeholders to develop a long-term vision to address a specific challenge, create a coherent, dynamic strategy to achieve that vision and steer the implementation of an action plan to deliver agreed programmes of activities and optimise the benefits for all parties. The European Photovoltaic Technology Platform has recently been established to define, support and accompany the implementation of a coherent and comprehensive strategic plan for photovoltaics. The platform will mobilise all stakeholders sharing a long-term European vision for PV, helping to ensure that Europe maintains and improves its industrial position. The platform will realise a European Strategic Research Agenda for PV for the next decade(s). Guided by a Steering Committee of 20 high level decision-makers representing all relevant European PV Stakeholders, the European PV Technology Platform comprises 4 Working Groups dealing with the subjects policy and instruments; market deployment; science, technology and applications as well as developing countries and is supported by a secretariat

The Educational Platform: Constructing Conceptual Frameworks.

Science.gov (United States)

Peca, Kathy; Isham, Mark

2001-01-01

The education faculty at Eastern New Mexico University used educational platforms as a means of developing the unit's conceptual framework. Faculty members developed personal platforms, then synthesized them into one curricular area platform. The resultant unit educational platform became the basis for the unit's conceptual framework, which…

AcEST: DK945549 [AcEST

Lifescience Database Archive (English)

Full Text Available savirus (isolate Bat/AUS/1996) GN=L PE=3 SV=2 Length = 2...HS N+ IT + K Sbjct: 81 RTEPINIYGPPEIKNTIENILKIGYHSINFKITVHEINSK 120 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lys

The community FabLab platform: applications and implications in biomedical engineering.

Science.gov (United States)

Stephenson, Makeda K; Dow, Douglas E

2014-01-01

Skill development in science, technology, engineering and math (STEM) education present one of the most formidable challenges of modern society. The Community FabLab platform presents a viable solution. Each FabLab contains a suite of modern computer numerical control (CNC) equipment, electronics and computing hardware and design, programming, computer aided design (CAD) and computer aided machining (CAM) software. FabLabs are community and educational resources and open to the public. Development of STEM based workforce skills such as digital fabrication and advanced manufacturing can be enhanced using this platform. Particularly notable is the potential of the FabLab platform in STEM education. The active learning environment engages and supports a diversity of learners, while the iterative learning that is supported by the FabLab rapid prototyping platform facilitates depth of understanding, creativity, innovation and mastery. The product and project based learning that occurs in FabLabs develops in the student a personal sense of accomplishment, self-awareness, command of the material and technology. This helps build the interest and confidence necessary to excel in STEM and throughout life. Finally the introduction and use of relevant technologies at every stage of the education process ensures technical familiarity and a broad knowledge base needed for work in STEM based fields. Biomedical engineering education strives to cultivate broad technical adeptness, creativity, interdisciplinary thought, and an ability to form deep conceptual understanding of complex systems. The FabLab platform is well designed to enhance biomedical engineering education.

National Community Solar Platform

Energy Technology Data Exchange (ETDEWEB)

Rupert, Bart [Clean Energy Collective, Louisville, CO (United States)

2016-06-30

This project was created to provide a National Community Solar Platform (NCSP) portal known as Community Solar Hub, that is available to any entity or individual who wants to develop community solar. This has been done by providing a comprehensive portal to make CEC’s solutions, and other proven community solar solutions, externally available for everyone to access – making the process easy through proven platforms to protect subscribers, developers and utilities. The successful completion of this project provides these tools via a web platform and integration APIs, a wide spectrum of community solar projects included in the platform, multiple groups of customers (utilities, EPCs, and advocates) using the platform to develop community solar, and open access to anyone interested in community solar. CEC’s Incubator project includes web-based informational resources, integrated systems for project information and billing systems, and engagement with customers and users by community solar experts. The combined effort externalizes much of Clean Energy Collective’s industry-leading expertise, allowing third parties to develop community solar without duplicating expensive start-up efforts. The availability of this platform creates community solar projects that are cheaper to build and cheaper to participate in, furthering the goals of DOE’s SunShot Initiative. Final SF 425 Final SF 428 Final DOE F 2050.11 Final Report Narrative

Flexible experimental FPGA based platform

DEFF Research Database (Denmark)

Andersen, Karsten Holm; Nymand, Morten

2016-01-01

This paper presents an experimental flexible Field Programmable Gate Array (FPGA) based platform for testing and verifying digital controlled dc-dc converters. The platform supports different types of control strategies, dc-dc converter topologies and switching frequencies. The controller platform...... interface supporting configuration and reading of setup parameters, controller status and the acquisition memory in a simple way. The FPGA based platform, provides an easy way within education or research to use different digital control strategies and different converter topologies controlled by an FPGA...

RadMAP: The Radiological Multi-sensor Analysis Platform

International Nuclear Information System (INIS)

Bandstra, Mark S.; Aucott, Timothy J.; Brubaker, Erik; Chivers, Daniel H.; Cooper, Reynold J.; Curtis, Joseph C.; Davis, John R.; Joshi, Tenzing H.; Kua, John; Meyer, Ross; Negut, Victor; Quinlan, Michael; Quiter, Brian J.; Srinivasan, Shreyas; Zakhor, Avideh; Zhang, Richard; Vetter, Kai

2016-01-01

The variability of gamma-ray and neutron background during the operation of a mobile detector system greatly limits the ability of the system to detect weak radiological and nuclear threats. The natural radiation background measured by a mobile detector system is the result of many factors, including the radioactivity of nearby materials, the geometric configuration of those materials and the system, the presence of absorbing materials, and atmospheric conditions. Background variations tend to be highly non-Poissonian, making it difficult to set robust detection thresholds using knowledge of the mean background rate alone. The Radiological Multi-sensor Analysis Platform (RadMAP) system is designed to allow the systematic study of natural radiological background variations and to serve as a development platform for emerging concepts in mobile radiation detection and imaging. To do this, RadMAP has been used to acquire extensive, systematic background measurements and correlated contextual data that can be used to test algorithms and detector modalities at low false alarm rates. By combining gamma-ray and neutron detector systems with data from contextual sensors, the system enables the fusion of data from multiple sensors into novel data products. The data are curated in a common format that allows for rapid querying across all sensors, creating detailed multi-sensor datasets that are used to study correlations between radiological and contextual data, and develop and test novel techniques in mobile detection and imaging. In this paper we will describe the instruments that comprise the RadMAP system, the effort to curate and provide access to multi-sensor data, and some initial results on the fusion of contextual and radiological data.

RadMAP: The Radiological Multi-sensor Analysis Platform

Energy Technology Data Exchange (ETDEWEB)

Bandstra, Mark S., E-mail: msbandstra@lbl.gov [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Aucott, Timothy J. [Department of Nuclear Engineering, University of California Berkeley, CA (United States); Brubaker, Erik [Sandia National Laboratory, Livermore, CA (United States); Chivers, Daniel H.; Cooper, Reynold J. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Curtis, Joseph C. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Department of Nuclear Engineering, University of California Berkeley, CA (United States); Davis, John R. [Department of Nuclear Engineering, University of California Berkeley, CA (United States); Joshi, Tenzing H.; Kua, John; Meyer, Ross; Negut, Victor; Quinlan, Michael; Quiter, Brian J. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Srinivasan, Shreyas [Department of Nuclear Engineering, University of California Berkeley, CA (United States); Department of Electrical Engineering and Computer Science, University of California Berkeley, CA (United States); Zakhor, Avideh; Zhang, Richard [Department of Electrical Engineering and Computer Science, University of California Berkeley, CA (United States); Vetter, Kai [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Department of Nuclear Engineering, University of California Berkeley, CA (United States)

2016-12-21

The variability of gamma-ray and neutron background during the operation of a mobile detector system greatly limits the ability of the system to detect weak radiological and nuclear threats. The natural radiation background measured by a mobile detector system is the result of many factors, including the radioactivity of nearby materials, the geometric configuration of those materials and the system, the presence of absorbing materials, and atmospheric conditions. Background variations tend to be highly non-Poissonian, making it difficult to set robust detection thresholds using knowledge of the mean background rate alone. The Radiological Multi-sensor Analysis Platform (RadMAP) system is designed to allow the systematic study of natural radiological background variations and to serve as a development platform for emerging concepts in mobile radiation detection and imaging. To do this, RadMAP has been used to acquire extensive, systematic background measurements and correlated contextual data that can be used to test algorithms and detector modalities at low false alarm rates. By combining gamma-ray and neutron detector systems with data from contextual sensors, the system enables the fusion of data from multiple sensors into novel data products. The data are curated in a common format that allows for rapid querying across all sensors, creating detailed multi-sensor datasets that are used to study correlations between radiological and contextual data, and develop and test novel techniques in mobile detection and imaging. In this paper we will describe the instruments that comprise the RadMAP system, the effort to curate and provide access to multi-sensor data, and some initial results on the fusion of contextual and radiological data.

Charcot-Marie-Tooth disease: The development of a diagnostic platform using next generation sequencing

DEFF Research Database (Denmark)

Christensen, Rikke; Væth, Signe; Thorsen, Kasper

, Sanger sequencing of 4 genes have led to a diagnosis in approximately 30% of the patients. Aims: 1) Development of a targeted NGS platform containing 63 genes that currently are found to be associated with CMT. 2) Analysis of the increased diagnostic yield using this platform to analyze 200 CMT samples...... previously analyzed using Sanger sequencing without identification of a disease causing mutation. Materials and Methods: Libraries for 200 patient samples obtained for CMT diagnostics were prepared using Illumina Truseq and target enrichment using SeqCap EZ Choise Library (Nimblegen). The libraries were...

Hybrid Integrated Platforms for Silicon Photonics

Directory of Open Access Journals (Sweden)

John E. Bowers

2010-03-01

Full Text Available A review of recent progress in hybrid integrated platforms for silicon photonics is presented. Integration of III-V semiconductors onto silicon-on-insulator substrates based on two different bonding techniques is compared, one comprising only inorganic materials, the other technique using an organic bonding agent. Issues such as bonding process and mechanism, bonding strength, uniformity, wafer surface requirement, and stress distribution are studied in detail. The application in silicon photonics to realize high-performance active and passive photonic devices on low-cost silicon wafers is discussed. Hybrid integration is believed to be a promising technology in a variety of applications of silicon photonics.

Product Platform Screening at LEGO

DEFF Research Database (Denmark)

Mortensen, Niels Henrik; Steen Jensen, Thomas; Nielsen, Ole Fiil

2012-01-01

Product platforms offer great benefits to companies developing new products in highly competitive markets. Literature describes how a single platform can be designed from a technical point of view, but rarely mentions how the process begins. How do companies identify possible platform candidates...... after a few changes had been applied to the initial process layout. This case study shows how companies must focus on a limited selection of simultaneous projects in order to keep focus. Primary stakeholders must be involved from the very beginning, and short presentations of the platform concepts...

Reusable platform concepts

International Nuclear Information System (INIS)

Gudmestad, O.T.; Sparby, B.K.; Stead, B.L.

1993-01-01

There is an increasing need to reduce costs of offshore production facilities in order to make development of offshore fields profitable. For small fields with short production time there is in particular a need to investigate ways to reduce costs. The idea of platform reuse is for such fields particularly attractive. This paper will review reusable platform concepts and will discuss their range of application. Particular emphasis will be placed on technical limitations. Traditional concepts as jackups and floating production facilities will be discussed by major attention will be given to newly developed ideas for reuse of steel jackets and concrete structures. It will be shown how the operator for several fields can obtain considerable savings by applying such reusable platform concepts

Disentangling Competition Among Platform Driven Strategic Groups

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric

2015-01-01

In platform-driven markets, competitive advantage is derived from superior platform design and configurations. For this reason, platform owners strive to create unique and inimitable platform configurals to maintain and extend their competitiveness within network economies. To disentangle firm...... competition within platform-driven markets, we opted for the UK mobile payment market as our empirical setting. By embracing the theoretical lens of strategic groups and digital platforms, this study supplements prior research by deriving a taxonomy of platform-driven strategic groups that is grounded...

A high performance scientific cloud computing environment for materials simulations

Science.gov (United States)

Jorissen, K.; Vila, F. D.; Rehr, J. J.

2012-09-01

We describe the development of a scientific cloud computing (SCC) platform that offers high performance computation capability. The platform consists of a scientific virtual machine prototype containing a UNIX operating system and several materials science codes, together with essential interface tools (an SCC toolset) that offers functionality comparable to local compute clusters. In particular, our SCC toolset provides automatic creation of virtual clusters for parallel computing, including tools for execution and monitoring performance, as well as efficient I/O utilities that enable seamless connections to and from the cloud. Our SCC platform is optimized for the Amazon Elastic Compute Cloud (EC2). We present benchmarks for prototypical scientific applications and demonstrate performance comparable to local compute clusters. To facilitate code execution and provide user-friendly access, we have also integrated cloud computing capability in a JAVA-based GUI. Our SCC platform may be an alternative to traditional HPC resources for materials science or quantum chemistry applications.

Platform development: implications for portfolio management

DEFF Research Database (Denmark)

Hsuan, Juliana; Hansen, Poul H. Kyvsgård

2007-01-01

" The challenge of implementing industrial platforms in practice can be described as a configuration problem caused by a considerable number of variables, which often have contradictory influences on the total performance of the firm. Consequently, the specific platform decisions become extremely...... complex, possibly increasing the strategic risks for the firm. This paper reports preliminary findings on platform management process at LEGO, a Danish toy company. Specifically, we report the process of applying games combined with simulations and workshops in the platform development. We also propose...... a framework, based on the portfolio management thinking to evaluate the degree of modularity embedded in a given platform and to which extent it is aligned with other platforms."...

Stratifying the Develoment of Product Platforms

DEFF Research Database (Denmark)

Sköld, Martin; Karlsson, Christer

2013-01-01

companies develop platforms for different aims, purposes, and product scopes. Following on from this, the requirements for platform development resources, the ways of organizing platform development, and the implications for management styles have not been explored and are presumably varying. To start...... influencing the project length, requirements for platform development resources, principles for organizing, and implications for management styles....

The COMET Sleep Research Platform.

Science.gov (United States)

Nichols, Deborah A; DeSalvo, Steven; Miller, Richard A; Jónsson, Darrell; Griffin, Kara S; Hyde, Pamela R; Walsh, James K; Kushida, Clete A

2014-01-01

The Comparative Outcomes Management with Electronic Data Technology (COMET) platform is extensible and designed for facilitating multicenter electronic clinical research. Our research goals were the following: (1) to conduct a comparative effectiveness trial (CET) for two obstructive sleep apnea treatments-positive airway pressure versus oral appliance therapy; and (2) to establish a new electronic network infrastructure that would support this study and other clinical research studies. The COMET platform was created to satisfy the needs of CET with a focus on creating a platform that provides comprehensive toolsets, multisite collaboration, and end-to-end data management. The platform also provides medical researchers the ability to visualize and interpret data using business intelligence (BI) tools. COMET is a research platform that is scalable and extensible, and which, in a future version, can accommodate big data sets and enable efficient and effective research across multiple studies and medical specialties. The COMET platform components were designed for an eventual move to a cloud computing infrastructure that enhances sustainability, overall cost effectiveness, and return on investment.

Histology of a dental implant with a platform switched implant-abutment connection

Directory of Open Access Journals (Sweden)

Vittoria Perrotti

2011-10-01

Full Text Available Background: Peri-implant crestal bone must be stable for aesthetic reasons. Aim of this study was a histologic analysis of an implant with a platform switched implant-abutment connection. Materials and methods: A 32-year-old male patient participated in this study. The patient needed a bilateral mandibular restoration. Four implants were used, and were immediately restored and loaded the same day of insertion. After a 6 weeks healing period, one implant with platform-switched abutment was retrieved with trephine. Before retrieval the implant was osseointegrated and not mobile. On one side of the implant, a 1 mm resorption of the crestal bone was present. On the contrary, on the other side no bone resorption had occurred and about 1 mm of bone was present over the implant shoulder. Results: The bone-implant contact percentage was 65.1 ± 6.3 %. Platform- switching could help in maintaining the height of the peri-implant crestal bone.

Identification of platform levels

DEFF Research Database (Denmark)

Mortensen, Niels Henrik

2005-01-01

reduction, ability to launch a wider product portfolio without increasing resources and reduction of complexity within the whole company. To support the multiple product development process, platform based product development has in many companies such as Philips, VW, Ford etc. proven to be a very effective...... product development in one step and therefore the objective of this paper is to identify levels of platform based product development. The structure of this paper is as follows. First the applied terminology for platforms will be briefly explained and then characteristics between single and multi product...... development will be examined. Based on the identification of the above characteristics five platform levels are described. The research presented in this paper is a result of MSc, Ph.D projects at the Technical University of Denmark and consultancy projects within the organisation of Institute of Product...

Photonic integration and photonics-electronics convergence on silicon platform

CERN Document Server

Liu, Jifeng; Baba, Toshihiko; Vivien, Laurent; Xu, Dan-Xia

2015-01-01

Silicon photonics technology, which has the DNA of silicon electronics technology, promises to provide a compact photonic integration platform with high integration density, mass-producibility, and excellent cost performance. This technology has been used to develop and to integrate various photonic functions on silicon substrate. Moreover, photonics-electronics convergence based on silicon substrate is now being pursued. Thanks to these features, silicon photonics will have the potential to be a superior technology used in the construction of energy-efficient cost-effective apparatuses for various applications, such as communications, information processing, and sensing. Considering the material characteristics of silicon and difficulties in microfabrication technology, however, silicon by itself is not necessarily an ideal material. For example, silicon is not suitable for light emitting devices because it is an indirect transition material. The resolution and dynamic range of silicon-based interference de...

The Innovative Capabilities Of Digital Payment Platforms

DEFF Research Database (Denmark)

Kazan, Erol

2015-01-01

This study presents a model for studying the innovative capabilities of digital payment platforms in regards to open innovation integration and commercialization. We perceive digital platforms as layered modular IT artifacts, where platform governance and the configuration of platform layers impact...... the support for open innovation. The proposed model has been employed in a comparative case study between two digital payment platforms: Apple Pay and Google Wallet. The findings suggest that digital payment platforms make use of boundary resources to be highly integrative or integratable, which supports...... the intended conjoint commercialization efforts. Furthermore, the architectural design of digital platforms impacts the access to commercialization, resulting to an exclusion or inclusion strategy in accessing value opportunities. Our findings contribute to the open innovation and digital platform literature...

PR-PR: cross-platform laboratory automation system.

Science.gov (United States)

Linshiz, Gregory; Stawski, Nina; Goyal, Garima; Bi, Changhao; Poust, Sean; Sharma, Monica; Mutalik, Vivek; Keasling, Jay D; Hillson, Nathan J

2014-08-15

To enable protocol standardization, sharing, and efficient implementation across laboratory automation platforms, we have further developed the PR-PR open-source high-level biology-friendly robot programming language as a cross-platform laboratory automation system. Beyond liquid-handling robotics, PR-PR now supports microfluidic and microscopy platforms, as well as protocol translation into human languages, such as English. While the same set of basic PR-PR commands and features are available for each supported platform, the underlying optimization and translation modules vary from platform to platform. Here, we describe these further developments to PR-PR, and demonstrate the experimental implementation and validation of PR-PR protocols for combinatorial modified Golden Gate DNA assembly across liquid-handling robotic, microfluidic, and manual platforms. To further test PR-PR cross-platform performance, we then implement and assess PR-PR protocols for Kunkel DNA mutagenesis and hierarchical Gibson DNA assembly for microfluidic and manual platforms.

Surface and material analytics based on Dresden-EBIS platform technology

Energy Technology Data Exchange (ETDEWEB)

Schmidt, M., E-mail: mike.schmidt@dreebit.com; König, J., E-mail: mike.schmidt@dreebit.com [DREEBIT GmbH, Grossroehrsdorf (Germany); Bischoff, L. [Helmholtz-Zentrum Dresden-Rossendorf, Dresden (Germany); Pilz, W. [Dresden University of Technology, Dresden (Germany); Zschornack, G. [Helmholtz-Zentrum Dresden-Rossendorf, Dresden, Germany and Dresden University of Technology, Dresden (Germany)

2015-01-09

Nowadays widely used mass spectrometry systems utilize energetic ions hitting a sample and sputter material from the surface of a specimen. The generated secondary ions are separated and detected with high mass resolution to determine the target materials constitution. Based on this principle, we present an alternative approach implementing a compact Electron Beam Ion Source (EBIS) in combination with a Liquid Metal Ion Source (LMIS). An LMIS can deliver heavy elements which generate high sputter yields on a target surface. More than 90% of this sputtered material consists of mono- and polyatomic neutrals. These particles are able to penetrate the magnetic field of an EBIS and they will be ionized within the electron beam. A broad spectrum of singly up to highly charged ions can be extracted depending on the operation conditions. Polyatomic ions will decay during the charge-up process. A standard bending magnet or a Wien filter is used to separate the different ion species due to their mass-to-charge ratio. Using different charge states of ions as it is common with EBIS it is also possible to resolve interfering charge-to-mass ratios of only singly charged ions. Different setups for the realization of feeding the electron beam with sputtered atoms of solids will be presented and discussed. As an example the analysis of a copper surface is used to show high-resolution spectra with low background noise. Individual copper isotopes and clusters with different isotope compositions can be resolved at equal atomic numbers. These results are a first step for the development of a new compact low-cost and high-resolution mass spectrometry system. In a more general context, the described technique demonstrates an efficient method for feeding an EBIS with atoms of nearly all solid elements from various solid target materials. The new straightforward design of the presented setup should be of high interest for a broad range of applications in materials research as well as for

Performance Measurement of Complex Event Platforms

Directory of Open Access Journals (Sweden)

Eva Zámečníková

2016-12-01

Full Text Available The aim of this paper is to find and compare existing solutions of complex event processing platforms (CEP. CEP platforms generally serve for processing and/or predicting of high frequency data. We intend to use CEP platform for processing of complex time series and integrate a solution for newly proposed method of decision making. The decision making process will be described by formal grammar. As there are lots of CEP solutions we will take the following characteristics under consideration - the processing in real time, possibility of processing of high volume data from multiple sources, platform independence, platform allowing integration with user solution and open license. At first we will talk about existing CEP tools and their specific way of use in praxis. Then we will mention the design of method for formalization of business rules used for decision making. Afterwards, we focus on two platforms which seem to be the best fit for integration of our solution and we will list the main pros and cons of each approach. Next part is devoted to benchmark platforms for CEP. Final part is devoted to experimental measurements of platform with integrated method for decision support.

Cretaceous tropical carbonate platform changes used as paleoclimatic and paleoceanic indicators: the three lower Cretaceous platform crises

Science.gov (United States)

Arnaud-Vanneau, A.; Vrielynck, B.

2009-04-01

Carbonate platform sediments are of biogenic origin. More commonly the bioclasts are fragments of shells and skeletons. The bioclastic composition of a limestone may reflect the nature of biota inhabiting the area and a carbonate platform can be estimated as a living factory, which reflects the prevailing ecological factors. The rate of carbonate production is highest in the tropics, in oligotrophic environments, and in the photic zone. The rate of carbonate production varies greatly with temperature and nutrient input. Three types of biotic carbonate platform can be distinguished. The highest carbonate production is linked to oligotrophic carbonate platform characterized by the presence of assemblages with hermatypic corals. This type of platform is developed in shallow marine environment, nutrient poor water and warm tropical sea. A less efficient production of carbonate platform is related to mesotrophic environments in cooler and/or deeper water and associated to nutrient flux with, sometime, detrital input. The biota includes red algae, solitary coral and branching ahermatypic corals, common bryozoans, crinoids and echinoids. The less productive carbonate platform is the eutrophic muddy platform where the mud is due to the intense bacterial activity, probably related to strong nutrient flux. All changes of type of carbonate platform can be related to climatic and oceanic changes. Three platform crises occurred during lower Cretaceous time. They are followed by important turnover of microfauna (large benthic foraminifers) and microflora (marine algae). They start with the demise of the previous oligotrophic platform, they continue with oceanic perturbations, expression of which was the widespread deposition of organic-rich sediments, well expressed during Late Aptian/Albian and Cenomanian Turonian boundary and the replacement of previous oligotrophic platforms by mesotrophic to eutrophic platforms. The first crisis occurred during Valanginian and Hauterivian

Helicopter flight simulation motion platform requirements

Science.gov (United States)

Schroeder, Jeffery Allyn

Flight simulators attempt to reproduce in-flight pilot-vehicle behavior on the ground. This reproduction is challenging for helicopter simulators, as the pilot is often inextricably dependent on external cues for pilot-vehicle stabilization. One important simulator cue is platform motion; however, its required fidelity is unknown. To determine the required motion fidelity, several unique experiments were performed. A large displacement motion platform was used that allowed pilots to fly tasks with matched motion and visual cues. Then, the platform motion was modified to give cues varying from full motion to no motion. Several key results were found. First, lateral and vertical translational platform cues had significant effects on fidelity. Their presence improved performance and reduced pilot workload. Second, yaw and roll rotational platform cues were not as important as the translational platform cues. In particular, the yaw rotational motion platform cue did not appear at all useful in improving performance or reducing workload. Third, when the lateral translational platform cue was combined with visual yaw rotational cues, pilots believed the platform was rotating when it was not. Thus, simulator systems can be made more efficient by proper combination of platform and visual cues. Fourth, motion fidelity specifications were revised that now provide simulator users with a better prediction of motion fidelity based upon the frequency responses of their motion control laws. Fifth, vertical platform motion affected pilot estimates of steady-state altitude during altitude repositionings. This refutes the view that pilots estimate altitude and altitude rate in simulation solely from visual cues. Finally, the combined results led to a general method for configuring helicopter motion systems and for developing simulator tasks that more likely represent actual flight. The overall results can serve as a guide to future simulator designers and to today's operators.

Bio-based C-3 Platform Chemical: Biotechnological Production and -Conversion of 3-Hydroxypropionaldehyde

OpenAIRE

Rezaei, Roya

2013-01-01

Demands for efficient, greener, economical and sustainable production of chemicals, materials and energy have led to development of industrial biotechnology as a key technology area to provide such products from bio-based raw materials from agricultural-, forestry- and related industrial residues and by-products. For the bio-based industry, it is essential to develop a number of building blocks or platform chemicals for C2-C6 chemicals and even aromatic chemicals. 3-hydroxypropionaldehyde (3H...

Distributed Fracturing Affecting the Isolated Carbonate Platforms, the Latemar Platform (Dolomites, North Italy).

NARCIS (Netherlands)

Boro, H.; Bertotti, G.V.; Hardebol, N.J.

2012-01-01

Isolated carbonate platforms are highly heterogeneous bodies and are typically composed of laterally juxtaposed first order domains with different sedimentological composition and organization, i.e. a well-stratified platform interior, a massive margin and a slope with steeply dipping and poorly

Platform for Testing Robotic Vehicles on Simulated Terrain

Science.gov (United States)

Lindemann, Randel

2006-01-01

The variable terrain tilt platform (VTTP) is a means of providing simulated terrain for mobility testing of engineering models of the Mars Exploration Rovers. The VTTP could also be used for testing the ability of other robotic land vehicles (and small vehicles in general) to move across terrain under diverse conditions of slope and surface texture, and in the presence of obstacles of various sizes and shapes. The VTTP consists mostly of a 16-ft-(4.88-m)-square tilt table. The tilt can be adjusted to any angle between 0 (horizontal) and 25 . The test surface of the table can be left bare; can be covered with hard, high-friction material; or can be covered with sand, gravel, and/or other ground-simulating material or combination of materials to a thickness of as much as 6 in. (approx. 15 cm). Models of rocks, trenches, and other obstacles can be placed on the simulated terrain. For example, for one of the Mars- Rover tests, a high-friction mat was attached to the platform, then a 6-in.- ( 15 cm) deep layer of dry, loose beach sand was deposited on the mat. The choice of these two driving surface materials was meant to bound the range of variability of terrain that the rover was expected to encounter on the Martian surface. At each of the different angles at which tests were performed, for some of the tests, rocklike concrete obstacles ranging in height from 10 to 25 cm were placed in the path of the rover (see figure). The development of the VTTP was accompanied by development of a methodology of testing to characterize the performance and modes of failure of a vehicle under test. In addition to variations in slope, ground material, and obstacles, testing typically includes driving up-slope, down-slope, cross-slope, and at intermediate angles relative to slope. Testing includes recording of drive-motor currents, wheel speeds, articulation of suspension mechanisms, and the actual path of the vehicle over the simulated terrain. The collected data can be used to

Flexible method for fabricating protein patterns on superhydrophobic platforms controlled by magnetic field.

Science.gov (United States)

Wang, Jian; Li, Hao; Zou, Haoyang; Wang, Chenmiao; Zhang, Hao; Mano, João F; Song, Wenlong

2017-02-28

Inspired by the rolling of water droplets on lotus leaves, we developed a novel, magnetic field-controlled patterning method for water-soluble proteins and other functional materials on superhydrophobic platforms. This simple method can be used to fabricate biochips and open micro-fluidic devices in a simple way.

Morphological indicators of growth stages in carbonates platform evolution: comparison between present-day and Miocene platforms of Northern Borneo, Malaysia.

Science.gov (United States)

Pierson, B.; Menier, D.; Ting, K. K.; Chalabi, A.

2012-04-01

Satellite images of present-day reefs and carbonate platforms of the Celebes Sea, east of Sabah, Malaysia, exhibit large-scale features indicative of the recent evolution of the platforms. These include: (1) multiple, sub-parallel reef rims at the windward margin, suggestive of back-stepping of the platform margin; (2) contraction of the platform, possibly as a result of recent sea level fluctuations; (3) colonization of the internal lagoons by polygonal reef structures and (4) fragmentation of the platforms and creation of deep channels separating platforms that used to be part of a single entity. These features are analogue to what has been observed on seismic attribute maps of Miocene carbonate platforms of Sarawak. An analysis of several growth stages of a large Miocene platform, referred to as the Megaplatform, shows that the platform evolves in function of syn-depositional tectonic movements and sea level fluctuations that result in back-stepping of the margin, illustrated by multiple reef rims, contraction of the platform, the development of polygonal structures currently interpreted as karstic in origin and fragmentation of the megaplatform in 3 sub-entities separated by deep channels that precedes the final demise of the whole platform. Comparing similar features on present-day to platforms and Miocene platforms leads to a better understanding of the growth history of Miocene platforms and to a refined predictability of reservoir and non-reservoir facies distribution.

Towards a Framework of Digital Platform Disruption

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.

2014-01-01

Digital platforms are disruptive information technology (IT) artifacts that erode conventional business logic associated with traditional market structures. This paper presents a framework for examining the disruptive potential of digital platforms whereby we postulate that the strategic interplay...... digital platforms purposely decouple platform layers, to foster open innovation and accelerate market disruption. This paper therefore represents a first concrete step aimed at unravelling the disruptive potential of digital platforms....... of governance regimes and platform layers is deterministic of whether disruptive derivatives are permitted to flourish. This framework has been employed in a comparative case study between centralized (i.e., PayPal) and decentralized (i.e., Coinkite) digital payment platforms to illustrate its applicability...

Product Platform Development in Industrial Networks

DEFF Research Database (Denmark)

Karlsson, Christer; Skold, Martin

2011-01-01

The article examines the strategic issues involved in the deployment of product platform development in an industrial network. The move entails identifying the types and characteristics of generically different product platform strategies and clarifying strategic motives and differences. Number o...... of platforms and product brands serve as the key dimensions when distinguishing the different strategies. Each strategy has its own challenges and raises various issues to deal with.......The article examines the strategic issues involved in the deployment of product platform development in an industrial network. The move entails identifying the types and characteristics of generically different product platform strategies and clarifying strategic motives and differences. Number...

The universal modular platform

International Nuclear Information System (INIS)

North, R.B.

1995-01-01

A new and patented design for offshore wellhead platforms has been developed to meet a 'fast track' requirement for increased offshore production, from field locations not yet identified. The new design uses modular construction to allow for radical changes in the water depth of the final location and assembly line efficiency in fabrication. By utilizing high strength steels and structural support from the well conductors the new design accommodates all planned production requirements on a support structure significantly lighter and less expensive than the conventional design it replaces. Twenty two platforms based on the new design were ready for installation within 18 months of the project start. Installation of the new platforms began in 1992 for drilling support and 1993 for production support. The new design has become the Company standard for all future production platforms. Large saving and construction costs have been realized through its light weight, flexibility in both positioning and water depth, and its modular construction

Tunable Microwave Component Technologies for SatCom-Platforms

Science.gov (United States)

Maune, Holger; Jost, Matthias; Wiens, Alex; Weickhmann, Christian; Reese, Roland; Nikfalazar, Mohammad; Schuster, Christian; Franke, Tobias; Hu, Wenjuan; Nickel, Matthias; Kienemund, Daniel; Prasetiadi, Ananto Eka; Jakoby, Rolf

2017-03-01

Modern communication platforms require a huge amount of switched RF component banks especially made of different filters and antennas to cover all operating frequencies and bandwidth for the targeted services and application scenarios. In contrast, reconfigurable devices made of tunable components lead to a considerable reduction in complexity, size, weight, power consumption, and cost. This paper gives an overview of suitable technologies for tunable microwave components especially for SatCom applications. Special attention is given to tunable components based on functional materials such as barium strontium titanate (BST) and liquid crystal (LC).

An experimental platform for pulsed-power driven magnetic reconnection

Science.gov (United States)

Hare, J. D.; Suttle, L. G.; Lebedev, S. V.; Loureiro, N. F.; Ciardi, A.; Chittenden, J. P.; Clayson, T.; Eardley, S. J.; Garcia, C.; Halliday, J. W. D.; Robinson, T.; Smith, R. A.; Stuart, N.; Suzuki-Vidal, F.; Tubman, E. R.

2018-05-01

We describe a versatile pulsed-power driven platform for magnetic reconnection experiments, based on the exploding wire arrays driven in parallel [Suttle et al., Phys. Rev. Lett. 116, 225001 (2016)]. This platform produces inherently magnetised plasma flows for the duration of the generator current pulse (250 ns), resulting in a long-lasting reconnection layer. The layer exists for long enough to allow the evolution of complex processes such as plasmoid formation and movement to be diagnosed by a suite of high spatial and temporal resolution laser-based diagnostics. We can access a wide range of magnetic reconnection regimes by changing the wire material or moving the electrodes inside the wire arrays. We present results with aluminium and carbon wires, in which the parameters of the inflows and the layer that forms are significantly different. By moving the electrodes inside the wire arrays, we change how strongly the inflows are driven. This enables us to study both symmetric reconnection in a range of different regimes and asymmetric reconnection.

Nanoparticle "Theranostic" Platforms for Applications in Cancer

Science.gov (United States)

Steiner, Jason Michael

The study and implementation of nanotechnology as applied to biology is making substantial progress toward the expansion of the dialogue between synthetic and biological systems. This dialogue leads to a deeper understanding of the origins, manifestations, and characteristics of biological phenomenon that ultimately will lead to improved methods of diagnosing and treating a variety of pathologies. Perhaps the most prevalent application of this new technology is in the field of cancer research, encompassing an array of diagnostic and therapeutic approaches for in vivo utilization. These approaches include novel ways of enhancing tumor imaging for earlier detection or delivering toxic therapeutics directly to the site of action, sparing the systemic damage that so often accompanies cancer treatment. However, it is the combination of these essential and orthogonal functionalities that is the hallmark of the promise of nanotechnology. Such materials, coined as "theranostics" for their therapeutic and diagnostic capabilities, allow for a new depth of understanding of the behavior of nanoparticles in vivo, and in particular their efficacy as therapeutic treatments. This dissertation discusses the development of platforms and materials that may be employed as theranostic cancer agents from two distinct philosophical approaches---what may be called "traditional" and "non-traditional" nanotechnology. The "non-traditional" approach details the development of a novel DNA nanoparticle platform created through an exponential enrichment process for selected cell targeting. The products compose a novel class of nanoparticles that possess all of the naturally advantageous properties of DNA. The remainder of the dissertation presents a more "traditional" approach to hierarchical nanoparticle construction, discussing synthesis, stabilization and functionalization of theranostic materials of iron oxide and gold and their combination into novel nanostructures for more efficacious in

eGender-from e-Learning to e-Research: a web-based interactive knowledge-sharing platform for sex- and gender-specific medical education.

Science.gov (United States)

Seeland, Ute; Nauman, Ahmad T; Cornelis, Alissa; Ludwig, Sabine; Dunkel, Mathias; Kararigas, Georgios; Regitz-Zagrosek, Vera

2016-01-01

Sex and Gender Medicine is a novel discipline that provides equitable medical care for society and improves outcomes for both male and female patients. The integration of sex- and gender-specific knowledge into medical curricula is limited due to adequate learning material, systematic teacher training and an innovative communication strategy. We aimed at initiating an e-learning and knowledge-sharing platform for Sex and Gender Medicine, the eGender platform (http://egender.charite.de), to ensure that future doctors and health professionals will have adequate knowledge and communication skills on sex and gender differences in order to make informed decisions for their patients. The web-based eGender knowledge-sharing platform was designed to support the blended learning pedagogical teaching concept and follows the didactic concept of constructivism. Learning materials developed by Sex and Gender Medicine experts of seven universities have been used as the basis for the new learning tools . The content of these tools is patient-centered and provides add-on information on gender-sensitive aspects of diseases. The structural part of eGender was designed and developed using the open source e-learning platform Moodle. The eGender platform comprises an English and a German version of e-learning modules: one focusing on basic knowledge and seven on specific medical disciplines. Each module consists of several courses corresponding to a disease or symptom complex. Self-organized learning has to be managed by using different learning tools, e.g., texts and audiovisual material, tools for online communication and collaborative work. More than 90 users from Europe registered for the eGender Medicine learning modules. The most frequently accessed module was "Gender Medicine-Basics" and the users favored discussion forums. These e-learning modules fulfill the quality criteria for higher education and are used within the elective Master Module "Gender Medicine

New microfluidic platform for life sciences in South Africa

CSIR Research Space (South Africa)

Hugo, S

2012-10-01

Full Text Available is also offered as numerous devices can be implemented on one disc. A variety of components from sample preparation through to detection can be implemented simply and effectively into an integrated microfluidic solution for life sciences. The lab... in the field of centrifugal microfluidics. New microfluidic platform for life sciences in South Africa S. HUGO, K. LAND CSIR Materials Science and Manufacturing P O Box 395, Pretoria 0001, SOUTH AFRICA Email: kland@csir.co.za INTRODUCTION Microfluidic...

30 CFR 75.1403-2 - Criteria-Hoists transporting materials; brakes.

Science.gov (United States)

2010-07-01

... Mantrips § 75.1403-2 Criteria—Hoists transporting materials; brakes. Hoists and elevators used to transport materials should be equipped with brakes capable of stopping and holding the fully loaded platform, cage... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Criteria-Hoists transporting materials; brakes...

New offshore platform in the Mexican Gulf

Energy Technology Data Exchange (ETDEWEB)

Beisel, T.

1982-04-01

After a construction period of only 10 months, the second steel Offshore platform was recently completed in the Mexican Gulf. The pattern for this structure was the Cognac platform. The erection of the new platform, called the 'Cerveza' platform, is described in the article.

Sinking offshore platform. Nedsenkbar fralandsplatform

Energy Technology Data Exchange (ETDEWEB)

Einstabland, T.B.; Olsen, O.

1988-12-19

The invention deals with a sinking offshore platform of the gravitational type designed for being installed on the sea bed on great depths. The platform consists of at least three inclining pillars placed on a foundation unit. The pillars are at the upper end connected to a tower structure by means of a rigid construction. The tower supports the platform deck. The rigid construction comprises a centre-positioned cylinder connected to the foundation. 11 figs.

Understanding Platform-Based Digital Currencies

OpenAIRE

Ben Fung; Hanna Halaburda

2014-01-01

Given technological advances and the widespread use of the Internet, various digital currencies have emerged. In most cases, Internet platforms such as Facebook and Amazon restrict the functionality of their digital currencies to enhance the business model and maximize their profits. While platform-based digital currencies could increase the efficiency of retail payments, they could also raise some important policy issues if they were to become widely used outside of the platform. Thus, it is...

Design of self-contained sensor for monitoring of deep-sea offshore platform

Science.gov (United States)

Song, Yang; Yu, Yan; Zhang, Chunwei; Dong, Weijie; Ou, Jinping

2013-04-01

Offshore platform, which is the base of the production and living in the sea, is the most important infrastructure for developing oil and gas resources. At present, there are almost 6500 offshore platforms servicing in the 53 countries' sea areas around the world, creating great wealth for the world. In general, offshore platforms may work for 20 years, however, offshore platforms are expensive, complex, bulky, and so many of them are on extended active duty. Because of offshore platforms servicing in the harsh marine environment for a long time, the marine environment have a great impact on the offshore platforms. Besides, with the impact and erosion of seawater, and material aging, the offshore platform is possible to be in unexpected situations when a badly sudden situation happens. Therefore, it is of great significance to monitor the marine environment and offshore platforms. The self-contained sensor for deep-sea offshore platform with its unique design, can not only effectively extend the working time of the sensor with the capability of converting vibration energy to electrical energy, but also simultaneously collect the data of acceleration, inclination, temperature and humidity of the deep sea, so that we can achieve the purpose of monitoring offshore platforms through analyzing the collected data. The self-contained sensor for monitoring of deep-sea offshore platform includes sensing unit, data collecting and storage unit, the energy supply unit. The sensing unit with multi-variables, consists of an accelerometer LIS344ALH, an inclinometer SCA103T and a temperature and humidity sensor SHT11; the data collecting and storage unit includes the MSP430 low-power MCU, large capacity memory, clock circuit and the communication interface, the communication interface includes USB interface, serial ports and wireless interface; in addition, the energy supply unit, converting vibration to electrical energy to power the overall system, includes the electromagnetic

A platform for communicating construction material information between e-commerce systems

Institute of Scientific and Technical Information of China (English)

Stephen C W Kong; LI Heng; SHEN Qi-ping

2004-01-01

E-commerce systems for construction material procurement are becoming increasingly important in Hong Kong. These E-commerce systems are non-interoperable and create problems for the buyers who use these systems to purchase construction materials. This paper presents the mobile agent-based approach and Web serv-ices-based approach for enabling interoperation of these systems in the E-Union environment.

A novel classification and online platform for planning and documentation of medical applications of additive manufacturing.

Science.gov (United States)

Tuomi, Jukka; Paloheimo, Kaija-Stiina; Vehviläinen, Juho; Björkstrand, Roy; Salmi, Mika; Huotilainen, Eero; Kontio, Risto; Rouse, Stephen; Gibson, Ian; Mäkitie, Antti A

2014-12-01

Additive manufacturing technologies are widely used in industrial settings and now increasingly also in several areas of medicine. Various techniques and numerous types of materials are used for these applications. There is a clear need to unify and harmonize the patterns of their use worldwide. We present a 5-class system to aid planning of these applications and related scientific work as well as communication between various actors involved in this field. An online, matrix-based platform and a database were developed for planning and documentation of various solutions. This platform will help the medical community to structurally develop both research innovations and clinical applications of additive manufacturing. The online platform can be accessed through http://www.medicalam.info. © The Author(s) 2014.

Evolutionary space platform concept study. Volume 2, part B: Manned space platform concepts

Science.gov (United States)

1982-01-01

Logical, cost-effective steps in the evolution of manned space platforms are investigated and assessed. Tasks included the analysis of requirements for a manned space platform, identifying alternative concepts, performing system analysis and definition of the concepts, comparing the concepts and performing programmatic analysis for a reference concept.

Polymer-based platform for microfluidic systems

Science.gov (United States)

Benett, William [Livermore, CA; Krulevitch, Peter [Pleasanton, CA; Maghribi, Mariam [Livermore, CA; Hamilton, Julie [Tracy, CA; Rose, Klint [Boston, MA; Wang, Amy W [Oakland, CA

2009-10-13

A method of forming a polymer-based microfluidic system platform using network building blocks selected from a set of interconnectable network building blocks, such as wire, pins, blocks, and interconnects. The selected building blocks are interconnectably assembled and fixedly positioned in precise positions in a mold cavity of a mold frame to construct a three-dimensional model construction of a microfluidic flow path network preferably having meso-scale dimensions. A hardenable liquid, such as poly (dimethylsiloxane) is then introduced into the mold cavity and hardened to form a platform structure as well as to mold the microfluidic flow path network having channels, reservoirs and ports. Pre-fabricated elbows, T's and other joints are used to interconnect various building block elements together. After hardening the liquid the building blocks are removed from the platform structure to make available the channels, cavities and ports within the platform structure. Microdevices may be embedded within the cast polymer-based platform, or bonded to the platform structure subsequent to molding, to create an integrated microfluidic system. In this manner, the new microfluidic platform is versatile and capable of quickly generating prototype systems, and could easily be adapted to a manufacturing setting.

Offshore Minerals Management Platforms for the Gulf of Mexico (GOM), Geographic NAD83, MMS (2006) [platforms_mms_2006

Data.gov (United States)

Louisiana Geographic Information Center — Offshore Minerals Management Platforms for the Gulf of Mexico (GOM). Identifies the location of platforms in GOM. All platforms existing in the database are included.

Platforms.

Science.gov (United States)

Josko, Deborah

2014-01-01

The advent of DNA sequencing technologies and the various applications that can be performed will have a dramatic effect on medicine and healthcare in the near future. There are several DNA sequencing platforms available on the market for research and clinical use. Based on the medical laboratory scientist or researcher's needs and taking into consideration laboratory space and budget, one can chose which platform will be beneficial to their institution and their patient population. Although some of the instrument costs seem high, diagnosing a patient quickly and accurately will save hospitals money with fewer hospital stays and targeted treatment based on an individual's genetic make-up. By determining the type of disease an individual has, based on the mutations present or having the ability to prescribe the appropriate antimicrobials based on the knowledge of the organism's resistance patterns, the clinician will be better able to treat and diagnose a patient which ultimately will improve patient outcomes and prognosis.

Microfluidic Platform for the Elastic Characterization of Mouse Submandibular Glands by Atomic Force Microscopy

Directory of Open Access Journals (Sweden)

Aaron P. Mosier

2014-02-01

Full Text Available The ability to characterize the microscale mechanical properties of biological materials has the potential for great utility in the field of tissue engineering. The development and morphogenesis of mammalian tissues are known to be guided in part by mechanical stimuli received from the local environment, and tissues frequently develop to match the physical characteristics (i.e., elasticity of their environment. Quantification of these material properties at the microscale may provide valuable information to guide researchers. Presented here is a microfluidic platform for the non-destructive ex vivo microscale mechanical characterization of mammalian tissue samples by atomic force microscopy (AFM. The device was designed to physically hold a tissue sample in a dynamically controllable fluid environment while allowing access by an AFM probe operating in force spectroscopy mode to perform mechanical testing. Results of measurements performed on mouse submandibular gland samples demonstrate the ability of the analysis platform to quantify sample elasticity at the microscale, and observe chemically-induced changes in elasticity.

Development of generic and strategic skills through a wiki platform in industrial engineering programs

Directory of Open Access Journals (Sweden)

L. Celorrio-Barragué

2016-03-01

Full Text Available This paper describes the collaborative learning task carried out in the framework of a Strength of Materials course in an undergraduate degree program in Industrial Engineering using a wiki platform as a support tool. Stages of the teaching/learning process are described. These are: organization of the wiki to host the work of student groups, creation of working groups and assignation of projects, delivery of guidance material and model, editing the project and publishing pages on the wiki, assessments performed using rubrics, and the results obtained. The wiki platform provides interesting statistics for evaluating cooperation between students and time variation of students’ effort. The final quality of the projects is very high because a midterm evaluation in the form of a “peer review rubric” is carried out. Then, students improve their projects. The paper concludes by gathering the opinions made by students; the benefits provided by this teaching experience are then analyzed.

Towards a Framework of Digital Platform Competition

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.

2016-01-01

between monopolistic (i.e., Pingit) and federated (i.e., Paym) mobile payment platforms to illustrate its applicability and yield principles on the nature and impact of competition among platform-driven ubiquitous systems. Preliminary findings indicate that monopolistic mobile digital platforms attempt...... to create unique configurals to obtain monopolistic power by tightly coupling platform layers, which are difficult to replicate. Conversely, federated digital platforms compete by dispersing the service layer to harness the collective resources from individual firms. Furthermore, the interaction...

Nitrogen-containing polymers as a platform for CO2 electroreduction.

Science.gov (United States)

Ponnurangam, Sathish; Chernyshova, Irina V; Somasundaran, Ponisseril

2017-06-01

Heterogeneous electroreduction of CO 2 has received considerable attention in the past decade. However, none of the earlier reviews has been dedicated to nitrogen-containing polymers (N-polymers) as an emerging platform for conversion of CO 2 to industrially useful chemicals. The term 'platform' is used here to underscore that the role of N-polymers is not only to serve as direct catalysts (through loaded metals) but also as co-catalysts/promoters and stabilizing agents. This review covers the current state, advantages, challenges, and prospects of the application of N-polymer-metal composites, also referred as polymer functionalized, coated, or modified electrodes, as well as functional hybrid materials, for the electrocatalytic conversion of CO 2 . It briefly surveys the efficiencies of the N-polymer-metal electrodes already used for this application, methods of their fabrication, and proposed mechanisms of their catalytic activities. Copyright © 2016 Elsevier B.V. All rights reserved.

Novel polymeric materials from triglycerides

Science.gov (United States)

Triglycerides are good platforms for new polymeric products that can substitute for petroleum-based materials. As part of our research emphasis in sustainability and green polymer chemistry, we have explored a number of reactions in efforts to produce a wide range of value-added products. In this ...

Assembly procedure for Shot Loading Platform

International Nuclear Information System (INIS)

Routh, R.D.

1995-01-01

This supporting document describes the assembly procedure for the Shot Loading Platform. The Shot Loading Platform is used by multiple equipment removal projects to load shielding shot in the annular spaces of the equipment storage containers. The platform height is adjustable to accommodate different sizes of storage containers and transport assemblies

Functional Polymers in Protein Detection Platforms: Optical, Electrochemical, Electrical, Mass-Sensitive, and Magnetic Biosensors

Directory of Open Access Journals (Sweden)

Jong-in Hahm

2011-03-01

Full Text Available The rapidly growing field of proteomics and related applied sectors in the life sciences demands convenient methodologies for detecting and measuring the levels of specific proteins as well as for screening and analyzing for interacting protein systems. Materials utilized for such protein detection and measurement platforms should meet particular specifications which include ease-of-mass manufacture, biological stability, chemical functionality, cost effectiveness, and portability. Polymers can satisfy many of these requirements and are often considered as choice materials in various biological detection platforms. Therefore, tremendous research efforts have been made for developing new polymers both in macroscopic and nanoscopic length scales as well as applying existing polymeric materials for protein measurements. In this review article, both conventional and alternative techniques for protein detection are overviewed while focusing on the use of various polymeric materials in different protein sensing technologies. Among many available detection mechanisms, most common approaches such as optical, electrochemical, electrical, mass-sensitive, and magnetic methods are comprehensively discussed in this article. Desired properties of polymers exploited for each type of protein detection approach are summarized. Current challenges associated with the application of polymeric materials are examined in each protein detection category. Difficulties facing both quantitative and qualitative protein measurements are also identified. The latest efforts on the development and evaluation of nanoscale polymeric systems for improved protein detection are also discussed from the standpoint of quantitative and qualitative measurements. Finally, future research directions towards further advancements in the field are considered.

Facebook and the engineering of connectivity: a multi-layered approach to social media platforms

NARCIS (Netherlands)

van Dijck, J.

2013-01-01

This article aims to explain how Web 2.0 platforms in general, and Facebook in particular, engineers online connections. Connectivity has become the material and metaphorical wiring of our culture, a culture in which technologies shape and are shaped not only by economic and legal frames, but also

Deployment of Mobile Learning Course Materials to Android Powered Mobile Devices

Science.gov (United States)

Chao, Lee

2012-01-01

The objective of this article is to facilitate mobile teaching and learning by providing an alternative course material deployment method. This article suggests a course material deployment platform for small universities or individual instructors. Different from traditional course material deployment methods, the method discussed deploys course…

Platform decisions supported by gaming

DEFF Research Database (Denmark)

Hansen, Poul H. Kyvsgård; Mikkola, Juliana Hsuan

2007-01-01

Platform is an ambiguous multidisciplinary concept. The philosophy behind it is easy to communicate and makes intuitively sense. However, the ease in communication does overshadow the high complexity when the concept is implemented. The practical industrial platform implementation challenge can...... be described as being a configuration problem with a high number of variables. These variables are different in nature; they have contradictory influence on the total performance, and, their importance change over time. Consequently, the specific platform decisions become highly complex and the consequences...

Digital platforms as enablers for digital transformation

DEFF Research Database (Denmark)

Hossain, Mokter; Lassen, Astrid Heidemann

transformation is crucial. This study aims at exploring how organizations are driven towards transformation in various ways to embrace digital platforms for ideas, technologies, and knowledge. It shows the opportunities and challenges digital platforms bring in organizations. It also highlights underlying......Digital platforms offer new ways for organizations to collaborate with the external environment for ideas, technologies, and knowledge. They provide new possibilities and competence but they also bring new challenges for organizations. Understanding the role of these platforms in digital...... mechanisms and potential outcomes of various digital platforms. The contribution of the submission is valuable for scholars to understand and further explore this area. It provides insight for practitioners to capture value through digital platforms and accelerate the pace of organizations’ digital...

[Orange Platform].

Science.gov (United States)

Toba, Kenji

2017-07-01

The Organized Registration for the Assessment of dementia on Nationwide General consortium toward Effective treatment in Japan (ORANGE platform) is a recently established nationwide clinical registry for dementia. This platform consists of multiple registries of patients with dementia stratified by the following clinical stages: preclinical, mild cognitive impairment, early-stage, and advanced-stage dementia. Patients will be examined in a super-longitudinal fashion, and their lifestyle, social background, genetic risk factors, and required care process will be assessed. This project is also notable because the care registry includes information on the successful, comprehensive management of patients with dementia. Therefore, this multicenter prospective cohort study will contribute participants to all clinical trials for Alzheimer's disease as well as improve the understanding of individuals with dementia.

Application of virtual distances methodology to laser tracker verification with an indexed metrology platform

International Nuclear Information System (INIS)

Acero, R; Pueo, M; Santolaria, J; Aguilar, J J; Brau, A

2015-01-01

High-range measuring equipment like laser trackers need large dimension calibrated reference artifacts in their calibration and verification procedures. In this paper, a new verification procedure for portable coordinate measuring instruments based on the generation and evaluation of virtual distances with an indexed metrology platform is developed. This methodology enables the definition of an unlimited number of reference distances without materializing them in a physical gauge to be used as a reference. The generation of the virtual points and reference lengths derived is linked to the concept of the indexed metrology platform and the knowledge of the relative position and orientation of its upper and lower platforms with high accuracy. It is the measuring instrument together with the indexed metrology platform one that remains still, rotating the virtual mesh around them. As a first step, the virtual distances technique is applied to a laser tracker in this work. The experimental verification procedure of the laser tracker with virtual distances is simulated and further compared with the conventional verification procedure of the laser tracker with the indexed metrology platform. The results obtained in terms of volumetric performance of the laser tracker proved the suitability of the virtual distances methodology in calibration and verification procedures for portable coordinate measuring instruments, broadening and expanding the possibilities for the definition of reference distances in these procedures. (paper)

Application of virtual distances methodology to laser tracker verification with an indexed metrology platform

Science.gov (United States)

Acero, R.; Santolaria, J.; Pueo, M.; Aguilar, J. J.; Brau, A.

2015-11-01

High-range measuring equipment like laser trackers need large dimension calibrated reference artifacts in their calibration and verification procedures. In this paper, a new verification procedure for portable coordinate measuring instruments based on the generation and evaluation of virtual distances with an indexed metrology platform is developed. This methodology enables the definition of an unlimited number of reference distances without materializing them in a physical gauge to be used as a reference. The generation of the virtual points and reference lengths derived is linked to the concept of the indexed metrology platform and the knowledge of the relative position and orientation of its upper and lower platforms with high accuracy. It is the measuring instrument together with the indexed metrology platform one that remains still, rotating the virtual mesh around them. As a first step, the virtual distances technique is applied to a laser tracker in this work. The experimental verification procedure of the laser tracker with virtual distances is simulated and further compared with the conventional verification procedure of the laser tracker with the indexed metrology platform. The results obtained in terms of volumetric performance of the laser tracker proved the suitability of the virtual distances methodology in calibration and verification procedures for portable coordinate measuring instruments, broadening and expanding the possibilities for the definition of reference distances in these procedures.

Mobile materials handling platform interface architecture for mass production environments

CSIR Research Space (South Africa)

Walker, A

2008-01-01

Full Text Available Industrial manufacturing systems achieve production stability due to near constant production processes e.g. mass production. Passive methods such as production flow analysis can produce plant layouts which optimise material flow within...

Comparative performance of the BGISEQ-500 versus Illumina HiSeq2500 sequencing platforms for palaeogenomic sequencing

DEFF Research Database (Denmark)

Mak, Sarah Siu Tze Mak; Gopalakrishnan, Shyam Sunder; Carøe, Christian

2017-01-01

on degraded DNA, then directly compared the sequencing performance and data quality of the BGISEQ-500 to the Illumina HiSeq2500 platform, on DNA extracted from eight historic and ancient dog and wolf samples. Results: The data generated was largely comparable between sequencing platforms...... difference was also observed in the mitochondrial DNA percentages recovered (p = 0.018), although we believe this is likely a stochastic effect relating to the extremely low levels of mitochondria that were sequenced from three of the samples with overall very low levels of endogenous DNA. Conclusions......: Although we acknowledge our analyses were limited to animal material, our observations suggest that the BGISEQ-500 holds the potential to represent valid and potentially valuable alternative platform for palaeogenomic data generation, that is worthy of future exploration by those interested...

Windows Azure Platform

CERN Document Server

Redkar, Tejaswi

2011-01-01

The Windows Azure Platform has rapidly established itself as one of the most sophisticated cloud computing platforms available. With Microsoft working to continually update their product and keep it at the cutting edge, the future looks bright - if you have the skills to harness it. In particular, new features such as remote desktop access, dynamic content caching and secure content delivery using SSL make the latest version of Azure a more powerful solution than ever before. It's widely agreed that cloud computing has produced a paradigm shift in traditional architectural concepts by providin

76 FR 21318 - Notice of Funds Availability; Inviting Applications for the Quality Samples Program

Science.gov (United States)

2011-04-15

... to the final destination will not be eligible for reimbursement. CCC will not reimburse the costs... run in the destination country). QSP projects shall target foreign importers and audiences who: Have... proposal that incorporates requests for funding and recommendations for virtually all of the FAS marketing...

77 FR 24166 - Notice of Funds Availability; Inviting Applications for the Quality Samples Program

Science.gov (United States)

2012-04-23

... to the final destination will not be eligible for reimbursement. CCC will not reimburse the costs... run in the destination country). QSP projects shall target foreign importers and audiences who: Have... proposal that incorporates requests for funding and recommendations for virtually all of the FAS marketing...

78 FR 23896 - Notice of Funds Availability: Inviting Applications for the Quality Samples Program

Science.gov (United States)

2013-04-23

... proposals for the 2014 Quality Samples Program (QSP). The intended effect of this notice is to solicit... Strategy (UES) application Internet Web site. The UES allows applicants to submit a single consolidated and... of the FAS marketing programs, financial assistance programs, and market access programs. The...

Radiographic inspection on offshore platforms

International Nuclear Information System (INIS)

Soares, Sergio Damasceno; Sperandio, Augusto Gasparoni

1994-01-01

One of the great challenges for non-destructive inspection is on offshore platforms, where safety is a critical issue. Inspection by gammagraphy is practically forbidden on the platform deck due to problems to personnel safety and radiological protection. Ir-192 sources are used and the risk of an accident with loss of radioisotope must be considered. It is unfeasible to use gammagraphy, because in case of an accident the rapid evacuation from the platform would be impossible. This problem does not occur when X-ray equipment is used as the radiation source. The limited practicality and portability of the X-ray equipment have prevented its use as a replacement for the gammagraphy. This paper presents the preliminary tests to see the viable use of radiographic tests with constant potential on offshore platforms. (author). 2 refs., 1 fig., 2 tabs, 3 photos

Towards A Research Agenda on Digital Platform Disruption

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.

Digital platforms are disruptive IT artifacts, because they facilitate the quick release of innovative platform derivatives from third parties. This study endeavors to unravel the disruptive potential, caused by distinct designs and configurations of digital platforms on market environments. We...... postulate that the disruptive potential of digital platforms is determined by the degree of alignment among the business, technology and platform profiles. Furthermore, we argue that the design and configuration of the aforementioned three elements dictates the extent to which open innovation is permitted....... To shed light on the disruptive potential of digital platforms, we opted for digital payment platforms as our unit of analysis. Through interviews with experts and payment providers, we seek to gain an in-depth appreciation of how contemporary digital payment platforms are designed and configured...

Students' Acceptance of an Educational Videos Platform: A Study in A Portuguese University

Science.gov (United States)

Costa, Carolina; Alvelos, Helena; Teixeira, Leonor

2018-01-01

The Educast is an educational videos' platform that captures simultaneously video and digital support materials. This paper presents a study on the acceptance of Educast, by students, using the Technology Acceptance Model--TAM. The data was collected through a questionnaire applied to 54 students which results were analyzed using descriptive…

Impact of platform switching on inter-proximal bone levels around short implants in the posterior region; 1-year results from a randomized clinical trial

NARCIS (Netherlands)

Telleman, Gerdien; Raghoebar, Gerry M.; Vissink, Arjan; Meijer, Henny J. A.; Meyer, H.J.A.

Aim To assess the outcome of short implants (8.5 mm) supplied with a conventional platform-matched implant-abutment connection or a platform-switched design. Materials and Methods Eighty patients with one or more missing teeth in the posterior zone were randomly assigned to be treated with implants

The Definitive Guide to NetBeans Platform

CERN Document Server

Bock, Heiko

2009-01-01

The Definitive Guide to NetBeans(t) Platform is a thorough and definitive introduction to the NetBeans Platform, covering all its major APIs in detail, with relevant code examples used throughout. The original German book on which this title is based was well received. The NetBeans Platform Community has put together this English translation, which author Heiko Bock updated to cover the latest NetBeans Platform 6.5 APIs. With an introduction by known NetBeans Platform experts Jaroslav Tulach, Tim Boudreau, and Geertjan Wielenga, this is the most up-to-date book on this topic at the moment. All

Potential Fish Production Impacts from Partial Removal of Decommissioned Oil and Gas Platforms off the Coast of California

Science.gov (United States)

Claisse, J.; Pondella, D.; Love, M.; Zahn, L.; Williams, C.; Bull, A. S.

2016-02-01

When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

Prepolishing on a CNC platform with bound abrasive contour tools

Science.gov (United States)

Schoeffler, Adrienne E.; Gregg, Leslie L.; Schoen, John M.; Fess, Edward M.; Hakiel, Michael; Jacobs, Stephen D.

2003-05-01

Deterministic microgrinding (DMG) of optical glasses and ceramics is the commercial manufacturing process of choice to shape glass surfaces prior to final finishing. This process employs rigid bound matrix diamond tooling resulting in surface roughness values of 3-5μm peak to valley and 100-400nm rms, as well as mid-spatial frequency tool marks that require subsequent removal in secondary finishing steps. The ability to pre-polish optical surfaces within the grinding platform would reduce final finishing process times. Bound abrasive contour wheels containing cerium oxide, alumina or zirconia abrasives were constructed with an epoxy matrix. The effects of abrasive type, composition, and erosion promoters were examined for tool hardness (Shore D), and tested with commercial optical glasses in an Optipro CNC grinding platform. Metrology protocols were developed to examine tool wear and subsequent surface roughness. Work is directed to demonstrating effective material removal, improved surface roughness and cutter mark removal.

A practice scaffolding interactive platform

DEFF Research Database (Denmark)

Bundsgaard, Jeppe

2009-01-01

A Practice Scaffolding Interactive Platform (PracSIP) is a social learning platform which supports students in collaborative project based learning by simulating a professional practice. A PracSIP puts the core tools of the simulated practice at the students' disposal, it organizes collaboration...

Development of a Modular Robotic Platform

Directory of Open Access Journals (Sweden)

Claudiu Ioan Cirebea

2014-12-01

Full Text Available In this paper a modular robotic platform is presented, for students and researchers laboratory work based on the Matlab-Simulink and dSpace real time control platform. The goal of this combination is to stimulate and to experiment with real time hardware and software in courses where mobile robotics is adopted as a motivating platform to introduce mechatronics competencies. Its many possibilities for modifications and extensions make experiments very easy. We used, for example, an omnidirectional mobile robot configuration with three Swedish wheels, whose kinematic model was simulated using Simulink. For real-time control, of the robot, the developed model has been implemented using DSpace platform DS1103.

Direct-Dispense Polymeric Waveguides Platform for Optical Chemical Sensors

Directory of Open Access Journals (Sweden)

Mohamad Hajj-Hassan

2008-12-01

Full Text Available We describe an automated robotic technique called direct-dispense to fabricate a polymeric platform that supports optical sensor arrays. Direct-dispense, which is a type of the emerging direct-write microfabrication techniques, uses fugitive organic inks in combination with cross-linkable polymers to create microfluidic channels and other microstructures. Specifically, we describe an application of direct-dispensing to develop optical biochemical sensors by fabricating planar ridge waveguides that support sol-gelderived xerogel-based thin films. The xerogel-based sensor materials act as host media to house luminophore biochemical recognition elements. As a prototype implementation, we demonstrate gaseous oxygen (O2 responsive optical sensors that operate on the basis of monitoring luminescence intensity signals. The optical sensor employs a Light Emitting Diode (LED excitation source and a standard silicon photodiode as the detector. The sensor operates over the full scale (0%-100% of O2 concentrations with a response time of less than 1 second. This work has implications for the development of miniaturized multisensor platforms that can be cost-effectively and reliably mass-produced.

Platform economy in Denmark – precarious employment?

DEFF Research Database (Denmark)

Rasmussen, Stine; Madsen, Per Kongshøj

limited. Nevertheless the labour offered through the platforms has a precarious character for instance in terms of lower wages and poorer rights and protection compared to the labour at the traditional, offline labour market. One important issue here is also the confusion as to whether the worker......This paper takes a labour market perspective on the emerging concept of the 'sharing economy' or 'platform economy', which we use as a more appropriate term for the phenomenon. Platform economy is in the article understood as those business models that have emerged since the millennium, where...... digital platforms serve as the link between persons wanting to make use of certain activities, services etc. and those owning them and we only have an interest in the work-related platforms. That means platforms, where paid work is offered and demanded. International examples of this new phenomenon...

Optically-controlled platforms for transfection and single- and sub-cellular surgery

DEFF Research Database (Denmark)

Villangca, Mark Jayson; Casey, Duncan; Glückstad, Jesper

2015-01-01

and specificity of optical trapping in conjunction with other modalities to perform single and sub-cellular surgery. These tools form highly tuneable platforms for the delivery or removal of material from cells of interest, but can simultaneously excite fluorescent probes for imaging purposes or plasmonic...... structures for very local heating. We discuss both the history and recent applications of the field, highlighting the key findings and developments over the last 40 years of biophotonics research....

A high performance scientific cloud computing environment for materials simulations

OpenAIRE

Jorissen, Kevin; Vila, Fernando D.; Rehr, John J.

2011-01-01

We describe the development of a scientific cloud computing (SCC) platform that offers high performance computation capability. The platform consists of a scientific virtual machine prototype containing a UNIX operating system and several materials science codes, together with essential interface tools (an SCC toolset) that offers functionality comparable to local compute clusters. In particular, our SCC toolset provides automatic creation of virtual clusters for parallel computing, including...

Software Development Process Improvement in Datacom Platform

OpenAIRE

Trabelsi, Walid

2008-01-01

Masteroppgave i Informasjons- og Kommunikasjonsteknologi 2008, Universitetet i Agder, Grimstad Ericsson Mobile Platform (EMP) is responsible of the development of a software platform and also to some extend responsible for related hardware parts. EMP is developing the data communication parts of the platform which is used by EMP customers. The platform development is done in large development programs and each program span over a quite a long time period. However, as we see eve...

Wireless sensor platform

Science.gov (United States)

Joshi, Pooran C.; Killough, Stephen M.; Kuruganti, Phani Teja

2017-08-08

A wireless sensor platform and methods of manufacture are provided. The platform involves providing a plurality of wireless sensors, where each of the sensors is fabricated on flexible substrates using printing techniques and low temperature curing. Each of the sensors can include planar sensor elements and planar antennas defined using the printing and curing. Further, each of the sensors can include a communications system configured to encode the data from the sensors into a spread spectrum code sequence that is transmitted to a central computer(s) for use in monitoring an area associated with the sensors.

Windows Azure Platform

CERN Document Server

Redkar, Tejaswi

2010-01-01

The Azure Services Platform is a brand-new cloud-computing technology from Microsoft. It is composed of four core components-Windows Azure, .NET Services, SQL Services, and Live Services-each with a unique role in the functioning of your cloud service. It is the goal of this book to show you how to use these components, both separately and together, to build flawless cloud services. At its heart Windows Azure Platform is a down-to-earth, code-centric book. This book aims to show you precisely how the components are employed and to demonstrate the techniques and best practices you need to know

Resealable, optically accessible, PDMS-free fluidic platform for ex vivo interrogation of pancreatic islets.

Science.gov (United States)

Lenguito, Giovanni; Chaimov, Deborah; Weitz, Jonathan R; Rodriguez-Diaz, Rayner; Rawal, Siddarth A K; Tamayo-Garcia, Alejandro; Caicedo, Alejandro; Stabler, Cherie L; Buchwald, Peter; Agarwal, Ashutosh

2017-02-28

We report the design and fabrication of a robust fluidic platform built out of inert plastic materials and micromachined features that promote optimized convective fluid transport. The platform is tested for perfusion interrogation of rodent and human pancreatic islets, dynamic secretion of hormones, concomitant live-cell imaging, and optogenetic stimulation of genetically engineered islets. A coupled quantitative fluid dynamics computational model of glucose stimulated insulin secretion and fluid dynamics was first utilized to design device geometries that are optimal for complete perfusion of three-dimensional islets, effective collection of secreted insulin, and minimization of system volumes and associated delays. Fluidic devices were then fabricated through rapid prototyping techniques, such as micromilling and laser engraving, as two interlocking parts from materials that are non-absorbent and inert. Finally, the assembly was tested for performance using both rodent and human islets with multiple assays conducted in parallel, such as dynamic perfusion, staining and optogenetics on standard microscopes, as well as for integration with commercial perfusion machines. The optimized design of convective fluid flows, use of bio-inert and non-absorbent materials, reversible assembly, manual access for loading and unloading of islets, and straightforward integration with commercial imaging and fluid handling systems proved to be critical for perfusion assay, and particularly suited for time-resolved optogenetics studies.

Demand Heterogeneity and the Adoption of Platform Complements

NARCIS (Netherlands)

G.J. Rietveld (Joost); J.P. Eggers

2016-01-01

textabstractThis paper offers a demand-based theory of how platform maturity affects the adoption of platform complements. We argue that differences between early and late adopters of the platform include willingness to pay for the platform-and-complement bundle, risk preferences, preference for

Crystal growth and computational materials science

International Nuclear Information System (INIS)

Jayakumar, S.; Ravindran, P.; Arun Kumar, R.; Sudarshan, C.

2012-01-01

The proceedings of the international conference on advanced materials discusses the advances being made in the area of single crystals, their preparation and device development from these crystals and details of the progress that is taking place in the computational field relating to materials science. Computational materials science makes use of advanced simulation tools and computer interfaces to develop a virtual platform which can provide a model for real-time experiments. This book includes selected papers in topics of crystal growth and computational materials science. We are confident that the new concepts and results presented will stimulate and enhance progress of research on crystal growth and computational materials science. Papers relevant to INIS are indexed separately

Platform development of x-ray absorption-based temperature measurements above 100-eV on the OMEGA laser

Science.gov (United States)

Workman, Jonathan; Keiter, P.; Tierney, T.; Tierney, H.; Belle, K.; Magelssen, G.; Peterson, R.; Fryer, C.; Comley, A.; Taylor, M.

2007-11-01

Experiments were performed on the OMEGA laser system at the University of Rochester to measure radiation temperature in hohlraum-heated foams. Using x-ray absorption spectroscopy in the 3-6-keV x-ray range allows temperature determination in the range of 50-200-eV. Uranium, bismuth and gold M-shell x-ray emission were used as broadband backlighters. Backlighter absorption through heated chlorinated foam and scandium tracers were used to determine temperatures. The development of this technique in the temperature range of 100-200-eV will be used for platform development of future NIF experiments. We will present time-integrated and time-resolved measurements of x-ray emission from the backlighter materials as well as absorption measurements trough the heated tracer materials. We will also present future directions in the development of this platform.

Enabling IoT ecosystems through platform interoperability

OpenAIRE

Bröring, Arne; Schmid, Stefan; Schindhelm, Corina-Kim; Khelil, Abdelmajid; Kabisch, Sebastian; Kramer, Denis; Le Phuoc, Danh; Mitic, Jelena; Anicic, Darko; Teniente López, Ernest

2017-01-01

Today, the Internet of Things (IoT) comprises vertically oriented platforms for things. Developers who want to use them need to negotiate access individually and adapt to the platform-specific API and information models. Having to perform these actions for each platform often outweighs the possible gains from adapting applications to multiple platforms. This fragmentation of the IoT and the missing interoperability result in high entry barriers for developers and prevent the emergence of broa...

Propagation law of impact elastic wave based on specific materials

Directory of Open Access Journals (Sweden)

Chunmin CHEN

2017-02-01

Full Text Available In order to explore the propagation law of the impact elastic wave on the platform, the experimental platform is built by using the specific isotropic materials and anisotropic materials. The glass cloth epoxy laminated plate is used for anisotropic material, and an organic glass plate is used for isotropic material. The PVDF sensors adhered on the specific materials are utilized to collect data, and the elastic wave propagation law of different thick plates and laminated plates under impact conditions is analyzed. The Experimental results show that in anisotropic material, transverse wave propagation speed along the fiber arrangement direction is the fastest, while longitudinal wave propagation speed is the slowest. The longitudinal wave propagation speed in anisotropic laminates is much slower than that in the laminated thick plates. In the test channel arranged along a particular angle away from the central region of the material, transverse wave propagation speed is larger. Based on the experimental results, this paper proposes a material combination mode which is advantageous to elastic wave propagation and diffusion in shock-isolating materials. It is proposed to design a composite material with high acoustic velocity by adding regularly arranged fibrous materials. The overall design of the barrier material is a layered structure and a certain number of 90°zigzag structure.

Demand forecasting and information platform in tourism

Directory of Open Access Journals (Sweden)

Li Yue

2017-05-01

Full Text Available Information asymmetry and the bullwhip effect have been serious problems in the tourism supply chain. Based on platform theory, this paper established a mathematical model to explore the inner mechanism of a platform’s influence on stakeholders’ ability to forecast demand in tourism. Results showed that the variance of stakeholders’ demand predictions with a platform was smaller than the variance without a platform, which meant that a platform would improve predictions of demand for stakeholders. The higher information-processing ability of the platform also had other effects on demand forecasting. Research on the inner logic of the platform’s influence on stakeholders has important theoretical and realistic value. This area is worthy of further study.

A STRATEGY FOR DEVELOPING NEW TREATMENT PARADIGMS FOR NEUROPSYCHIATRIC AND NEUROCOGNITIVE SYMPTOMS IN ALZHEIMER’S DISEASE

Directory of Open Access Journals (Sweden)

Hugo eGeerts

2013-04-01

Full Text Available Successful disease-modifying drug development for Alzheimer’s disease has hit a roadblock with the recent failures of amyloid-based therapies, highlighting the translational disconnect between preclinical animal models and clinical outcome. Although disease-modifying therapies are the Holy Grail to pursue, symptomatic therapies addressing cognitive and neuropsychiatric aspects of the disease are also extremely important for the quality of life of patients and caregivers. Despite the fact that neuropsychiatric problems in Alzheimer patients are the major driver for costs associated with institutionalization, no good preclinical animal models with predictive validity have been documented. We propose a combination of quantitative systems pharmacology (QSP, phenotypic screening and preclinical animal models as a novel strategy for addressing the bottleneck in both cognitive and neuropsychiatric drug discovery and development for Alzheimer’s disease. Preclinical animal models such as transgene rats documenting changes in neurotransmitters with tau and amyloid pathology will provide key information that together with human imaging, pathology and clinical data will inform the virtual patient model. In this way QSP modeling can partially overcome the translational disconnect and reduce the attrition of drug programs in the clinical setting. This approach is different from target driven drug discovery as it aims to restore emergent properties of the networks and therefore likely will identify multitarget drugs. We review examples on how this hybrid humanized QSP approach has been helpful in predicting clinical outcomes in schizophrenia treatment and cognitive impairment in Alzheimer’s disease and expand on how this strategy could be applied to neuropsychiatric symptoms in dementia. We believe such an innovative approach when used carefully could change the R&D paradigm for symptomatic treatment in Alzheimer’s disease.

1D Nano materials 2012

International Nuclear Information System (INIS)

Yanqiu Zhu, Y.; Ma, R.; Whitby, R.; Acquah, S.

2013-01-01

We witnessed an initial hyped period and enthusiasm on carbon nano tubes in the 1990s later went through a significant expansion into nano tubes of other materials (metal di chalcogenides, boron nitride, etc.) as well as various nano wires and nano rods. While much of the hype might have gone, the research on one-dimensional (1D) nano materials has matured as one of the most active research areas within the nano science and nano technology community, flourishing with ample, exciting, and new research opportunities. Just like any other research frontier, researchers working in the 1D nano materials field are constantly striving to develop new fundamental science as well as potential applications. It remains a common belief that versatility and tunability of 1D nano materials would challenge many new rising tasks coming from our resource and energy demanding modern society. The traditional semiconductor industry has produced so many devices and systems from transistors, sensors, lasers, and LEDs to more sophisticated solar panels, which are now part of our daily lives. By down sizing the core components or parts to 1D form, one might wonder how fundamentally the dimensionality and morphology would impact the device performance, this is, as always, requiring us to fully understand the structure-property relationship in 1D nano materials. It may be equally crucial in connecting discovery-driven fundamental science to market-driven technology industry concerning potentially relevant findings derived from these novel materials. The importance of a platform that allows active researchers in this field to present their new development in a timely and efficient manner is therefore self-evident. Following the success of two early special issues devoted to 1D nano materials, this is the third one in a row organized by the same group of guest editors, attesting that such a platform has been well received by the readers

The VISPA Internet Platform for Students

Science.gov (United States)

Asseldonk, D. v.; Erdmann, M.; Fischer, R.; Glaser, C.; Müller, G.; Quast, T.; Rieger, M.; Urban, M.

2016-04-01

The VISPA internet platform enables users to remotely run Python scripts and view resulting plots or inspect their output data. With a standard web browser as the only user requirement on the client-side, the system becomes suitable for blended learning approaches for university physics students. VISPA was used in two consecutive years each by approx. 100 third year physics students at the RWTH Aachen University for their homework assignments. For example, in one exercise students gained a deeper understanding of Einsteins mass-energy relation by analyzing experimental data of electron-positron pairs revealing J / Ψ and Z particles. Because the students were free to choose their working hours, only few users accessed the platform simultaneously. The positive feedback from students and the stability of the platform lead to further development of the concept. This year, students accessed the platform in parallel while they analyzed the data recorded by demonstrated experiments live in the lecture hall. The platform is based on experience in the development of professional analysis tools. It combines core technologies from previous projects: an object-oriented C++ library, a modular data-driven analysis flow, and visual analysis steering. We present the platform and discuss its benefits in the context of teaching based on surveys that are conducted each semester.

Towards a Market Entry Framework for Digital Payment Platforms

DEFF Research Database (Denmark)

Kazan, Erol; Damsgaard, Jan

2016-01-01

This study presents a framework to understand and explain the design and configuration of digital payment platforms and how these platforms create conditions for market entries. By embracing the theoretical lens of platform envelopment, we employed a multiple and comparative-case study...... in a European setting by using our framework as an analytical lens to assess market-entry conditions. We found that digital payment platforms have acquired market entry capabilities, which is achieved through strategic platform design (i.e., platform development and service distribution) and technology design...... (i.e., issuing evolutionary and revolutionary payment instruments). The studied cases reveal that digital platforms leverage payment services as a mean to bridge and converge core and adjacent platform markets. In so doing, platform envelopment strengthens firms’ market position in their respective...

Launching platforms for user-generated content

OpenAIRE

Batista, Guilherme Luís Caroço

2015-01-01

Field lab: Entrepreneurial and innovative ventures This paper intends to discuss and absorb the Best Practices employed by successful User- Generated Content (UGC)1 platforms and constitute a guide on how to launch a platform without having a cyclical lack of content and users. Research shows that companies have resorted to integration with mature UGC platforms, and providing content by themselves, in an initial state. I conclude that integration possibilities should be explore...

Integrated Spintronic Platforms for Biomolecular Recognition Detection

Science.gov (United States)

Martins, V. C.; Cardoso, F. A.; Loureiro, J.; Mercier, M.; Germano, J.; Cardoso, S.; Ferreira, R.; Fonseca, L. P.; Sousa, L.; Piedade, M. S.; Freitas, P. P.

2008-06-01

This paper covers recent developments in magnetoresistive based biochip platforms fabricated at INESC-MN, and their application to the detection and quantification of pathogenic waterborn microorganisms in water samples for human consumption. Such platforms are intended to give response to the increasing concern related to microbial contaminated water sources. The presented results concern the development of biological active DNA chips and protein chips and the demonstration of the detection capability of the present platforms. Two platforms are described, one including spintronic sensors only (spin-valve based or magnetic tunnel junction based), and the other, a fully scalable platform where each probe site consists of a MTJ in series with a thin film diode (TFD). Two microfluidic systems are described, for cell separation and concentration, and finally, the read out and control integrated electronics are described, allowing the realization of bioassays with a portable point of care unit. The present platforms already allow the detection of complementary biomolecular target recognition with 1 pM concentration.

Impact of platform switching on inter-proximal bone levels around 8.5 mm implants in the posterior region; 5-year results from a randomized clinical trial

NARCIS (Netherlands)

Telleman, Gerdien; Raghoebar, Gerry M.; Vissink, Arjan; Meijer, Henny J. A.

Aim: To assess the medium- term results of 8.5 mm implants supplied with a conventional platform- matched implant- abutment connection or a platform- switched design. Materials and Methods: Eighty patients with one or more missing teeth in the maxillary or mandibular posterior zone were randomly

Microneedle Platforms for Cell Analysis

KAUST Repository

Kavaldzhiev, Mincho

2017-11-01

Micro-needle platforms are the core components of many recent drug delivery and gene-editing techniques, which allow for intracellular access, controlled cell membrane stress or mechanical trapping of the nucleus. This dissertation work is devoted to the development of micro-needle platforms that offer customized fabrication and new capabilities for enhanced cell analyses. The highest degree of geometrical flexibility is achieved with 3D printed micro-needles, which enable optimizing the topographical stress environment for cells and cell populations of any size. A fabrication process for 3D-printed micro-needles has been developed as well as a metal coating technique based on standard sputter deposition. This extends the functionalities of the platforms by electrical as well as magnetic features. The micro-needles have been tested on human colon cancer cells (HCT116), showing a high degree of biocompatibility of the platform. Moreover, the capabilities of the 3D-printed micro-needles have been explored for drug delivery via the well-established electroporation technique, by coating the micro-needles with gold. Antibodies and fluorescent dyes have been delivered to HCT116 cells and human embryonic kidney cells with a very high transfection rate up to 90%. In addition, the 3D-printed electroporation platform enables delivery of molecules to suspended cells or adherent cells, with or without electroporation buffer solution, and at ultra-low voltages of 2V. In order to provide a micro-needle platform that exploits existing methods for mass fabrication a custom designed template-based process has been developed. It has been used for the production of gold, iron, nickel and poly-pyrrole micro-needles on silicon and glass substrates. A novel delivery method is introduced that activates the micro-needles by electromagnetic induction, which enables to wirelessly gain intracellular access. The method has been successfully tested on HCT116 cells in culture, where a time

Blu-Ray-based micromechanical characterization platform for biopolymer degradation assessment

DEFF Research Database (Denmark)

Casci Ceccacci, Andrea; Chen, Ching-Hsiu; Hwu, En-Te

2017-01-01

Degradable biopolymers are used as carrier materials in drug delivery devices. A complete understanding of their degradation behaviour is thus crucial in the design of new delivery systems. Here we combine a reliable method, based on spray coated micromechanical resonators and a disposable...... microfluidic chip, to characterize biopolymer degradation under the action of enzymes in controlled flow condition. The sensing platform is based on the mechanics and optics from a Blu-Ray player, which automatically localize individual sensors within the array, and sequentially measure and record...

High-efficiency solar cells physics, materials, and devices

CERN Document Server

Wang, Xiaodong

2013-01-01

This book creates a platform for knowledge sharing and dissemination of research on making current photovoltaic technology cheaper, creating advanced technologies based on new architectural designs, and developing new materials to serve as light absorbers.

Disentangling Competition Among Platform Driven Strategic Groups

DEFF Research Database (Denmark)

Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.

2018-01-01

for the mobile payment market in the United Kingdom as our empirical setting. By conceptualizing digital platforms as layered modular architectures and embracing the theoretical lens of strategic groups, this study supplements prior research by deriving a taxonomy of platform profiles that is grounded...... delivery architecture. The preceding attributes of value creation architecture and value delivery architecture aided us in identifying six profiles associated with mobile payment platforms, which in turn led us to advance three competitive strategies that could be pursued by digital platforms in network...

Platform computing

CERN Multimedia

2002-01-01

"Platform Computing releases first grid-enabled workload management solution for IBM eServer Intel and UNIX high performance computing clusters. This Out-of-the-box solution maximizes the performance and capability of applications on IBM HPC clusters" (1/2 page) .

Moldless PEGDA-Based Optoelectrofluidic Platform for Microparticle Selection

Directory of Open Access Journals (Sweden)

Shih-Mo Yang

2011-01-01

Full Text Available This paper reports on an optoelectrofluidic platform which consists of the organic photoconductive material, titanium oxide phthalocyanine (TiOPc, and the photocrosslinkable polymer, poly (ethylene glycol diacrylate (PEGDA. TiOPc simplifies the fabrication process of the optoelectronic chip due to requiring only a single spin-coating step. PEGDA is applied to embed the moldless PEGDA-based microchannel between the top ITO glass and the bottom TiOPc substrate. A real-time control interface via a touch panel screen is utilized to select the target 15 μm polystyrene particles. When the microparticles flow to an illuminating light bar, which is oblique to the microfluidic flow path, the lateral driving force diverts the microparticles. Two light patterns, the switching oblique light bar and the optoelectronic ladder phenomenon, are designed to demonstrate the features. This work integrating the new material design, TiOPc and PEGDA, and the ability of mobile microparticle manipulation demonstrates the potential of optoelectronic approach.

Paper Skin Multisensory Platform for Simultaneous Environmental Monitoring

KAUST Repository

Nassar, Joanna M.

2016-02-19

Human skin and hair can simultaneously feel pressure, temperature, humidity, strain, and flow—great inspirations for applications such as artificial skins for burn and acid victims, robotics, and vehicular technology. Previous efforts in this direction use sophisticated materials or processes. Chemically functionalized, inkjet printed or vacuum-technology-processed papers albeit cheap have shown limited functionalities. Thus, performance and/or functionalities per cost have been limited. Here, a scalable “garage” fabrication approach is shown using off-the-shelf inexpensive household elements such as aluminum foil, scotch tapes, sticky-notes, napkins, and sponges to build “paper skin” with simultaneous real-time sensing capability of pressure, temperature, humidity, proximity, pH, and flow. Enabling the basic principles of porosity, adsorption, and dimensions of these materials, a fully functioning distributed sensor network platform is reported, which, for the first time, can sense the vitals of its carrier (body temperature, blood pressure, heart rate, and skin hydration) and the surrounding environment.

Analysis of offshore platforms lifting with fixed pile structure type (fixed platform) based on ASD89

Science.gov (United States)

Sugianto, Agus; Indriani, Andi Marini

2017-11-01

Platform construction GTS (Gathering Testing Sattelite) is offshore construction platform with fix pile structure type/fixed platform functioning to support the mining of petroleum exploitation. After construction fabrication process platform was moved to barges, then shipped to the installation site. Moving process is generally done by pull or push based on construction design determined when planning. But at the time of lifting equipment/cranes available in the work area then the moving process can be done by lifting so that moving activity can be implemented more quickly of work. This analysis moving process of GTS platform in a different way that is generally done to GTS platform types by lifting using problem is construction reinforcement required, so the construction can be moved by lifting with analyzing and checking structure working stress that occurs due to construction moving process by lifting AISC code standard and analysis using the SAP2000 structure analysis program. The analysis result showed that existing condition cannot be moved by lifting because stress ratio is above maximum allowable value that is 0.950 (AISC-ASD89). Overstress occurs on the member 295 and 324 with stress ratio value 0.97 and 0.95 so that it is required structural reinforcement. Box plate aplication at both members so that it produces stress ratio values 0.78 at the member 295 and stress ratio of 0.77 at the member 324. These results indicate that the construction have qualified structural reinforcement for being moved by lifting.

21 CFR 890.3940 - Wheelchair platform scale.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Wheelchair platform scale. 890.3940 Section 890.3940 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... platform scale. (a) Identification. A wheelchair platform scale is a device with a base designed to...

Assessments of high-consequence platforms: Issues and applications

International Nuclear Information System (INIS)

Digre, K.A.; Craig, M.J.K.

1994-01-01

An API task group has developed a process for the assessment of existing platforms to determine their fitness for purpose. This has been released as a draft supplement to API RP 2A-WSD, 20th edition. Details and the background of this work are described in a companion paper. The assessment of a platform's fitness for purpose involves firstly a definition of the platform's exposure; and secondly, an evaluation of the platform's predicted performance relative to the assessment criteria associated with that exposure. This paper deals with platforms in the high exposure category. That is, platforms whose potential failure consequences, in terms of potential life loss and environmental damage, are significant. The criteria for placement of a platform in a high exposure category are explained, as are the performance criteria demanded of these high exposure platforms. In the companion paper, the metocean assessment process and associated API-developed acceptance criteria are highlighted. This paper addresses primarily ice and seismic loading assessments and associated API-developed criteria, which are based on over thirty years of successful offshore operation and field experience, as well as extrapolation of land-based performance criteria. Three West Coast, USA production platforms are used for illustration

Magnetic hydroxyapatite: a promising multifunctional platform for nanomedicine application

Science.gov (United States)

Mondal, Sudip; Manivasagan, Panchanathan; Bharathiraja, Subramaniyan; Santha Moorthy, Madhappan; Kim, Hye Hyun; Seo, Hansu; Lee, Kang Dae; Oh, Junghwan

2017-01-01

In this review, specific attention is paid to the development of nanostructured magnetic hydroxyapatite (MHAp) and its potential application in controlled drug/gene delivery, tissue engineering, magnetic hyperthermia treatment, and the development of contrast agents for magnetic resonance imaging. Both magnetite and hydroxyapatite materials have excellent prospects in nanomedicine with multifunctional therapeutic approaches. To date, many research articles have focused on biomedical applications of nanomaterials because of which it is very difficult to focus on any particular type of nanomaterial. This study is possibly the first effort to emphasize on the comprehensive assessment of MHAp nanostructures for biomedical applications supported with very recent experimental studies. From basic concepts to the real-life applications, the relevant characteristics of magnetic biomaterials are patented which are briefly discussed. The potential therapeutic and diagnostic ability of MHAp-nanostructured materials make them an ideal platform for future nanomedicine. We hope that this advanced review will provide a better understanding of MHAp and its important features to utilize it as a promising material for multifunctional biomedical applications. PMID:29200851

Magnetic hydroxyapatite: a promising multifunctional platform for nanomedicine application.

Science.gov (United States)

Mondal, Sudip; Manivasagan, Panchanathan; Bharathiraja, Subramaniyan; Santha Moorthy, Madhappan; Kim, Hye Hyun; Seo, Hansu; Lee, Kang Dae; Oh, Junghwan

2017-01-01

In this review, specific attention is paid to the development of nanostructured magnetic hydroxyapatite (MHAp) and its potential application in controlled drug/gene delivery, tissue engineering, magnetic hyperthermia treatment, and the development of contrast agents for magnetic resonance imaging. Both magnetite and hydroxyapatite materials have excellent prospects in nanomedicine with multifunctional therapeutic approaches. To date, many research articles have focused on biomedical applications of nanomaterials because of which it is very difficult to focus on any particular type of nanomaterial. This study is possibly the first effort to emphasize on the comprehensive assessment of MHAp nanostructures for biomedical applications supported with very recent experimental studies. From basic concepts to the real-life applications, the relevant characteristics of magnetic biomaterials are patented which are briefly discussed. The potential therapeutic and diagnostic ability of MHAp-nanostructured materials make them an ideal platform for future nanomedicine. We hope that this advanced review will provide a better understanding of MHAp and its important features to utilize it as a promising material for multifunctional biomedical applications.

Experience using EPICS on PC platforms

International Nuclear Information System (INIS)

Hill, J.O.; Kasemire, K.U.

1997-03-01

The Experimental Physics and Industrial Control System (EPICS) has been widely adopted in the accelerator community. Although EPICS is available on many platforms, the majority of implementations have used UNIX workstations as clients, and VME- or VXI-based processors for distributed input output controllers. Recently, a significant portion of EPICS has been ported to personal computer (PC) hardware platforms running Microsoft's operating systems, and also Wind River System's real time vxWorks operating system. This development should significantly reduce the cost of deploying EPICS systems, and the prospect of using EPICS together with the many high quality commercial components available for PC platforms is also encouraging. A hybrid system using both PC and traditional platforms is currently being implemented at LANL for LEDA, the low energy demonstration accelerator under construction as part of the Accelerator Production of Tritium (APT) project. To illustrate these developments the authors compare their recent experience deploying a PC-based EPICS system with experience deploying similar systems based on traditional (UNIX-hosted) EPICS hardware and software platforms

A scalable FPGA-based digitizing platform for radiation data acquisition

International Nuclear Information System (INIS)

Schiffer, Randolph T.; Flaska, Marek; Pozzi, Sara A.; Carney, Sean; Wentzloff, David D.

2011-01-01

Regulating the proliferation of nuclear materials has become an important issue in our society. In order to detect the radiation given off by nuclear materials, systems implementing detectors connected to data processing modules have been developed. We have implemented a scalable, portable detection platform with a data processing module about the size of an external DVD drive. The data processing component of our system utilizes real-time data handling and has the potential for growth and behavior modifications through custom FPGA code editing. The size of our system is dynamic, so additional input channels can be implemented if necessary. This paper presents a scalable, portable detection system capable of transmitting streaming data from its inputs to a PC or laptop. The system also performs tail/total integral pulse shape discrimination (PSD) in real time on the FPGA to filter the data and selectively transmit pulses to a PC. The data arrives at the inputs of the data capturing module, is processed in real time by the onboard FPGA and is then transferred to a PC or laptop via a PCIe cord in discrete packets. The maximum transfer rate from the FPGA to the PC is 2000 MB/s. The Detection for Nuclear Non-Proliferation Group at University of Michigan will use the detection platform to achieve pre-processing of radiation data in real time. Such pre-processing includes PSD, pulse height distributions and particle times of arrival.

Incorporating Speech Synthesis in the Development of a Mobile Platform for E-learning

DEFF Research Database (Denmark)

Roux, Justus; Scholtz, Pieter; Klop, Daleen

2010-01-01

training component, particularly focusing on an African language, isiXhosa. The high penetration rate of mobile phones within the African continent has created new opportunities for delivering various kinds of information, including e-learning material to communities that have not had appropriate......This presentation and accompanying demonstration focuses on the development of a mobile platform for e-learning purposes with enhanced text-to-speech capabilities. It reports on an international consortium project entitled Mobile E-learning for Africa (MELFA), which includes a reading and literacy...... infrastructures. Aspects of the mobile platform development are described paying attention to basic functionalities of the user interface, as well as to the underlying web technologies involved. Some of the main features of the literacy training module are described, such as grapheme-sound, correspondence...

Genesis and Evolution of Digital Payment Platforms

DEFF Research Database (Denmark)

Hjelholt, Morten; Damsgaard, Jan

2012-01-01

Payment transactions through the use of physical coins, bank notes or credit cards have for centuries been the standard formats of exchanging money. Recently online and mobile digital payment platforms has entered the stage as contenders to this position and possibly could penetrate societies...... thoroughly and substitute current payment standards in the decades to come. This paper portrays how digital payment paltforms evolve in socio-technical niches and how various technological platforms aim for institutional attention in their attempt to challenge earlier platforms and standards. The paper...... applies a co-evolutionary multilevel perspective to model the interplay and processes between technology and society wherein digital payment platforms potentially will substitute other payment platforms just like the credit card negated the check. On this basis this paper formulate a multilevel conceptual...

Rapid Development of Bespoke Unmanned Platforms for Atmospheric Science

Science.gov (United States)

Sobester, A.; Johnston, S. J.; Scanlan, J. P.; Hart, E. E.; O'Brien, N. S.

2012-04-01

The effective deployment of airborne atmospheric science instruments often hinges on the development cycle time of a suitable platform, one that is capable of delivering them to the desired altitude range for a specified amount of time, along a pre-determined trajectory. This could be driven by the need to respond rapidly to sudden, unexpected events (e.g., volcano eruptions, nuclear fallout, etc.) or simply to accommodate the iterative design and flight test cycle of the instrument developer. A shorter development cycle time would also afford us the ability to quickly adapt the hardware and control logic in response to unexpected results during an experimental campaign. We report on recent developments aimed at meeting this demand. As part of the Atmospheric Science Through Robotic Aircraft (ASTRA) initiative we have investigated the use of rapid prototyping technologies to this end, both on the 'airframe' of the platform itself and on the on-board systems. We show how fast multi-disciplinary design optimization techniques, coupled with computer-controlled additive manufacturing (3D printing) and laser cutting methods and electronic prototyping (using standard, modular, programmable building blocks) can lead to the delivery of a fully customized platform integrating a given instrument in a timescale of the order of ten days. Specific examples include the design and testing of a balloon-launched glider sensorcraft and a stratospheric balloon system. The 'vehicle' for the latter was built on a 3D printer using a copolymer thermoplastic material and fitted with a sacrificial protective 'cage' laser-cut from an open-cell foam. The data logging, tracking, sensor integration and communications services of the platform were constructed using the .net Gadgeteer open source hardware kit. The flight planning and eventual post-flight recovery of the system is enabled by a generic, stochastic trajectory simulation tool, also developed as part of the ASTRA initiative. This

A low cost, high precision extreme/harsh cold environment, autonomous sensor data gathering and transmission platform.

Science.gov (United States)

Chetty, S.; Field, L. A.

2014-12-01

SWIMS III, is a low cost, autonomous sensor data gathering platform developed specifically for extreme/harsh cold environments. Arctic ocean's continuing decrease of summer-time ice is related to rapidly diminishing multi-year ice due to the effects of climate change. Ice911 Research aims to develop environmentally inert materials that when deployed will increase the albedo, enabling the formation and/preservation of multi-year ice. SWIMS III's sophisticated autonomous sensors are designed to measure the albedo, weather, water temperature and other environmental parameters. This platform uses low cost, high accuracy/precision sensors, extreme environment command and data handling computer system using satellite and terrestrial wireless solution. The system also incorporates tilt sensors and sonar based ice thickness sensors. The system is light weight and can be deployed by hand by a single person. This presentation covers the technical, and design challenges in developing and deploying these platforms.

Computing platforms for software-defined radio

CERN Document Server

Nurmi, Jari; Isoaho, Jouni; Garzia, Fabio

2017-01-01

This book addresses Software-Defined Radio (SDR) baseband processing from the computer architecture point of view, providing a detailed exploration of different computing platforms by classifying different approaches, highlighting the common features related to SDR requirements and by showing pros and cons of the proposed solutions. Coverage includes architectures exploiting parallelism by extending single-processor environment (such as VLIW, SIMD, TTA approaches), multi-core platforms distributing the computation to either a homogeneous array or a set of specialized heterogeneous processors, and architectures exploiting fine-grained, coarse-grained, or hybrid reconfigurability. Describes a computer engineering approach to SDR baseband processing hardware; Discusses implementation of numerous compute-intensive signal processing algorithms on single and multicore platforms; Enables deep understanding of optimization techniques related to power and energy consumption of multicore platforms using several basic a...

Structured academic discussions through an online education-specific platform to improve Pharm.D. students learning outcomes.

Science.gov (United States)

Kolluru, Srikanth; Varughese, James T

To facilitate active academic discussions using an online, education-centered platform and reinforce concepts, in order to improve overall course outcomes. A third year integrated pharmacotherapy course was enrolled on an online searchable platform, Piazza®, to facilitate academic discussions. Students could ask, answer, and explore content, and build on submitted answers in wiki style in collaboration. Instructor posted learning objectives, endorsed student responses with correct answers and led follow-up discussions. Review sessions were conducted on this platform before all major exams. A student t-test was used to compare class performance with those of previous years. In a post-activity qualitative survey, most students appreciated the less stressful, online interaction with peers and faculty. For 15 medicinal chemistry course hours, there were 83 posts on Piazza® with 303 total contributions, 107 student responses, and 546min of group discussion time. 94% of questions received student responses and 89% of those were endorsed by the instructor. Students enjoyed pre-exam discussions, organization of the page, and reinforcing material on complex learning objectives. This discussion forum fostered personal exploration of content by the students, which led to better performance on examinations. Involving the use of an online, education-centered platform for student discussions was an effective means of increasing class engagement with the course material. Student performance on exams was significantly improved in both cohorts that utilized active learning compared to the cohort without active learning (p=0.001 and p= 0.002 respectively). Piazza® can be utilized for any course and across disciplines. Copyright © 2017 Elsevier Inc. All rights reserved.

Pre-polishing on a CNC platform with bound abrasive contour tools

Science.gov (United States)

Schoeffer, Adrienne E.

2003-05-01

Deterministic micorgrinding (DMG) of optical glasses and ceramics is the commercial manufacturing process of choice to shape glass surfaces prior to final finishing. This process employs rigid bound matrix diamond tooling resulting in surface roughness values of 3-51.tm peak to valley and 100-400nm rms, as well as mid-spatial frequency tool marks that require subsequent removal in secondary finishing steps. The ability to pre-polish optical surfaces within the grinding platform would reduce final finishing process times. Bound abrasive contour wheels containing cerium oxide, alumina or zirconia abrasives were constructed with an epoxy matrix. The effects of abrasive type, composition, and erosion promoters were examined for tool hardness (Shore D), and tested with commercial optical glasses in an OptiproTM CNC grinding platform. Metrology protocols were developed to examine tool wear and subsequent surface roughness. Work is directed to demonstrating effective material removal, improved surface roughness and cutter mark removal.

Advances in the development of the Mexican platform for analysis and design of nuclear reactors: AZTLAN Platform

International Nuclear Information System (INIS)

Gomez T, A. M.; Puente E, F.; Del Valle G, E.; Francois L, J. L.; Espinosa P, G.

2017-09-01

The AZTLAN platform project: development of a Mexican platform for the analysis and design of nuclear reactors, financed by the SENER-CONACYT Energy Sustain ability Fund, was approved in early 2014 and formally began at the end of that year. It is a national project led by the Instituto Nacional de Investigaciones Nucleares (ININ) and with the collaboration of Instituto Politecnico Nacional (IPN), the Universidad Autonoma Metropolitana (UAM) and Universidad Nacional Autonoma de Mexico (UNAM) as part of the development team and with the participation of the Laguna Verde Nuclear Power Plant, the National Commission of Nuclear Safety and Safeguards, the Ministry of Energy and the Karlsruhe Institute of Technology (Kit, Germany) as part of the user group. The general objective of the project is to modernize, improve and integrate the neutronic, thermo-hydraulic and thermo-mechanical codes, developed in Mexican institutions, in an integrated platform, developed and maintained by Mexican experts for the benefit of Mexican institutions. Two years into the process, important steps have been taken that have consolidated the platform. The main results of these first two years have been presented in different national and international forums. In this congress, some of the most recent results that have been implemented in the platform codes are shown in more detail. The current status of the platform from a more executive view point is summarized in this paper. (Author)

A survey on platforms for big data analytics.

Science.gov (United States)

Singh, Dilpreet; Reddy, Chandan K

The primary purpose of this paper is to provide an in-depth analysis of different platforms available for performing big data analytics. This paper surveys different hardware platforms available for big data analytics and assesses the advantages and drawbacks of each of these platforms based on various metrics such as scalability, data I/O rate, fault tolerance, real-time processing, data size supported and iterative task support. In addition to the hardware, a detailed description of the software frameworks used within each of these platforms is also discussed along with their strengths and drawbacks. Some of the critical characteristics described here can potentially aid the readers in making an informed decision about the right choice of platforms depending on their computational needs. Using a star ratings table, a rigorous qualitative comparison between different platforms is also discussed for each of the six characteristics that are critical for the algorithms of big data analytics. In order to provide more insights into the effectiveness of each of the platform in the context of big data analytics, specific implementation level details of the widely used k-means clustering algorithm on various platforms are also described in the form pseudocode.

Reverse engineering of the robot base platform

International Nuclear Information System (INIS)

Anwar A Rahman; Azizul Rahman A Aziz; Mohd Arif Hamzah; Muhd Nor Atan; Fadil Ismail; Rosli Darmawan

2009-01-01

The robot base platform used to place the robotic arm version 2 was imported through a local company. The robot base platform is used as a reference for reverse egineering development for a smaller size robot. The paper will discuss the reverse engineering design process and parameters involved in the development of the robot base platform. (Author)

Using decommissioned offshore oil/gas platforms for nuclear/RO desalination: the ONDP (Offshore Nuclear Desalination Platform)

International Nuclear Information System (INIS)

Nagar, Ankesh

2010-01-01

Oil platforms are manmade concrete and steel giant structures standing high on ocean floor weighing anywhere between 10,000 tonnes and 150,000 tonnes or more and designed to withstand cruel forces of nature, having an average life of 70 years. With the declining petrol reserves within next 30 years, hundreds of platforms will be scheduled for decommissioning. This issue is a hot topic as oil companies tussle with environmentalists and state lawmakers over the future. The cash strapped oil companies have a legal obligation to remove each rig entirely, returning the ocean floor to its original condition. Lean times in oil industry mean a tight cash flow. Safely removing massive structures from deep waters and shipping the pile to the shores for reuse and recycling presents a technological challenge for operators. Some conceptual applications investigated to reuse them are the conversion of offshore structures into fish farms, prisons, military outposts, hotels, for Search and Rescue operations or Centers for Waste Processing and Disposal. Decommissioning oil and gas installation is exorbitantly expensive. On an average, removing a complete platform with or without pipeline in sea waters with 'clean sea approach' costs $15 million to $ 6 billion depending on location. Global warming has adversely affected world climate. Water levels in ground and reservoirs have shown drastic decrement. In future there will be need for more and more water all over the world. Fossil fuel energy based desalination is expensive and not eco-friendly so is dismantling of oil platform with its pipeline. The oil platforms are far located from population, have sufficient tank capacity and pipeline structure to store and pump water to shore. When found economically unviable these mammoth structures with modifications can be installed with 02 or more small or medium sized nuclear reactors such as KLT 40S with required module to desalinate water and co generate electricity which can be sent to

'Good' platform-political reasons for 'bad' platform-data. Zur sozio-technischen Geschichte der Plattformaktivitäten Fav, Retweet und Like

NARCIS (Netherlands)

Paßmann, J.; Gerlitz, C.

2014-01-01

In this article, we explore the relation between platform activities and their usage practices. Taking departure from predefined activities offered by social media platforms, this paper inquires into what may happen if platform features cater to opposing user practices. The paper investigates

VOLTTRON Lite: Integration Platform for the Transactional Network

Energy Technology Data Exchange (ETDEWEB)

Haack, Jereme N.; Katipamula, Srinivas; Akyol, Bora A.; Lutes, Robert G.

2013-10-31

In FY13, Pacific Northwest National Laboratory (PNNL) with funding from the Department of Energy’s (DOE’s) Building Technologies Office (BTO) designed, prototyped and tested a transactional network platform. The platform is intended to support energy, operational and financial transactions between any networked entities (equipment, organizations, buildings, grid, etc.). Initially, in FY13, the concept demonstrated transactions between packaged rooftop units (RTUs) and the electric grid using applications or “agents” that reside on the platform, on the equipment, on local building controller or in the Cloud. This document describes the core of the transactional network platform, the Volttron Lite™ software and associated services hosted on the platform. Future enhancements are also discussed. The appendix of the document provides examples of how to use the various services hosted on the platform.

Business and IT Capabilities for Cloud Platform Success

DEFF Research Database (Denmark)

Hahn, Christopher; Huntgeburth, Jan; Winkler, Till J.

2016-01-01

The growing proliferation of cloud platform ecosystems demands a deeper understanding of the capabilities that help existing and emerging platform providers to be successful by creating and appropriating value. This multiple case study of four cloud platform providers (three large, one SME......) instantiates Rai and Tang’s (2014) framework of dyadic IT and network IT capabilities for a cloud platform context and extends it by exploring previously undertheorized cloud platform business capabilities. We further build on this extended framework by employing a configurational perspective to elucidate...... the complementary role of the three proposed business capabilities (incentives and rules, ecosystem marketing and sales, partner development and support) for relevant value creation and appropriation mechanisms. In addition to providing a capability framework catered to the cloud platform context, our findings...

Baking Gender Into Social Media Design: How Platforms Shape Categories for Users and Advertisers

Directory of Open Access Journals (Sweden)

Rena Bivens

2016-10-01

Full Text Available In recent years, several popular social media platforms have launched freeform custom gender fields. This decision reconstitutes gender categories beyond an oppressive binary only permitting “males” and “females.” In this work, we uncover many different user-facing gender category design strategies within the social media ecosystem, ranging from custom gender options (on Facebook, Google+, and Pinterest to the absence of gender fields entirely (on Twitter and LinkedIn. To explore how gender is baked into platform design, this article investigates the 10 most popular English-speaking social media platforms by performing recorded walkthroughs from two different subject positions: (1 a new user registering an account, and (2 a new advertiser creating an ad. We explore several different spaces in social media software where designers commonly program gender—sign-up pages, profile pages, and advertising portals—to consider (1 how gender is made durable through social media design, and (2 the shifting composition of the category of gender within the social media ecosystem more broadly. Through this investigation, we question how these categorizations attribute meaning to gender as they materialize in different software spaces, along with the recursive implications for society. Ultimately, our analysis reveals how social media platforms act as intermediaries within the larger ecosystem of advertising and web analytics companies. We argue that this intermediary role entrusts social media platforms with a considerable degree of control over the generation of broader categorization systems, which can be wielded to shape the perceived needs and desires of both users and advertising clients.

Hierarchical DSE for multi-ASIP platforms

DEFF Research Database (Denmark)

Micconi, Laura; Corvino, Rosilde; Gangadharan, Deepak

2013-01-01

This work proposes a hierarchical Design Space Exploration (DSE) for the design of multi-processor platforms targeted to specific applications with strict timing and area constraints. In particular, it considers platforms integrating multiple Application Specific Instruction Set Processors (ASIPs...

A case study for integrated STEM outreach in an urban setting using a do-it-yourself vertical jump measurement platform.

Science.gov (United States)

Drazan, John F; Danielsen, Heather; Vercelletto, Matthew; Loya, Amy; Davis, James; Eglash, Ron

2016-08-01

The purpose of this study was to develop and deploy a low cost vertical jump platform using readily available materials for Science, Technology, Engineering, and Mathematics (STEM) education and outreach in the inner city. The platform was used to measure the jumping ability of participants to introduce students to the collection and analysis of scientific data in an engaging, accessible manner. This system was designed and fabricated by a student team of engineers as part of a socially informed engineering and design class. The vertical jump platform has been utilized in 10 classroom lectures in physics and biology. The system was also used in an after school program in which high school volunteers prepared a basketball based STEM outreach program, and at a community outreach events with over 100 participants. At present, the same group of high school students are now building their own set of vertical jump platform under the mentorship of engineering undergraduates. The construction and usage of the vertical jump platform provides an accessible introduction to the STEM fields within the urban community.

PROBA-V Mission Exploitation Platform

Directory of Open Access Journals (Sweden)

Erwin Goor

2016-07-01

Full Text Available As an extension of the PROBA-Vegetation (PROBA-V user segment, the European Space Agency (ESA, de Vlaamse Instelling voor Technologisch Onderzoek (VITO, and partners TRASYS and Spacebel developed an operational Mission Exploitation Platform (MEP to drastically improve the exploitation of the PROBA-V Earth Observation (EO data archive, the archive from the historical SPOT-VEGETATION mission, and derived products by researchers, service providers, and thematic users. The analysis of the time series of data (petabyte range is addressed, as well as the large scale on-demand processing of the complete archive, including near real-time data. The platform consists of a private cloud environment, a Hadoop-based processing environment and a data manager. Several applications are released to the users, e.g., a full resolution viewing service, a time series viewer, pre-defined on-demand processing chains, and virtual machines with powerful tools and access to the data. After an initial release in January 2016 a research platform was deployed gradually, allowing users to design, debug, and test applications on the platform. From the PROBA-V MEP, access to, e.g., Sentinel-2 and Sentinel-3 data will be addressed as well.

Cloud Based Earth Observation Data Exploitation Platforms

Science.gov (United States)

Romeo, A.; Pinto, S.; Loekken, S.; Marin, A.

2017-12-01

In the last few years data produced daily by several private and public Earth Observation (EO) satellites reached the order of tens of Terabytes, representing for scientists and commercial application developers both a big opportunity for their exploitation and a challenge for their management. New IT technologies, such as Big Data and cloud computing, enable the creation of web-accessible data exploitation platforms, which offer to scientists and application developers the means to access and use EO data in a quick and cost effective way. RHEA Group is particularly active in this sector, supporting the European Space Agency (ESA) in the Exploitation Platforms (EP) initiative, developing technology to build multi cloud platforms for the processing and analysis of Earth Observation data, and collaborating with larger European initiatives such as the European Plate Observing System (EPOS) and the European Open Science Cloud (EOSC). An EP is a virtual workspace, providing a user community with access to (i) large volume of data, (ii) algorithm development and integration environment, (iii) processing software and services (e.g. toolboxes, visualization routines), (iv) computing resources, (v) collaboration tools (e.g. forums, wiki, etc.). When an EP is dedicated to a specific Theme, it becomes a Thematic Exploitation Platform (TEP). Currently, ESA has seven TEPs in a pre-operational phase dedicated to geo-hazards monitoring and prevention, costal zones, forestry areas, hydrology, polar regions, urban areas and food security. On the technology development side, solutions like the multi cloud EO data processing platform provides the technology to integrate ICT resources and EO data from different vendors in a single platform. In particular it offers (i) Multi-cloud data discovery, (ii) Multi-cloud data management and access and (iii) Multi-cloud application deployment. This platform has been demonstrated with the EGI Federated Cloud, Innovation Platform Testbed Poland

Functional inks and printing of two-dimensional materials.

Science.gov (United States)

Hu, Guohua; Kang, Joohoon; Ng, Leonard W T; Zhu, Xiaoxi; Howe, Richard C T; Jones, Christopher G; Hersam, Mark C; Hasan, Tawfique

2018-05-08

Graphene and related two-dimensional materials provide an ideal platform for next generation disruptive technologies and applications. Exploiting these solution-processed two-dimensional materials in printing can accelerate this development by allowing additive patterning on both rigid and conformable substrates for flexible device design and large-scale, high-speed, cost-effective manufacturing. In this review, we summarise the current progress on ink formulation of two-dimensional materials and the printable applications enabled by them. We also present our perspectives on their research and technological future prospects.

Available: motorised platform

CERN Multimedia

The COMPASS collaboration

2014-01-01

The COMPASS collaboration would like to offer to a new owner the following useful and fully operational piece of equipment, which is due to be replaced with better adapted equipment.   Please contact Erwin Bielert (erwin.bielert@cern.ch or 160539) for further information.  Motorized platform (FOR FREE):   Fabricated by ACL (Alfredo Cardoso & Cia Ltd) in Portugal. The model number is MeXs 5-­‐30.  Specifications: 5 m wide, 1 m deep, adjustable height (1.5 m if folded). Maximum working floor height: 4 m. conforms to CERN regulations, number LV158. Type LD500, capacity 500 kg and weight 2000 kg.  If no interested party is found before December 2014, the platform will be thrown away.

Neutron CSI: Integrated platform for non-destructive composition and stress imaging with neutrons

International Nuclear Information System (INIS)

Materna, T.; Pirling, T.

2011-01-01

We propose to build an interdisciplinary platform for non-destructive analysis and imaging with neutrons. The project regroups an instrument already available at ILL (Laue-Langevin Institute), SALSA, with a new one for Neutron Tomography coupled to Prompt-Gamma Neutron Activation (PGNA) as well as partial usage of another proposed instrument, FIPPS. The focus of the proposition is the versatility of high spatial resolution and energy-selective neutron tomography to provide a rapid and precise 3D morphological map of an object as well as indirect information on its 3D elemental and structural composition through the scan of Bragg-edges in transmission. Coupled to PGNA imaging and the strain analysis power of SALSA, the aim of the platform is to answer key questions occurring in geological, metallurgical, engineering and medical fields, material research and cultural heritage. (authors)

Overview and Demonstration of USEPA’s Risk-Informed Materials Management (RIMM) Tool System

Science.gov (United States)

The Risk-Informed Materials Management (RIMM) Tool System is a data gathering and analysis platform for conducting material disposal and beneficial use assessments. Users can evaluate risks to human and ecological receptors associated with exposures to organic and inorganic chemi...

University technology platform of anticipatory learning

Directory of Open Access Journals (Sweden)

Leonid Davidovich Gitelman

2016-03-01

Full Text Available The innovative development sets large-scale and challenging tasks, which need to be addressed in the lack-of-knowledge conditions and require the coordination and integration of numerous expert structures, which are scattered around the world and have different status and competencies. One of the mechanisms of integrating the partners’ intellectual and financial resources is provided by the technology platforms. The article discusses the nature and functions of technology platforms and analyzes the experience of their application in different countries with a special emphasis on universities. The article gives an overview of the various interpretations of technology platform concepts. It also describes the development and implementation of the technological platform at the Ural Federal University (research and education centre ‘ENGEC’, which was targeted at organizing anticipatory learning in the sphere of energy engineering and high-tech industries; its mechanism and role in improving different university activities and processes are shown. This platform is based on the original methodology ‘Integrated System of Consulting, Training, and Transformation’ (ISCT, which includes authentic methods and technologies, which are used in the educational process. A significant advantage of this methodology is that it can be applied in university education as well as in corporate training integrated with innovative activities.

3D printing functional materials and devices (Conference Presentation)

Science.gov (United States)

McAlpine, Michael C.

2017-05-01

The development of methods for interfacing high performance functional devices with biology could impact regenerative medicine, smart prosthetics, and human-machine interfaces. Indeed, the ability to three-dimensionally interweave biological and functional materials could enable the creation of devices possessing unique geometries, properties, and functionalities. Yet, most high quality functional materials are two dimensional, hard and brittle, and require high crystallization temperatures for maximal performance. These properties render the corresponding devices incompatible with biology, which is three-dimensional, soft, stretchable, and temperature sensitive. We overcome these dichotomies by: 1) using 3D printing and scanning for customized, interwoven, anatomically accurate device architectures; 2) employing nanotechnology as an enabling route for overcoming mechanical discrepancies while retaining high performance; and 3) 3D printing a range of soft and nanoscale materials to enable the integration of a diverse palette of high quality functional nanomaterials with biology. 3D printing is a multi-scale platform, allowing for the incorporation of functional nanoscale inks, the printing of microscale features, and ultimately the creation of macroscale devices. This three-dimensional blending of functional materials and `living' platforms may enable next-generation 3D printed devices.

Implementation of Online Veterinary Hospital on Cloud Platform.

Science.gov (United States)

Chen, Tzer-Shyong; Chen, Tzer-Long; Chung, Yu-Fang; Huang, Yao-Min; Chen, Tao-Chieh; Wang, Huihui; Wei, Wei

2016-06-01

Pet markets involve in great commercial possibilities, which boost thriving development of veterinary hospital businesses. The service tends to intensive competition and diversified channel environment. Information technology is integrated for developing the veterinary hospital cloud service platform. The platform contains not only pet medical services but veterinary hospital management and services. In the study, QR Code andcloud technology are applied to establish the veterinary hospital cloud service platform for pet search by labeling a pet's identification with QR Code. This technology can break the restriction on veterinary hospital inspection in different areas and allows veterinary hospitals receiving the medical records and information through the exclusive QR Code for more effective inspection. As an interactive platform, the veterinary hospital cloud service platform allows pet owners gaining the knowledge of pet diseases and healthcare. Moreover, pet owners can enquire and communicate with veterinarians through the platform. Also, veterinary hospitals can periodically send reminders of relevant points and introduce exclusive marketing information with the platform for promoting the service items and establishing individualized marketing. Consequently, veterinary hospitals can increase the profits by information share and create the best solution in such a competitive veterinary market with industry alliance.

Nanodiamonds as platforms for biology and medicine.

Science.gov (United States)

Man, Han B; Ho, Dean

2013-02-01

Nanoparticles possess a wide range of exceptional properties applicable to biology and medicine. In particular, nanodiamonds (NDs) are being studied extensively because they possess unique characteristics that make them suitable as platforms for diagnostics and therapeutics. This carbon-based material (2-8 nm) is medically relevant because it unites several key properties necessary for clinical applications, such as stability and compatibility in biological environments, and scalability in production. Research by the Ho group and others has yielded ND particles with a variety of capabilities ranging from delivery of chemotherapeutic drugs to targeted labeling and uptake studies. In addition, encouraging new findings have demonstrated the ability for NDs to effectively treat chemoresistant tumors in vivo. In this review, we highlight the progress made toward bringing nanodiamonds from the bench to the bedside.

The development of an open platform to test ITS solutions

DEFF Research Database (Denmark)

Lahrmann, Harry; Agerholm, Niels; Juhl, Jens

2013-01-01

This paper presents the ITS Platform Northern Denmark, which is an open platform to test ITS solutions. The platform consists of a new developed GNSS/GPRS On Board Unit installed in nearly 500 cars, a backend server and a specially designed digital road map for ITS applications. The platform is o...... is open for third part application. This paper presents the platform’s potentials and explains a series of test applications, which are developed on the plat- form. Moreover, a number of new projects, which are planned for ITS Platform is introduced.......This paper presents the ITS Platform Northern Denmark, which is an open platform to test ITS solutions. The platform consists of a new developed GNSS/GPRS On Board Unit installed in nearly 500 cars, a backend server and a specially designed digital road map for ITS applications. The platform...

High Metal Removal Rate Process for Machining Difficult Materials

Energy Technology Data Exchange (ETDEWEB)

Bates, Robert; McConnell, Elizabeth

2016-06-29

Machining methods across many industries generally require multiple operations to machine and process advanced materials, features with micron precision, and complex shapes. The resulting multiple machining platforms can significantly affect manufacturing cycle time and the precision of the final parts, with a resultant increase in cost and energy consumption. Ultrafast lasers represent a transformative and disruptive technology that removes material with micron precision and in a single step manufacturing process. Such precision results from athermal ablation without modification or damage to the remaining material which is the key differentiator between ultrafast laser technologies and traditional laser technologies or mechanical processes. Athermal ablation without modification or damage to the material eliminates post-processing or multiple manufacturing steps. Combined with the appropriate technology to control the motion of the work piece, ultrafast lasers are excellent candidates to provide breakthrough machining capability for difficult-to-machine materials. At the project onset in early 2012, the project team recognized that substantial effort was necessary to improve the application of ultrafast laser and precise motion control technologies (for micromachining difficult-to-machine materials) to further the aggregate throughput and yield improvements over conventional machining methods. The project described in this report advanced these leading-edge technologies thru the development and verification of two platforms: a hybrid enhanced laser chassis and a multi-application testbed.

Electron Acceptor Materials Engineering in Colloidal Quantum Dot Solar Cells

KAUST Repository

Liu, Huan; Tang, Jiang; Kramer, Illan J.; Debnath, Ratan; Koleilat, Ghada I.; Wang, Xihua; Fisher, Armin; Li, Rui; Brzozowski, Lukasz; Levina, Larissa; Sargent, Edward H.

2011-01-01

-ion-doped sol-gel-derived titanium dioxide electrodes produce a tunable-bandedge, well-passivated materials platform for CQD solar cell optimization. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Droplet microfluidic platform for cell electrofusion

NARCIS (Netherlands)

Schoeman, R.M.

2015-01-01

In this thesis a lab on a chip platform is described which is capable of electrofusing cells in a picoliter droplet. The platform consist out of glass part containing recessed platinum electrodes plasma bonded to a PDMS slab containing microchannels. First the two cell populations are introduced

Snap: an integrated SNP annotation platform

DEFF Research Database (Denmark)

Li, Shengting; Ma, Lijia; Li, Heng

2007-01-01

Snap (Single Nucleotide Polymorphism Annotation Platform) is a server designed to comprehensively analyze single genes and relationships between genes basing on SNPs in the human genome. The aim of the platform is to facilitate the study of SNP finding and analysis within the framework of medical...

A software platform to develop and execute kitting tasks on industrial cyber-physical systems

DEFF Research Database (Denmark)

Rovida, Francesco

2017-01-01

The current material handling infrastructure associated with manufacturing and assembly operations still register a great presence of human work for highly repetitive tasks. A major contributing factor for the low automation is that current manufacturing robots have little or no understanding of ....... A platform where skills, similarly to computer or smartphone applications, can be installed and removed from heterogeneous robots with few elementary steps....

Cyclic platform dolomites and platform-to-basin transition of Jefferson Formation (Frasnian), southwest Montana and east-central Idaho

Energy Technology Data Exchange (ETDEWEB)

Dorobek, S.L.

1987-08-01

The Jefferson Formation (Frasnian) in southwestern Montana consists of cyclic sequences of shallow marine platformal dolomites that grade westward into slope/basinal facies in east-central Idaho. Regional sedimentologic characteristics of slope facies in Idaho indicate that the Jefferson platform resembled a distally steepened ramp. Slope facies consist of slope laminites with local small scale slumps and slope breccias. Shallow water platform-derived clasts are lacking in the slope breccias. Individual shallowing upward platform cycles are 25 m to < 1 m thick and consists of, in descending order: local solution-collapse breccia caps; cryptalgal dolomudstone; rare ooid dolograinstone; thin-bedded Amphipora dolowackestone; coarsely crystalline dolostones with abundant lenticular to domal stromatoporoids; and basal thin-bedded, fine-grained, shale dolostones with closely spaced hard-grounds that grade upward into burrow-homogenized, irregularly bedded dolostones.

Gas turbine bucket with impingement cooled platform

Science.gov (United States)

Jones, Raphael Durand

2002-01-01

In a turbine bucket having an airfoil portion and a root portion, with a substantially planar platform at an interface between the airfoil portion and root portion, a platform cooling arrangement including at least one bore in the root portion and at least one impingement cooling tube seated in the bore, the tube extending beyond the bore with an outlet in close proximity to a targeted area on an underside of the platform.

Discussion on Application of Space Materials and Technological Innovation in Dynamic Fashion Show

Science.gov (United States)

Huo, Meilin; Kim, Chul Soo; Zhao, Wenhan

2018-03-01

In modern dynamic fashion show, designers often use the latest ideas and technology, and spend their energy in stage effect and overall environment to make audience’s watching a fashion show like an audio-visual feast. With rapid development of China’s science and technology, it has become a design trend to strengthen the relationship between new ideas, new trends and technology in modern art. With emergence of new technology, new methods and new materials, designers for dynamic fashion show stage art can choose the materials with an increasingly large scope. Generation of new technology has also made designers constantly innovate the stage space design means, and made the stage space design innovated constantly on the original basis of experiences. The dynamic clothing display space is on design of clothing display space, layout, platform decoration style, platform models, performing colors, light arrangement, platform background, etc.

Oil and Gas Producing Platforms in the Gulf of Mexico, Geographic NAD83, MMS (1998)[platforms_MMS_1998

Data.gov (United States)

Louisiana Geographic Information Center — This is a point data set for the location of over 4300 MMS administered platform structures used for oil and gas production in the Gulf of Mexico. Groups of platform...

High throughput in vivo protease inhibitor selection platform

DEFF Research Database (Denmark)

2017-01-01

The invention relates to a recombinant microbial cell comprising a selection platform for screening for a protease inhibitor, wherein the platform comprises transgenes encoding a protease having selective peptide bond cleavage activity at a recognition site amino acid sequence; and transgenes...... platform for screening for a protease inhibitor....

Automated inventory and material science scoping calculations under fission and fusion conditions

Directory of Open Access Journals (Sweden)

Mark R. Gilbert

2017-09-01

Full Text Available The FISPACT-II inventory simulation platform is a modern computational tool with advanced and unique capabilities. It is sufficiently flexible and efficient to make it an ideal basis around which to perform extensive simulation studies to scope a variety of responses of many materials (elements to several different neutron irradiation scenarios. This paper briefly presents the typical outputs from these scoping studies, which have been used to compile a suite of nuclear physics materials handbooks, providing a useful and vital resource for material selection and design studies. Several different global responses are extracted from these reports, allowing for comparisons between materials and between different irradiation conditions. A new graphical output format has been developed for the FISPACT-II platform to display these “global summaries”; results for different elements are shown in a periodic table layout, allowing side-by-side comparisons. Several examples of such plots are presented and discussed.

Mesozoic carbonate-siliciclastic platform to basin systems of a South Tethyan margin (Egypt, East Mediterranean)

Science.gov (United States)

Tassy, Aurélie; Crouzy, Emmanuel; Gorini, Christian; Rubino, Jean-Loup

2015-04-01

series (up to 3500 m) as a mixed combination of debris flows, internal preserved blocks, and/or compressively-deformed distal allochthonous masses. Transported material have proceeded from the dismantling of the Mesozoic mixed carbonate-siliciclastic platform. They can spread down slope over areas as large as 70000 of km2. According to stratigraphic correlations with global sea-level positions, platform instability would have been triggered by the gravitational collapse of the carbonate-siliciclastic platform under its own weight after successive subaerial exposures which were able to generate karstification processes. Seismic interpretation is constrained by a detailed assessment of the Egyptian margin paleogeography supported by wells. This margin segment is briefly compared to the outcropping Apulian margin in Italy.

German crowd-investing platforms: Literature review and survey

Directory of Open Access Journals (Sweden)

David Grundy

2016-12-01

Full Text Available This article presents a comprehensive overview of the current German crowd-investing market drawing on a data-set of 31 crowd-investing platforms including the analysis of 265 completed projects. While crowd-investing market still only represents a niche in the German venture capital market, there is potential for an increase in both market volume and in average project investment. The market share is distributed among a few crowd-investing platforms with high entry barriers for new platforms although platforms that specialise in certain sectors have managed to successfully enter the market. German crowd-investing platforms are found to promote mainly internet-based enterprises (36% followed by projects in real estate (24% and green projects (19%, with the median money raised 100,000 euro.

Evaluation of E-learning Platforms: a Case Study

Directory of Open Access Journals (Sweden)

Cristina POP

2012-01-01

Full Text Available In the recent past, a great number of e-learning platforms have been introduced on the market showing different characteristics and services. These platforms can be evaluated using multiple criteria and methods. This paper proposes a list of selected quality criteria for describing, characterizing and selecting e-learning platform. These criteria were designed based on e-learning standards. I also propose a mathematical model to determine the probability that a student uses an e-learning platform based on the factors (criteria that determine the quality of the platform and the socio-demographic variables of the student. The case study presented is an application of the model and the input data, intermediate calculations and final results were processed using SAS (Statistical Analysis Software.

Platforms for Persistent Communications, Surveillance and Reconnaissance

National Research Council Canada - National Science Library

Campbell, William; Vehlow, Chuck; Wartell, Mike; Adler, Allen; Swan, Pete; Wynn, Bob; Beriwaln, Madhu; Collier, Darrell; Gallagher, Herb; Glaser, Gary; Scalera, Steve; Puthoff, Jolene

2008-01-01

...). The Army Science Board investigated capabilities of platforms deployed in space near space and lower altitudes and assessed tradeoffs among benefits weaknesses costs and logistics burdens associated with platform types...

Urban search mobile platform modeling in hindered access conditions

Science.gov (United States)

Barankova, I. I.; Mikhailova, U. V.; Kalugina, O. B.; Barankov, V. V.

2018-05-01

The article explores the control system simulation and the design of the experimental model of the rescue robot mobile platform. The functional interface, a structural functional diagram of the mobile platform control unit, and a functional control scheme for the mobile platform of secure robot were modeled. The task of design a mobile platform for urban searching in hindered access conditions is realized through the use of a mechanical basis with a chassis and crawler drive, a warning device, human heat sensors and a microcontroller based on Arduino platforms.

An Investigation of Digital Payment Platform Designs

DEFF Research Database (Denmark)

Kazan, Erol; Damsgaard, Jan

2014-01-01

This paper focuses on the triumph march of mobile phones that currently are annexing music players, navigation devices, and cameras as separate physical objects. The next target is set on payment. Through synthesizing available literature, we construct a framework for studying digital payment...... platforms that combines platform, technology and business design aspects. The framework is applied to conduct a comparative case study of digital payment platforms. Four types of market actors are considered: banks, mobile network operators, merchants, and startups, which are incumbents and disrupters....... By hosting third-party services, payment instruments are evolving from single-purpose to multi-functional ones. Our research extends existing payment literature from the MSP perspective to emphasize certain digital payment platform components, which impact strategies and complementary products....

Fresh water generators onboard a floating platform

International Nuclear Information System (INIS)

Tewari, P.K.; Verma, R.K.; Misra, B.M.; Sadhulkan, H.K.

1997-01-01

A dependable supply of fresh water is essential for any ocean going vessel. The operating and maintenance personnel on offshore platforms and marine structures also require a constant and regular supply of fresh water to meet their essential daily needs. A seawater thermal desalination unit onboard delivers good quality fresh water from seawater. The desalination units developed by Bhabha Atomic Research Centre (BARC) suitable for ocean going vessels and offshore platforms have been discussed. Design considerations of such units with reference to floating platforms and corrosive environments have been presented. The feasibility of coupling a low temperature vacuum evaporation (LTVE) desalination plant suitable for an onboard floating platform to a PHWR nuclear power plant has also been discussed. (author). 1 ref., 3 figs, 2 tabs

Carbonate platform growth and demise offshore Central Vietnam

DEFF Research Database (Denmark)

Fyhn, Michael B.W.; Boldreel, Lars Ole; Nielsen, Lars H.

2013-01-01

Fault Zone, the Tuy Hoa Carbonate Platform fringes the continental margin between Da Nang and Nha Trang. Here, platform growth initiated during the Early Miocene and continued until Middle Miocene time when regional uplift led to subaerial exposure, termination of platform growth and karstification...... continues on isolated platforms hosting the Paracel Islands farther seawards. The onset of widespread carbonate deposition largely reflects the Early Miocene transgression of the area linked with early post-rift subsidence and the opening of the South China Sea. The mid-Neogene shift in carbonate deposition...

How Export and Import Platforms Drive Industry Upgrading

DEFF Research Database (Denmark)

Ishida, Masami; Machikita, Tomohiro; Ueki, Yasushi

2013-01-01

to extend the geographic scope of their foreign platforms if they run both exporting and importing; (2) firm size and R&D sales ration play a role of foreign platforms in ASEAN, Europe, and the USA, but these have no effects on foreign platforms in east Asia; (3) emerging multinationals do not achieve...

Play a Starring Role in Your Textbook: A Digital Web Platform with an Embedded Role-Playing Game

Science.gov (United States)

Spielvogel, Laura; Spielvogel, Christian

2014-01-01

In this report, we introduce our digital e-textbook web platform with an integrated role-playing game, which has been created for "introduction to anthropology" courses. We believe that textbooks have the potential to do more to motivate students' pursuit of learning if their material (topically organised chapters supported by…

Rigid multipodal platforms for metal surfaces

Directory of Open Access Journals (Sweden)

Michal Valášek

2016-03-01

Full Text Available In this review the recent progress in molecular platforms that form rigid and well-defined contact to a metal surface are discussed. Most of the presented examples have at least three anchoring units in order to control the spatial arrangement of the protruding molecular subunit. Another interesting feature is the lateral orientation of these foot structures which, depending on the particular application, is equally important as the spatial arrangement of the molecules. The numerous approaches towards assembling and organizing functional molecules into specific architectures on metal substrates are reviewed here. Particular attention is paid to variations of both, the core structures and the anchoring groups. Furthermore, the analytical methods enabling the investigation of individual molecules as well as monomolecular layers of ordered platform structures are summarized. The presented multipodal platforms bearing several anchoring groups form considerably more stable molecule–metal contacts than corresponding monopodal analogues and exhibit an enlarged separation of the functional molecules due to the increased footprint, as well as restrict tilting of the functional termini with respect to the metal surface. These platforms are thus ideally suited to tune important properties of the molecule–metal interface. On a single-molecule level, several of these platforms enable the control over the arrangement of the protruding rod-type molecular structures (e.g., molecular wires, switches, rotors, sensors with respect to the surface of the substrate.

A Cross-Platform Tactile Capabilities Interface for Humanoid Robots

Directory of Open Access Journals (Sweden)

Jie eMa

2016-04-01

Full Text Available This article presents the core elements of a cross-platform tactile capabilities interface (TCI for humanoid arms. The aim of the interface is to reduce the cost of developing humanoid robot capabilities by supporting reuse through cross-platform deployment. The article presents a comparative analysis of existing robot middleware frameworks, as well as the technical details of the TCI framework that builds on the the existing YARP platform. The TCI framework currently includes robot arm actuators with robot skin sensors. It presents such hardware in a platform independent manner, making it possible to write robot control software that can be executed on different robots through the TCI frameworks. The TCI framework supports multiple humanoid platforms and this article also presents a case study of a cross-platform implementation of a set of tactile protective withdrawal reflexes that have been realised on both the Nao and iCub humanoid robot platforms using the same high-level source code.

X-ray photoelectron spectroscopy study of pyrolytically coated graphite platforms submitted to simulated electrothermal atomic absorption spectrometry conditions

International Nuclear Information System (INIS)

Ruiz, Frine; Benzo, Zully; Quintal, Manuelita; Garaboto, Angel; Albornoz, Alberto; Brito, Joaquin L.

2006-01-01

The present work is part of an ongoing project aiming to a better understanding of the mechanisms of atomization on graphite furnace platforms used for electrothermal atomic absorption spectrometry (ETAAS). It reports the study of unused pyrolytic graphite coated platforms of commercial origin, as well as platforms thermally or thermo-chemically treated under simulated ETAAS analysis conditions. X-ray photoelectron spectroscopy (XPS) was employed to study the elements present at the surfaces of the platforms. New, unused platforms showed the presence of molybdenum, of unknown origin, in concentrations up to 1 at.%. Species in two different oxidations states (Mo 6+ and Mo 2+ ) were detected by analyzing the Mo 3d spectral region with high resolution XPS. The analysis of the C 1s region demonstrated the presence of several signals, one of these at 283.3 eV related to the presence of Mo carbide. The O 1s region showed also various peaks, including a signal that can be attributed to the presence of MoO 3 . Some carbon and oxygen signals were consistent with the presence of C=O and C-O- (probably C-OH) groups on the platforms surfaces. Upon thermal treatment up to 2900 deg. C, the intensity of the Mo signal decreased, but peaks due to Mo oxides (Mo 6+ and Mo 5+ ) and carbide (Mo 2+ ) were still apparent. Thermo-chemical treatment with 3 vol.% HCl solutions and heating up to 2900 deg. C resulted in further diminution of the Mo signal, with complete disappearance of Mo carbide species. Depth profiling of unused platforms by Ar + ion etching at increasing time periods demonstrated that, upon removal of several layers of carbonaceous material, the Mo signal disappears suggesting that this contamination is present only at the surface of the pyrolytic graphite platform

eTRIKS platform: Conception and operation of a highly scalable cloud-based platform for translational research and applications development.

Science.gov (United States)

Bussery, Justin; Denis, Leslie-Alexandre; Guillon, Benjamin; Liu, Pengfeï; Marchetti, Gino; Rahal, Ghita

2018-04-01

We describe the genesis, design and evolution of a computing platform designed and built to improve the success rate of biomedical translational research. The eTRIKS project platform was developed with the aim of building a platform that can securely host heterogeneous types of data and provide an optimal environment to run tranSMART analytical applications. Many types of data can now be hosted, including multi-OMICS data, preclinical laboratory data and clinical information, including longitudinal data sets. During the last two years, the platform has matured into a robust translational research knowledge management system that is able to host other data mining applications and support the development of new analytical tools. Copyright © 2018 Elsevier Ltd. All rights reserved.

Influence of the substrate platform on the opto-electronic properties of multi-layer organic light-emitting field-effect transistors

Energy Technology Data Exchange (ETDEWEB)

Generali, Gianluca; Capelli, Raffaella; Toffanin, Stefano; Muccini, Michele [Consiglio Nazionale delle Ricerche (CNR), Istituto per lo Studio dei Materiali Nanostrutturati (ISMN), via P. Gobetti 101, I-40129 Bologna (Italy); Dinelli, Franco, E-mail: g.generali@bo.ismn.cnr.it, E-mail: m.muccini@bo.ismn.cnr.it [Consiglio Nazionale delle Ricerche (CNR), INO U.O.S. ' A. Gozzini' Area della Ricerca di Pisa - S. Cataldo, via Moruzzi 1, I-56124 Pisa (Italy)

2011-06-08

In this paper, we present a study of the effects of the influence of the substrate platform on the properties of a three-layer vertical hetero-junction made of thin films of {alpha}, {omega}-diperfluorohexyl-4T (DHF4T), a blend of tris(8-hydroxyquinoline)aluminium (Alq3) and 4-(dicyanomethylene)-2-methyl-6-(p-dimethylaminostyryl)-4H-pyran (DCM) and {alpha}, {omega}-dihexyl-quaterthiophene (DH4T). The hetero-junction represents the active component of an organic light-emitting transistor (OLET). The substrate platforms investigated in this study are glass/indium-tin-oxide/poly(methyl-methacrylate) (PMMA) and Si{sup ++}/silicon oxide (SiO{sub 2})/PMMA. The first platform is almost completely transparent to light and therefore is very promising for use in OLET applications. The second one has been chosen for comparison as it employs standard microelectronic materials, i.e. Si{sup ++}/SiO{sub 2}. We show how different gate materials and structure can affect the relevant field-effect electrical characteristics, such as the charge mobility and threshold voltage. By means of an atomic force microscopy analysis, a systematic study has been made in order to correlate the morphology of the active layers with the electrical properties of the devices.

Circular Bioassay Platforms for Applications in Microwave-Accelerated Techniques.

Science.gov (United States)

Mohammed, Muzaffer; Clement, Travis C; Aslan, Kadir

2014-12-02

In this paper, we present the design of four different circular bioassay platforms, which are suitable for homogeneous microwave heating, using theoretical calculations (i.e., COMSOL™ multiphysics software). Circular bioassay platforms are constructed from poly(methyl methacrylate) (PMMA) for optical transparency between 400-800 nm, has multiple sample capacity (12, 16, 19 and 21 wells) and modified with silver nanoparticle films (SNFs) to be used in microwave-accelerated bioassays (MABs). In addition, a small monomode microwave cavity, which can be operated with an external microwave generator (100 W), for use with the bioassay platforms in MABs is also developed. Our design parameters for the circular bioassay platforms and monomode microwave cavity during microwave heating were: (i) temperature profiles, (ii) electric field distributions, (iii) location of the circular bioassay platforms inside the microwave cavity, and (iv) design and number of wells on the circular bioassay platforms. We have also carried out additional simulations to assess the use of circular bioassay platforms in a conventional kitchen microwave oven (e.g., 900 W). Our results show that the location of the circular bioassay platforms in the microwave cavity was predicted to have a significant effect on the homogeneous heating of these platforms. The 21-well circular bioassay platform design in our monomode microwave cavity was predicted to offer a homogeneous heating pattern, where inter-well temperature was observed to be in between 23.72-24.13°C and intra-well temperature difference was less than 0.21°C for 60 seconds of microwave heating, which was also verified experimentally.

Applied architecture patterns on the Microsoft platform

CERN Document Server

Dovgal, Andre; Noriskin, Gregor

2014-01-01

Presented in a scenario-driven tutorial way, we lead you through fictitious example problems and present you with the best solutions. This book is intended for architects, developers, and managers who need to improve their knowledge of the Microsoft application platform. This book will appeal to anyone, especially consultants, who want to get up to speed on selecting the most appropriate platform for a particular problem. A good understanding of the general Windows platform and development technologies would be helpful.

Proof-of-Concept Prototyping for Observis Platform

OpenAIRE

Ekimov, Victor

2012-01-01

Observis Oy is a start-up company first appeared in January 2011. The company is building up a measurement platform that is open and easy to connect. It helps measurement device suppliers, system and service providers, and analyzing services to found and combine each other’s products to create more value to the end customers. Observis Oy intends to develop a platform for integration with other services in order to provide management functionality in environmental field of business. Platform i...

Unsupervised detection of salt marsh platforms: a topographic method

Science.gov (United States)

Goodwin, Guillaume C. H.; Mudd, Simon M.; Clubb, Fiona J.

2018-03-01

Salt marshes filter pollutants, protect coastlines against storm surges, and sequester carbon, yet are under threat from sea level rise and anthropogenic modification. The sustained existence of the salt marsh ecosystem depends on the topographic evolution of marsh platforms. Quantifying marsh platform topography is vital for improving the management of these valuable landscapes. The determination of platform boundaries currently relies on supervised classification methods requiring near-infrared data to detect vegetation, or demands labour-intensive field surveys and digitisation. We propose a novel, unsupervised method to reproducibly isolate salt marsh scarps and platforms from a digital elevation model (DEM), referred to as Topographic Identification of Platforms (TIP). Field observations and numerical models show that salt marshes mature into subhorizontal platforms delineated by subvertical scarps. Based on this premise, we identify scarps as lines of local maxima on a slope raster, then fill landmasses from the scarps upward, thus isolating mature marsh platforms. We test the TIP method using lidar-derived DEMs from six salt marshes in England with varying tidal ranges and geometries, for which topographic platforms were manually isolated from tidal flats. Agreement between manual and unsupervised classification exceeds 94 % for DEM resolutions of 1 m, with all but one site maintaining an accuracy superior to 90 % for resolutions up to 3 m. For resolutions of 1 m, platforms detected with the TIP method are comparable in surface area to digitised platforms and have similar elevation distributions. We also find that our method allows for the accurate detection of local block failures as small as 3 times the DEM resolution. Detailed inspection reveals that although tidal creeks were digitised as part of the marsh platform, unsupervised classification categorises them as part of the tidal flat, causing an increase in false negatives and overall platform

Unsupervised detection of salt marsh platforms: a topographic method

Directory of Open Access Journals (Sweden)

G. C. H. Goodwin

2018-03-01

Full Text Available Salt marshes filter pollutants, protect coastlines against storm surges, and sequester carbon, yet are under threat from sea level rise and anthropogenic modification. The sustained existence of the salt marsh ecosystem depends on the topographic evolution of marsh platforms. Quantifying marsh platform topography is vital for improving the management of these valuable landscapes. The determination of platform boundaries currently relies on supervised classification methods requiring near-infrared data to detect vegetation, or demands labour-intensive field surveys and digitisation. We propose a novel, unsupervised method to reproducibly isolate salt marsh scarps and platforms from a digital elevation model (DEM, referred to as Topographic Identification of Platforms (TIP. Field observations and numerical models show that salt marshes mature into subhorizontal platforms delineated by subvertical scarps. Based on this premise, we identify scarps as lines of local maxima on a slope raster, then fill landmasses from the scarps upward, thus isolating mature marsh platforms. We test the TIP method using lidar-derived DEMs from six salt marshes in England with varying tidal ranges and geometries, for which topographic platforms were manually isolated from tidal flats. Agreement between manual and unsupervised classification exceeds 94 % for DEM resolutions of 1 m, with all but one site maintaining an accuracy superior to 90 % for resolutions up to 3 m. For resolutions of 1 m, platforms detected with the TIP method are comparable in surface area to digitised platforms and have similar elevation distributions. We also find that our method allows for the accurate detection of local block failures as small as 3 times the DEM resolution. Detailed inspection reveals that although tidal creeks were digitised as part of the marsh platform, unsupervised classification categorises them as part of the tidal flat, causing an increase in false negatives

Measurement of baseline and orientation between distributed aerospace platforms.

Science.gov (United States)

Wang, Wen-Qin

2013-01-01

Distributed platforms play an important role in aerospace remote sensing, radar navigation, and wireless communication applications. However, besides the requirement of high accurate time and frequency synchronization for coherent signal processing, the baseline between the transmitting platform and receiving platform and the orientation of platform towards each other during data recording must be measured in real time. In this paper, we propose an improved pulsed duplex microwave ranging approach, which allows determining the spatial baseline and orientation between distributed aerospace platforms by the proposed high-precision time-interval estimation method. This approach is novel in the sense that it cancels the effect of oscillator frequency synchronization errors due to separate oscillators that are used in the platforms. Several performance specifications are also discussed. The effectiveness of the approach is verified by simulation results.

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Optical materials; crystal growth; platform technique; X-ray diffraction; surface analysis; frequency doubling. ... However, its practical applications are limited by the insufficient reproducibility of the mentioned propertiescaused by the strong influence of the growth conditions, and, in particular, pH of the solution from which α ...

Combined Cell Culture-Biosensing Platform Using Vertically Aligned Patterned Peptide Nanofibers for Cellular Studies

DEFF Research Database (Denmark)

Taskin, Mehmet B.; Sasso, Luigi; Dimaki, Maria

2013-01-01

it possible to avoid a loss of sensitivity because of the diffusion of the sample. The obtained results showed that the peptide nanofibers were suitable as a cell culturing substrate for PC12 cells. The peptide nanofibers could be employed as an alternative biological material to increase the adherence......This Article presents the development of a combined cell culture–biosensing platform using vertically aligned self-assembled peptide nanofibers. Peptide nanofibers were patterned on a microchip containing gold microelectrodes to provide the cells with a 3D environment enabling them to grow...... and proliferate. Gold microelectrodes were functionalized with conductive polymers for the electrochemical detection of dopamine released from PC12 cells. The combined cell culture–biosensing platform assured a close proximity of the release site, the cells and the active surface of the sensor, thereby rendering...

The JANNUS Saclay facility: A new platform for materials irradiation, implantation and ion beam analysis

Energy Technology Data Exchange (ETDEWEB)

Pellegrino, S., E-mail: stephanie.pellegrino@cea.fr [CEA, INSTN, UEPTN, Laboratoire JANNUS, F-91191 Gif-sur-Yvette (France); Trocellier, P.; Miro, S.; Serruys, Y.; Bordas, E.; Martin, H. [CEA, DEN, Service de Recherches de Metallurgie Physique, Laboratoire JANNUS, F-91191 Gif-sur-Yvette (France); Chaabane, N.; Vaubaillon, S. [CEA, INSTN, UEPTN, Laboratoire JANNUS, F-91191 Gif-sur-Yvette (France); Gallien, J.P.; Beck, L. [CEA, DEN, Service de Recherches de Metallurgie Physique, Laboratoire JANNUS, F-91191 Gif-sur-Yvette (France)

2012-02-15

The third accelerator of the multi-ion irradiation platform JANNUS (Joint Accelerators for Nanosciences and NUclear Simulation), a 6SDH-2 Pelletron from National Electrostatic Corporation, Middleton was installed at Saclay in October 2009. The first triple beam irradiation combining Fe, He and H ion beams has been performed in March 2010. In the first part of this paper, we give a technical description of the triple beam facility, its performances and experimental capabilities. Typically, damage dose up to 100 dpa can be reached in 10 h irradiation with heavy ion beams, with or without simultaneous bombardment by protons, helium-4 ions or any other heavy ion beam. In the second part of this paper, we illustrate some IBA results obtained after irradiation and implantation experiments.

Avogadro: an advanced semantic chemical editor, visualization, and analysis platform.

Science.gov (United States)

Hanwell, Marcus D; Curtis, Donald E; Lonie, David C; Vandermeersch, Tim; Zurek, Eva; Hutchison, Geoffrey R

2012-08-13

The Avogadro project has developed an advanced molecule editor and visualizer designed for cross-platform use in computational chemistry, molecular modeling, bioinformatics, materials science, and related areas. It offers flexible, high quality rendering, and a powerful plugin architecture. Typical uses include building molecular structures, formatting input files, and analyzing output of a wide variety of computational chemistry packages. By using the CML file format as its native document type, Avogadro seeks to enhance the semantic accessibility of chemical data types. The work presented here details the Avogadro library, which is a framework providing a code library and application programming interface (API) with three-dimensional visualization capabilities; and has direct applications to research and education in the fields of chemistry, physics, materials science, and biology. The Avogadro application provides a rich graphical interface using dynamically loaded plugins through the library itself. The application and library can each be extended by implementing a plugin module in C++ or Python to explore different visualization techniques, build/manipulate molecular structures, and interact with other programs. We describe some example extensions, one which uses a genetic algorithm to find stable crystal structures, and one which interfaces with the PackMol program to create packed, solvated structures for molecular dynamics simulations. The 1.0 release series of Avogadro is the main focus of the results discussed here. Avogadro offers a semantic chemical builder and platform for visualization and analysis. For users, it offers an easy-to-use builder, integrated support for downloading from common databases such as PubChem and the Protein Data Bank, extracting chemical data from a wide variety of formats, including computational chemistry output, and native, semantic support for the CML file format. For developers, it can be easily extended via a powerful

Avogadro: an advanced semantic chemical editor, visualization, and analysis platform

Directory of Open Access Journals (Sweden)

Hanwell Marcus D

2012-08-01

Full Text Available Abstract Background The Avogadro project has developed an advanced molecule editor and visualizer designed for cross-platform use in computational chemistry, molecular modeling, bioinformatics, materials science, and related areas. It offers flexible, high quality rendering, and a powerful plugin architecture. Typical uses include building molecular structures, formatting input files, and analyzing output of a wide variety of computational chemistry packages. By using the CML file format as its native document type, Avogadro seeks to enhance the semantic accessibility of chemical data types. Results The work presented here details the Avogadro library, which is a framework providing a code library and application programming interface (API with three-dimensional visualization capabilities; and has direct applications to research and education in the fields of chemistry, physics, materials science, and biology. The Avogadro application provides a rich graphical interface using dynamically loaded plugins through the library itself. The application and library can each be extended by implementing a plugin module in C++ or Python to explore different visualization techniques, build/manipulate molecular structures, and interact with other programs. We describe some example extensions, one which uses a genetic algorithm to find stable crystal structures, and one which interfaces with the PackMol program to create packed, solvated structures for molecular dynamics simulations. The 1.0 release series of Avogadro is the main focus of the results discussed here. Conclusions Avogadro offers a semantic chemical builder and platform for visualization and analysis. For users, it offers an easy-to-use builder, integrated support for downloading from common databases such as PubChem and the Protein Data Bank, extracting chemical data from a wide variety of formats, including computational chemistry output, and native, semantic support for the CML file format

Benchmarking computer platforms for lattice QCD applications

International Nuclear Information System (INIS)

Hasenbusch, M.; Jansen, K.; Pleiter, D.; Stueben, H.; Wegner, P.; Wettig, T.; Wittig, H.

2004-01-01

We define a benchmark suite for lattice QCD and report on benchmark results from several computer platforms. The platforms considered are apeNEXT, CRAY T3E; Hitachi SR8000, IBM p690, PC-Clusters, and QCDOC

The Creative Platform

DEFF Research Database (Denmark)

Byrge, Christian; Hansen, Søren

whether you consider thirdgrade teaching, human-resource development, or radical new thinking in product development in a company. The Creative Platform was developed at Aalborg University through a series of research-and-development activities in collaboration with educational institutions and private...

The Construction of Platform Imperialism in the Globalization Era

Directory of Open Access Journals (Sweden)

Dal Yong Jin

2013-01-01

Full Text Available In the early 21st century, platforms, known as digital media intermediaries, have greatly influenced people’s daily lives. Due to the importance of platforms for the digital economy and culture, including intellectual property and participatory culture, several countries have developed their own social network sites and Web portals. Nonetheless, a handful of Western countries, primarily the U.S., have dominated the global platform market and society. This paper aims to historicize the concept of imperialism in the globalized 21st century. It investigates whether the recent growth of American-based platforms has resulted in a change to the fundamental idea of the imperialism thesis by analyzing the evolutionary nature of imperialism towards platform imperialism. It then addresses whether we are experiencing a new notion of imperialism by mapping out several core characteristics that define platform imperialism, including the swift growth and global dominance of SNSs and smartphones. It pays close attention to the capitalization of platforms and their global expansion, including the major role of intellectual property rights as the most significant form of capital accumulation in the digital age. It eventually endeavors to make a contribution to the platform imperialism discourse as a form of new imperialism, focusing on the nexus of great powers.

Embedded Linux platform for data acquisition systems

International Nuclear Information System (INIS)

Patel, Jigneshkumar J.; Reddy, Nagaraj; Kumari, Praveena; Rajpal, Rachana; Pujara, Harshad; Jha, R.; Kalappurakkal, Praveen

2014-01-01

Highlights: • The design and the development of data acquisition system on FPGA based reconfigurable hardware platform. • Embedded Linux configuration and compilation for FPGA based systems. • Hardware logic IP core and its Linux device driver development for the external peripheral to interface it with the FPGA based system. - Abstract: This scalable hardware–software system is designed and developed to explore the emerging open standards for data acquisition requirement of Tokamak experiments. To address the future need for a scalable data acquisition and control system for fusion experiments, we have explored the capability of software platform using Open Source Embedded Linux Operating System on a programmable hardware platform such as FPGA. The idea was to identify the platform which can be customizable, flexible and scalable to support the data acquisition system requirements. To do this, we have selected FPGA based reconfigurable and scalable hardware platform to design the system with Embedded Linux based operating system for flexibility in software development and Gigabit Ethernet interface for high speed data transactions. The proposed hardware–software platform using FPGA and Embedded Linux OS offers a single chip solution with processor, peripherals such ADC interface controller, Gigabit Ethernet controller, memory controller amongst other peripherals. The Embedded Linux platform for data acquisition is implemented and tested on a Virtex-5 FXT FPGA ML507 which has PowerPC 440 (PPC440) [2] hard block on FPGA. For this work, we have used the Linux Kernel version 2.6.34 with BSP support for the ML507 platform. It is downloaded from the Xilinx [1] GIT server. Cross-compiler tool chain is created using the Buildroot scripts. The Linux Kernel and Root File System are configured and compiled using the cross-tools to support the hardware platform. The Analog to Digital Converter (ADC) IO module is designed and interfaced with the ML507 through Xilinx

Embedded Linux platform for data acquisition systems

Energy Technology Data Exchange (ETDEWEB)

Patel, Jigneshkumar J., E-mail: jjp@ipr.res.in [Institute for Plasma Research, Gandhinagar, Gujarat (India); Reddy, Nagaraj, E-mail: nagaraj.reddy@coreel.com [Sandeepani School of Embedded System Design, Bangalore, Karnataka (India); Kumari, Praveena, E-mail: praveena@ipr.res.in [Institute for Plasma Research, Gandhinagar, Gujarat (India); Rajpal, Rachana, E-mail: rachana@ipr.res.in [Institute for Plasma Research, Gandhinagar, Gujarat (India); Pujara, Harshad, E-mail: pujara@ipr.res.in [Institute for Plasma Research, Gandhinagar, Gujarat (India); Jha, R., E-mail: rjha@ipr.res.in [Institute for Plasma Research, Gandhinagar, Gujarat (India); Kalappurakkal, Praveen, E-mail: praveen.k@coreel.com [Sandeepani School of Embedded System Design, Bangalore, Karnataka (India)

2014-05-15

Highlights: • The design and the development of data acquisition system on FPGA based reconfigurable hardware platform. • Embedded Linux configuration and compilation for FPGA based systems. • Hardware logic IP core and its Linux device driver development for the external peripheral to interface it with the FPGA based system. - Abstract: This scalable hardware–software system is designed and developed to explore the emerging open standards for data acquisition requirement of Tokamak experiments. To address the future need for a scalable data acquisition and control system for fusion experiments, we have explored the capability of software platform using Open Source Embedded Linux Operating System on a programmable hardware platform such as FPGA. The idea was to identify the platform which can be customizable, flexible and scalable to support the data acquisition system requirements. To do this, we have selected FPGA based reconfigurable and scalable hardware platform to design the system with Embedded Linux based operating system for flexibility in software development and Gigabit Ethernet interface for high speed data transactions. The proposed hardware–software platform using FPGA and Embedded Linux OS offers a single chip solution with processor, peripherals such ADC interface controller, Gigabit Ethernet controller, memory controller amongst other peripherals. The Embedded Linux platform for data acquisition is implemented and tested on a Virtex-5 FXT FPGA ML507 which has PowerPC 440 (PPC440) [2] hard block on FPGA. For this work, we have used the Linux Kernel version 2.6.34 with BSP support for the ML507 platform. It is downloaded from the Xilinx [1] GIT server. Cross-compiler tool chain is created using the Buildroot scripts. The Linux Kernel and Root File System are configured and compiled using the cross-tools to support the hardware platform. The Analog to Digital Converter (ADC) IO module is designed and interfaced with the ML507 through Xilinx

Bioma platform advancements during 2017

OpenAIRE

FUMAGALLI DAVIDE; NIEMEYER STEFAN

2017-01-01

In this report we describe the advancements on the Bioma Framework developed during year 2017. Given that the Bioma platform is quite mature, its core was not recently changed. So that the majority of changes concerns the implementation of the models developed in the platform. Moreover, during 2017 we also set up an alternative version of the framework itself, based on a new developing framework called .NET Core, with the purpose of being able to create a version of Bioma runnable on Linux. ...

Stargate-based Acoustic Sensor Platform

OpenAIRE

Hanbiao Wang; Kung Yao; Deborah Estrin

2004-01-01

To facilitate the study of the wireless sensor network for demanding acoustic monitoring of long distance sources, we recently have also started working on the development of a new generation of wireless acoustic sensor network platform using the Stargate nodes. The 400 MHz PXA-255 XScale processor and the 64 MB SDRAM provide the Stargate platform a decent processing capability. The VX Pocket 440 sound card with four external microphones are attached to each Stargate node through the PCMCIA s...

Methodology for development of risk indicators for offshore platforms

International Nuclear Information System (INIS)

Oeien, K.; Sklet, S.

1999-01-01

This paper presents a generic methodology for development of risk indicators for petroleum installations and a specific set of risk indicators established for one offshore platform. The risk indicators should be used to control the risk during operation of platforms. The methodology is purely risk-based and the basis for development of risk indicators is the platform specific quantitative risk analysis (QRA). In order to identify high risk contributing factors, platform personnel are asked to assess whether and how much the risk influencing factors will change. A brief comparison of probabilistic safety assessment (PSA) for nuclear power plants and quantitative risk analysis (QRA) for petroleum platforms is also given. (au)

Benchmarking computer platforms for lattice QCD applications

International Nuclear Information System (INIS)

Hasenbusch, M.; Jansen, K.; Pleiter, D.; Wegner, P.; Wettig, T.

2003-09-01

We define a benchmark suite for lattice QCD and report on benchmark results from several computer platforms. The platforms considered are apeNEXT, CRAY T3E, Hitachi SR8000, IBM p690, PC-Clusters, and QCDOC. (orig.)

Software development on the SAP HANA platform

CERN Document Server

Walker, Mark

2013-01-01

Software Development on the SAP HANA Platform is a general tutorial guide to SAP HANA.This book is written for beginners to the SAP HANA platform. No knowledge of SAP HANA is necessary to start using this book.

Catalyst-Free Vapor-Phase Method for Direct Integration of Gas Sensing Nanostructures with Polymeric Transducing Platforms

Directory of Open Access Journals (Sweden)

Stella Vallejos

2014-01-01

Full Text Available Tungsten oxide nanoneedles (NNs are grown and integrated directly with polymeric transducing platforms for gas sensors via aerosol-assisted chemical vapor deposition (AACVD method. Material analysis shows the feasibility to grow highly crystalline nanomaterials in the form of NNs with aspect ratios between 80 and 200 and with high concentration of oxygen vacancies at the surface, whereas gas testing demonstrates moderate sensing responses to hydrogen at concentrations between 10 ppm and 50 ppm, which are comparable with results for tungsten oxide NNs grown on silicon transducing platforms. This method is demonstrated to be an attractive route to fabricate next generation of gas sensors devices, provided with flexibility and functionality, with great potential in a cost effective production for large-scale applications.

Complementors as Connectors: Open Innovation in Digital Product Platforms

NARCIS (Netherlands)

Hilbolling, Susan; Berends, Hans; Deken, F.; Tuertscher, Philipp

2018-01-01

Through open, standardized interfaces, autonomous third parties can develop complementary products and services for digital product platforms, but, at the same time, these third parties also establish connections that span multiple platforms - beyond the control of the platform owner. This paper

Reconfigurable, Intelligently-Adaptive, Communication System, an SDR Platform

Science.gov (United States)

Roche, Rigoberto J.; Shalkhauser, Mary Jo; Hickey, Joseph P.; Briones, Janette C.

2016-01-01

The Space Telecommunications Radio System (STRS) provides a common, consistent framework to abstract the application software from the radio platform hardware. STRS aims to reduce the cost and risk of using complex, configurable and reprogrammable radio systems across NASA missions. The NASA Glenn Research Center (GRC) team made a software defined radio (SDR) platform STRS compliant by adding an STRS operating environment and a field programmable gate array (FPGA) wrapper, capable of implementing each of the platforms interfaces, as well as a test waveform to exercise those interfaces. This effort serves to provide a framework toward waveform development onto an STRS compliant platform to support future space communication systems for advanced exploration missions. The use of validated STRS compliant applications provides tested code with extensive documentation to potentially reduce risk, cost and e ort in development of space-deployable SDRs. This paper discusses the advantages of STRS, the integration of STRS onto a Reconfigurable, Intelligently-Adaptive, Communication System (RIACS) SDR platform, and the test waveform and wrapper development e orts. The paper emphasizes the infusion of the STRS Architecture onto the RIACS platform for potential use in next generation flight system SDRs for advanced exploration missions.

Secure smart embedded devices, platforms and applications

CERN Document Server

Markantonakis, Konstantinos

2013-01-01

New generations of IT users are increasingly abstracted from the underlying devices and platforms that provide and safeguard their services. As a result they may have little awareness that they are critically dependent on the embedded security devices that are becoming pervasive in daily modern life. Secure Smart Embedded Devices, Platforms and Applications provides a broad overview of the many security and practical issues of embedded devices, tokens, and their operation systems, platforms and main applications. It also addresses a diverse range of industry/government initiatives and consider

Research and application of mobile teaching platform

Science.gov (United States)

Yang, Ping; Xue, Hongjiao

2017-08-01

The application of mobile technology in university digital campus is ripe. This article mainly introduced the necessity of teaching platform based on mobile Internet in the teaching of higher vocational education, and the key to the construction of the feasibility of mobile learning platform, which is a feasible and effective teaching model under the new situation, worthy of promotion. The design and application of teaching platform based on mobile Internet is the change of educational ideas and working methods, and is the new starting point of Higher Vocational education.

Competitive Positioning of Complementors on Digital Platforms

DEFF Research Database (Denmark)

Wessel, Michael; Thies, Ferdinand; Benlian, Alexander

2017-01-01

markets. With increasing numbers of products and services offered via the platforms, signals such as popularity and reputation have become critical market mechanisms that affect the decision-making processes of end-users. In this paper, we examine the positioning strategies of new hosts on Airbnb......, a platform focused on accommodation sharing, to understand how they attempt to cope with the inherent lack of credible quality signals as they join the platform. By analyzing close to 47,000 listings, we find that new hosts follow a cost-leadership strategy rather than trying to differentiate their offerings...

Proceedings of the national conference on multifunctional advanced materials: abstracts of invited speakers

International Nuclear Information System (INIS)

2013-01-01

National Conference on Multifunctional Advanced Materials was a platform for scientists, physicists and chemists from diverse fields to discuss on interdisciplinary research on materials. The conference provided a forum for exchange of information and ideas in virtually all areas of advanced materials research, to encourage interdisciplinary research bridging the gap between magnetic materials, nanotechnology, composite materials, shockwave induced materials, physics, bio-materials, chemistry, electronics, among others. Thus, the main motive of the conference was to promote applied research in advanced materials. Papers relevant to INIS are indexed separately

Java-based mobile agent platforms for wireless sensor networks

NARCIS (Netherlands)

Aiello, F.; Carbone, A.; Fortino, G.; Galzarano, S.; Ganzha, M.; Paprzycki, M.

2010-01-01

This paper proposes an overview and comparison of mobile agent platforms for the development of wireless sensor network applications. In particular, the architecture, programming model and basic performance of two Java-based agent platforms, Mobile Agent Platform for Sun SPOT (MAPS) and Agent

Platform for Modeling and Simulation of Photovoltaic Generation Systems

Directory of Open Access Journals (Sweden)

Anny A. Arroyave-Berrio

2013-11-01

Full Text Available A platform for modeling and simulation using Matlab is presented. The platform has four models of photovoltaic panels. It identifies the parameters of each one, for a given solar panel, based on experimental data of voltage, current and environmental conditions. Also the platform generates four blocks, for using in Matlab-Simulink and Psim simulation tools. The experimental validation of the platform was made using the PV panels of the Metropolitan Technological Institute (ITM Lab.

Airy beams on two dimensional materials

Science.gov (United States)

Imran, Muhammad; Li, Rujiang; Jiang, Yuyu; Lin, Xiao; Zheng, Bin; Dehdashti, Shahram; Xu, Zhiwei; Wang, Huaping

2018-05-01

We propose that quasi-transverse-magnetic (quasi-TM) Airy beams can be supported on two dimensional (2D) materials. By taking graphene as a typical example, the solution of quasi-TM Airy beams is studied under the paraxial approximation. The analytical field intensity in a bilayer graphene-based planar plasmonic waveguide is confirmed by the simulation results. Due to the tunability of the chemical potential of graphene, the self-accelerating behavior of the quasi-TM Airy beam can be steered effectively. 2D materials thus provide a good platform to investigate the propagation of Airy beams.

Design, construction, and implementation of an online platform for patients with type 1 diabetes: EncoDiab

Science.gov (United States)

Alvarado-Martel, Dácil; Cañas, Francesca; Velasco, Rebeca; Alcubierre, Nuria; López-Ríos, Laura; Rius, Ferran; Nóvoa, Francisco Javier; Carrillo, Armando; Hernández, Marta; Wägner, Ana María; Mauricio, Dídac

2015-01-01

Purpose The purpose of this study was to develop, build, and implement a virtual platform equipped with practical tools, relevant contents, and communication rooms, with the aim of facilitating patients’ self-management of type 1 diabetes mellitus (T1DM). Materials and methods The design of the platform was based on the suggestions of T1DM patients who were being managed at two reference hospitals. Patients’ needs and preferences were identified in group discussion sessions. Before having access to the platform, patients underwent a baseline assessment, which included physical examination and the administration of validated questionnaires for evaluation of clinical background, quality of life, treatment satisfaction, and well-being. Results A total of 33 patients were included in the study; 54.5% of them were men, their median age was 34 (18–50) years, the median duration of diabetes was 15 (1–38) years, and the median A1C was 7.4% (6%–12.6%). Based on their suggestions and requests, the online platform EncoDiab was built and organized into four domains: a personal domain, two domains shared by the patients and the staff of each of the two participating hospitals, and one domain that was accessible to all participants. The platform included practical tools (a body mass index calculator, a carbohydrate counting tool, and an insulin-dose calculator), a library with relevant information (documents on prevention and treatment of acute complications, nutrition, exercise, etc), and a chat room. Conclusion Although the study is still ongoing, our current results demonstrate the feasibility of building and implementing an online platform for helping T1DM patients in the self-management of their disease in the public health setting. PMID:26124644

Online stock trading platform

Directory of Open Access Journals (Sweden)

Ion LUNGU

2006-01-01

Full Text Available The Internet is the perfect tool that can assure the market’s transparency for any user who wants to trade on the stock market. The investor can have access to the market news, financial calendar or the press releases of the issuers. A good online trading platform also provides real-time intraday quotes, trading history and technical analysis giving the investor a clearer view of the supply and demand in the market. All this information provides the investor a good image of the market and encourages him to trade. This paper wishes to draft the pieces of an online trading platform and to analyze the impact of developing and implementing one in a brokerage firm.

Common tester platform concept.

Energy Technology Data Exchange (ETDEWEB)

Hurst, Michael James

2008-05-01

This report summarizes the results of a case study on the doctrine of a common tester platform, a concept of a standardized platform that can be applicable across the broad spectrum of testing requirements throughout the various stages of a weapons program, as well as across the various weapons programs. The common tester concept strives to define an affordable, next-generation design that will meet testing requirements with the flexibility to grow and expand; supporting the initial development stages of a weapons program through to the final production and surveillance stages. This report discusses a concept investing key leveraging technologies and operational concepts combined with prototype tester-development experiences and practical lessons learned gleaned from past weapons programs.

Operation of Lanzhou all permanent electron cyclotron resonance ion source No. 2 on 320 kV platform with highly charged ions.

Science.gov (United States)

Lu, W; Li, J Y; Kang, L; Liu, H P; Li, H; Li, J D; Sun, L T; Ma, X W

2014-02-01

The 320 kV platform for multi-discipline research with highly charged ions is a heavy ion beam acceleration instrument developed by Institute of Modern Physics, which is dedicated to basic scientific researches such as plasma, atom, material physics, and astrophysics, etc. The platform has delivered ion beams of 400 species for 36,000 h. The average operation time is around 5000 h/year. With the beams provided by the platform, lots of outstanding progresses were made in various research fields. The ion source of the platform is an all-permanent magnet electron cyclotron resonance ion source, LAPECR2 (Lanzhou All Permanent ECR ion source No. 2). The maximum axial magnetic fields are 1.28 T at injection and 1.07 T at extraction, and the radial magnetic field is up to 1.21 T at the inner wall of the plasma chamber. The ion source is capable to produce low, medium, and high charge state gaseous and metallic ion beams, such as H(+), (40)Ar(8+), (129)Xe(30+), (209)Bi(33+), etc. This paper will present the latest result of LAPECR2 and the routine operation status for the high voltage platform.

On the notion of abstract platform in MDA development

NARCIS (Netherlands)

Andrade Almeida, João; Dijkman, R.M.; van Sinderen, Marten J.; Ferreira Pires, Luis

2004-01-01

Although platform-independence is a central property in MDA models, the study of platform-independence has been largely overlooked in MDA. As a consequence, there is a lack of guidelines to select abstraction criteria and modelling concepts for platform-independent design. In addition, there is

Graphalytics: A Big Data Benchmark for Graph-Processing Platforms

NARCIS (Netherlands)

M. Capotă (Mihai); T. Hegeman (Tim); A. Iosup (Alexandru); A. Prat; O. Erling (Orri); P.A. Boncz (Peter)

2015-01-01

htmlabstractGraphs are increasingly used in industry, governance, and science. This has stimulated the appearance of many and diverse graph-processing platforms. Although platform diversity is beneficial, it also makes it very challenging to select the best platform for an application domain or one

A body sensor platform for concurrent applications

NARCIS (Netherlands)

Bui, T.V.; Verhoeven, R.; Lukkien, J.J.

2012-01-01

This paper presents a Body Sensor Platform supporting concurrent applications that share resources and data. Concerns are application isolation, data privacy and platform trustworthiness in view of dynamic loading of applications. A prototype has been built on commercial-off-the-shelf hardware. The

Constructing bald eagle nests with natural materials

Science.gov (United States)

T. G. Grubb

1995-01-01

A technique for using natural materials to build artificial nests for bald eagles (Haliaeetus leucocephalus) and other raptors is detailed. Properly constructed nests are as permanently secured to the nest tree or cliff substrate as any eagle-built nest or human-made platform. Construction normally requires about three hours and at least two people. This technique is...

Materials Data Science: Current Status and Future Outlook

Science.gov (United States)

Kalidindi, Surya R.; De Graef, Marc

2015-07-01

The field of materials science and engineering is on the cusp of a digital data revolution. After reviewing the nature of data science and Big Data, we discuss the features of materials data that distinguish them from data in other fields. We introduce the concept of process-structure-property (PSP) linkages and illustrate how the determination of PSPs is one of the main objectives of materials data science. Then we review a selection of materials databases, as well as important aspects of materials data management, such as storage hardware, archiving strategies, and data access strategies. We introduce the emerging field of materials data analytics, which focuses on data-driven approaches to extract and curate materials knowledge from available data sets. The critical need for materials e-collaboration platforms is highlighted, and we conclude the article with a number of suggestions regarding the near-term future of the materials data science field.

Designing platform independent mobile apps and services

CERN Document Server

Heckman, Rocky

2016-01-01

This book explains how to help create an innovative and future proof architecture for mobile apps by introducing practical approaches to increase the value and flexibility of their service layers and reduce their delivery time. Designing Platform Independent Mobile Apps and Services begins by describing the mobile computing landscape and previous attempts at cross platform development. Platform independent mobile technologies and development strategies are described in chapter two and three. Communication protocols, details of a recommended five layer architecture, service layers, and the data abstraction layer are also introduced in these chapters. Cross platform languages and multi-client development tools for the User Interface (UI) layer, as well as message processing patterns and message routing of the Service Int rface (SI) layer are explained in chapter four and five. Ways to design the service layer for mobile computing, using Command Query Responsibility Segregation (CQRS) and the Data Abstraction La...

Mobile Prototyping Platforms for Remote Engineering Applications

Directory of Open Access Journals (Sweden)

Karsten Henke

2009-08-01

Full Text Available This paper describes a low-cost mobile communication platform as a universal rapid-prototyping system, which is based on the Quadrocopter concept. At the Integrated Hardware and Software Systems Group at the Ilmenau University of Technology these mobile platforms are used to motivate bachelor and master students to study Computer Engineering sciences. This could be done by increasing their interest in technical issues, using this platform as integral part of a new ad-hoc lab to demonstrate different aspects in the area of Mobile Communication as well as universal rapid prototyping nodes to investigate different mechanisms for self-organized mobile communication systems within the International Graduate School on Mobile Communications. Beside the three fields of application, the paper describes the current architecture concept of the mobile prototyping platform as well as the chosen control mechanism and the assigned sensor systems to fulfill all the required tasks.

Design for game based learning platforms

DEFF Research Database (Denmark)

Sørensen, Birgitte Holm; Meyer, Bente

2010-01-01

This paper focuses on the challenges related to the design of game based learning platforms for formal learning contexts that are inspired by the pupil's leisure time related use of web 2.0. The paper is based on the project Serious Games on a Global Market Place (2007-2011) founded by the Danish...... of web 2.0 and integrates theories of learning, didactics, games, play, communication, multimodality and different pedagogical approaches. In relation to the introduced model the teacher role is discussed.......This paper focuses on the challenges related to the design of game based learning platforms for formal learning contexts that are inspired by the pupil's leisure time related use of web 2.0. The paper is based on the project Serious Games on a Global Market Place (2007-2011) founded by the Danish...... Council for Strategic Research, in which an online game-based platform for English as a foreign language in primary school is studied. The paper presents a model for designing for game based learning platforms. This design is based on cultural and ethnographic based research on children's leisure time use...

ALICE Connex : Mobile Volunteer Computing and Edutainment Platform

CERN Document Server

Chalumporn, Gantaphon

2016-01-01

Mobile devices are very powerful and trend to be developed. They have functions that are used in everyday life. One of their main tasks is to be an entertainment devices or gaming platform. A lot of technologies are now accepted and adopted to improve the potential of education. Edutainment is a combination of entertainment and education media together to make use of both benefits. In this work, we introduce a design of edutainment platform which is a part of mobile volunteer computing and edutainment platform called ‘ALICE Connex’ for ALICE at CERN. The edutainment platform focuses to deliver enjoyment and education, while promotes ALICE and Volunteer Computing platform to general public. The design in this work describes the functionality to build an effective edutainment with real-time multiplayer interaction on round-based gameplay, while integrates seamless edutainment with basic particle physic content though game mechanism and items design. For the assessment method we will observe the enjoyment o...

Making Spatial Statistics Service Accessible On Cloud Platform

OpenAIRE

Mu, X.; Wu, J.; Li, T; Zhong, Y.; Gao, X.

2014-01-01

Web service can bring together applications running on diverse platforms, users can access and share various data, information and models more effectively and conveniently from certain web service platform. Cloud computing emerges as a paradigm of Internet computing in which dynamical, scalable and often virtualized resources are provided as services. With the rampant growth of massive data and restriction of net, traditional web services platforms have some prominent problems existi...

Platform for the acceleration of energy liberalization (PVE)

International Nuclear Information System (INIS)

2000-01-01

The title platform was founded to support a smooth transition to a liberalized energy market. Representatives of the Dutch government, the energy sector, business and industry and other relevant parties are members of the platform. The platform was officially initiated June 22, 2000. The site contains many documents from the PVE working groups on the liberalization process of the energy market in the Netherlands and Europe in pdf-format [nl

In-vitro nanodiagnostic platform through nanoparticles and DNA-RNA nanotechnology.

Science.gov (United States)

Chan, Ki; Ng, Tzi Bun

2015-04-01

Nanocomposites containing nanoparticles or nanostructured domains exhibit an even higher degree of material complexity that leads to an extremely high variability of nanostructured materials. This review introduces analytical concepts and techniques for nanomaterials and derives recommendations for a qualified selection of characterization techniques for specific types of samples, and focuses the characterization of nanoparticles and their agglomerates or aggregates. In addition, DNA nanotechnology and the more recent newcomer RNA nanotechnology have achieved almost an advanced status among nanotechnology researchers¸ therefore, the core features, potential, and significant challenges of DNA nanotechnology are also highlighted as a new discipline. Moreover, nanobiochips made by nanomaterials are rapidly emerging as a new paradigm in the area of large-scale biochemical analysis. The use of nanoscale components enables higher precision in diagnostics while considerably reducing the cost of the platform that leads this review to explore the use of nanoparticles, nanomaterials, and other bionanotechnologies for its application to nanodiagnostics in-vitro.

Multi-function microfluidic platform for sensor integration.

Science.gov (United States)

Fernandes, Ana C; Semenova, Daria; Panjan, Peter; Sesay, Adama M; Gernaey, Krist V; Krühne, Ulrich

2018-03-06

The limited availability of metabolite-specific sensors for continuous sampling and monitoring is one of the main bottlenecks contributing to failures in bioprocess development. Furthermore, only a limited number of approaches exist to connect currently available measurement systems with high throughput reactor units. This is especially relevant in the biocatalyst screening and characterization stage of process development. In this work, a strategy for sensor integration in microfluidic platforms is demonstrated, to address the need for rapid, cost-effective and high-throughput screening in bioprocesses. This platform is compatible with different sensor formats by enabling their replacement and was built in order to be highly flexible and thus suitable for a wide range of applications. Moreover, this re-usable platform can easily be connected to analytical equipment, such as HPLC, laboratory scale reactors or other microfluidic chips through the use of standardized fittings. In addition, the developed platform includes a two-sensor system interspersed with a mixing channel, which allows the detection of samples that might be outside the first sensor's range of detection, through dilution of the sample solution up to 10 times. In order to highlight the features of the proposed platform, inline monitoring of glucose levels is presented and discussed. Glucose was chosen due to its importance in biotechnology as a relevant substrate. The platform demonstrated continuous measurement of substrate solutions for up to 12 h. Furthermore, the influence of the fluid velocity on substrate diffusion was observed, indicating the need for in-flow calibration to achieve a good quantitative output. Copyright © 2018 Elsevier B.V. All rights reserved.

Graphalytics : A big data benchmark for graph-processing platforms

NARCIS (Netherlands)

Capota, Mihai; Hegeman, Tim; Iosup, Alexandru; Prat-Pérez, Arnau; Erling, Orri; Boncz, Peter

2015-01-01

Graphs are increasingly used in industry, governance, and science. This has stimulated the appearance of many and diverse graph-processing platforms. Although platform di- versity is beneficial, it also makes it very challenging to select the best platform for an application domain or one of its im-

Front-end development and multi-language implementation on Magento Platform

OpenAIRE

Lai, Chenjia

2015-01-01

Magento is a smart platform for E-commerce solutions. Aseanic Trading Oy plans to develop a website based on the Magento platform. The purpose of this project is to develop an E-commerce platform for middle and small companies, to improve product management, and to increase a company’s profit. This project is developed based on the Magento platform. The backend of the Magento platform uses PHP language, while the frontend uses DIV, CSS and jQuery. Also, MySQL is used as the database suppo...

Compact and lightweight support platform with electromagnetic disturbance elimination for interferometer on reversed field pinch Keda Torus eXperiment

Science.gov (United States)

Mao, Wenzhe; Yuan, Peng; Zheng, Jian; Ding, Weixing; Li, Hong; Lan, Tao; Liu, Adi; Liu, Wandong; Xie, Jinlin

2016-11-01

A compact and lightweight support platform has been used as a holder for the interferometer system on the Keda Torus eXperiment (KTX), which is a reversed field pinch device. The vibration caused by the interaction between the time-varying magnetic field and the induced current driven in the metal optical components has been measured and, following comparison with the mechanical vibration of the KTX device and the refraction effect of the ambient turbulent air flow, has been identified as the primary vibration source in this case. To eliminate this electromagnetic disturbance, nonmetallic epoxy resin has been selected as the material for the support platform and the commercially available metal optical mounts are replaced. Following these optimization steps and mechanical reinforcements, the stability of the interferometer platform has improved significantly. The phase shift caused by the vibration has been reduced to the level of background noise.

Flexible Communication Platform for Crisis Management

OpenAIRE

Jiří Barta; Tomáš Ludík; Jiří Urbánek

2013-01-01

Topics Disaster and Emergency Management are highly debated among experts. Fast communication will help to deal with emergencies. Problem is with the network connection and data exchange. The paper suggests a solution, which allows possibilities and perspectives of new flexible communication platform to the protection of communication systems for crisis management. This platform is used for everyday communication and communication in crisis situations too.

Graphene as multifunctional delivery platform in cancer therapy.

Science.gov (United States)

Nejabat, Mojgan; Charbgoo, Fahimeh; Ramezani, Mohammad

2017-08-01

The biomedical applications of graphene-based nanomaterials including drug and gene delivery have grown rapidly in the past few years. This is due to its high surface area that results in high cargo loading capacity. It is demonstrated that graphene can improve drug efficacy without increasing the dose of the chemotherapeutic agent in cancer treatment. Considering these valuable benefits of graphene, this review focused on the newest advancements in drug and gene delivery systems using graphene and unveiling advantages and disadvantages of different graphene-based materials in introducing an effective cargo delivery system for cancer therapy. Different approaches for reducing cytotoxic impacts of graphene oxide and production of biocompatible delivery platform were also reviewed. © 2017 Wiley Periodicals, Inc. J Biomed Mater Res Part A: 105A: 2355-2367, 2017. © 2017 Wiley Periodicals, Inc.

Miniaturized Analytical Platforms From Nanoparticle Components: Studies in the Construction, Characterization, and High-Throughput Usage of These Novel Architectures

Energy Technology Data Exchange (ETDEWEB)

Pris, Andrew David [Iowa State Univ., Ames, IA (United States)

2003-01-01

The scientific community has recently experienced an overall effort to reduce the physical size of many experimental components to the nanometer size range. This size is unique as the characteristics of this regime involve aspects of pure physics, biology, and chemistry. One extensively studied example of a nanometer sized experimental component, which acts as a junction between these three principle scientific theologies, is deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). These biopolymers not only contain the biological genetic guide to code for the production of life-sustaining materials, but are also being probed by physicists as a means to create electrical circuits and furthermore as controllable architectural and sensor motifs in the chemical disciplines. Possibly the most common nano-sized component between these sciences are nanoparticles composed of a variety of materials. The cross discipline employment of nanoparticles is evident from the vast amount of literature that has been produced from each of the individual communities within the last decade. Along these cross-discipline lines, this dissertation examines the use of several different types of nanoparticles with a wide array of surface chemistries to understand their adsorption properties and to construct unique miniaturized analytical and immunoassay platforms. This introduction will act as a literature review to provide key information regarding the synthesis and surface chemistries of several types of nanoparticles. This material will set the stage for a discussion of assembling ordered arrays of nanoparticles into functional platforms, architectures, and sensors. The introduction will also include a short explanation of the atomic force microscope that is used throughout the thesis to characterize the nanoparticle-based structures. Following the Introduction, four research chapters are presented as separate manuscripts. Chapter 1 examines the self-assembly of polymeric nanoparticles

Fluidics platform and method for sample preparation

Science.gov (United States)

Benner, Henry W.; Dzenitis, John M.

2016-06-21

Provided herein are fluidics platforms and related methods for performing integrated sample collection and solid-phase extraction of a target component of the sample all in one tube. The fluidics platform comprises a pump, particles for solid-phase extraction and a particle-holding means. The method comprises contacting the sample with one or more reagents in a pump, coupling a particle-holding means to the pump and expelling the waste out of the pump while the particle-holding means retains the particles inside the pump. The fluidics platform and methods herein described allow solid-phase extraction without pipetting and centrifugation.

New Digital Metal-Oxide (MOx Sensor Platform

Directory of Open Access Journals (Sweden)

Daniel Rüffer

2018-03-01

Full Text Available The application of metal oxide gas sensors in Internet of Things (IoT devices and mobile platforms like wearables and mobile phones offers new opportunities for sensing applications. Metal-oxide (MOx sensors are promising candidates for such applications, thanks to the scientific progresses achieved in recent years. For the widespread application of MOx sensors, viable commercial offerings are required. In this publication, the authors show that with the new Sensirion Gas Platform (SGP a milestone in the commercial application of MOx technology has been reached. The architecture of the new platform and its performance in selected applications are presented.

AutoCAD platform customization VBA

CERN Document Server

Ambrosius, Lee

2015-01-01

Boost productivity and streamline your workflow with expert AutoCAD: VBA programming instruction AutoCAD Platform Customization: VBA is the definitive guide to personalizing AutoCAD and the various programs that run on the AutoCAD platform, including AutoCAD Architecture, Civil 3D, Plant 3D, and more. Written by an Autodesk insider with years of customization and programming experience, this book features detailed discussions backed by real-world examples and easy-to-follow tutorials that illustrate each step in the personalization process. Readers gain expert guidance toward managing layout

Launching a Two-sided Platform

OpenAIRE

Solheim, Magnus Tovsen; Tovsen, Ole Kristoffer Solheim

2017-01-01

Two-sided platforms, such as Airbnb, Uber and eBay, have all revolutionized their industries. Despite having colossal potential, they are very difficult to launch. This is due to what s referred to as network effects, which imply that the value of the platform becomes larger as more people use it. Network effects lead to a chicken-or-egg-problem , where it is difficult to convince sellers to join if there are no buyers and vice versa, in addition to the need to reach a critical mass of users...

Risk Management of P2P Internet Financing Service Platform

Science.gov (United States)

Yalei, Li

2017-09-01

Since 2005, the world’s first P2P Internet financing service platform Zopa in UK was introduced, in the development of “Internet +” trend, P2P Internet financing service platform has been developed rapidly. In 2007, China’s first P2P platform “filming loan” was established, marking the P2P Internet financing service platform to enter China and the rapid development. At the same time, China’s P2P Internet financing service platform also appeared in different forms of risk. This paper focuses on the analysis of the causes of risk of P2P Internet financing service platform and the performance of risk management process. It provides a solution to the Internet risk management plan, and explains the risk management system of the whole P2P Internet financing service platform and the future development direction.

Prospects of joining multi-material structures

Science.gov (United States)

Sankaranarayanan, R.; Hynes, N. Rajesh Jesudoss

2018-05-01

Spring up trends and necessities make the pipelines for the brand new Technologies. The same way, Multimaterial structures emerging as fruitful alternatives for the conventional structures in the manufacturing sector. Especially manufacturing of transport vehicles is placing a perfect platform for these new structures. Bonding or joining technology plays a crucial role in the field of manufacturing for sustainability. These latest structures are purely depending on such joining technologies so that multi-material structuring can be possible practically. The real challenge lies on joining dissimilar materials of different properties and nature. Escalation of thermoplastic usage in large structural components also faces similar ambiguity for joining multi-material structures. Adhesive bonding, mechanical fastening and are the answering technologies for multi-material structures. This current paper analysis the prospects of these bonding technologies to meet the challenges of tomorrow.

Carbonate-platform response to the Toarcian Oceanic Anoxic Event in the southern hemisphere: Implications for climatic change and biotic platform demise

Science.gov (United States)

Han, Zhong; Hu, Xiumian; Kemp, David B.; Li, Juan

2018-05-01

The Toarcian Oceanic Anoxic Event (T-OAE, ∼183 Ma) was a profound short-term environmental perturbation associated with the large-scale release of 13C-depleted carbon into the global ocean-atmosphere system, which resulted in a significant negative carbon-isotope excursion (CIE). The general lack of characteristic T-OAE records outside of the northern hemisphere means that the precise environmental effects and significance of this event are uncertain. Many biotic carbonate platforms of the northern hemisphere western Tethys drowned or shifted to non-skeletal platforms during the early Toarcian. However, southern hemisphere records of Toarcian carbonate platforms are rare, and thus the extent and significance of biotic platform demise during the T-OAE is unclear. Here we present high-resolution geochemical and sedimentological data across two Pliensbachian-Toarcian shallow-water carbonate-platform sections exposed in the Tibetan Himalaya. These sections were located paleogeographically on the open southeastern tropical Tethyan margin in the southern hemisphere. The T-OAE in the Tibetan Himalaya is marked by a negative CIE in organic matter. Our sedimentological analysis of the two sections reveals an abundance of storm deposits within the T-OAE interval, which emphasizes a close link between warming and tropical storms during the T-OAE event, in line with evidence recently provided from western Tethyan sections of the northern hemisphere. In addition, our analysis also reveals extensive biotic carbonate-platform demise by drowning or changing to non-skeletal carbonates coincident with the onset of the CIE. Taken together, our results suggest that rapid and pervasive seawater warming in response to carbon release likely played a significant role in sudden biotic carbonate platform demise, and suppression/postponement of biotic platform re-development along the whole tropical/subtropical Tethyan margin.

Contrasting platform thinking and product modularization

DEFF Research Database (Denmark)

Boer, Henrike Engele Elisabeth; Persson, Magnus

2015-01-01

Product modularization and platform thinking are both practices that seek to alleviate the negative impact of product customization and variety on internal operations by relying on economies of substitution. Through the use of a standardized pool of components and interfaces, these practices aim...... to create a broad spectrum of product choices. At first sight, product modularization and platform thinking are very similar. The difference between these practices can, however, be found in the manner in which they employ standardization. Where product modularization focuses on creating standardized...... variants. There is a general lack of research addressing the contingency factors that dictate the appropriateness of the use of product modularization and platform thinking in different contexts. To our knowledge, no large-scale empirical research has been reported in which the two concepts, contextual...

Planning geometry lessons with learning platforms

DEFF Research Database (Denmark)

Tamborg, Andreas Lindenskov

mathematics teachers’ joint planning of a lesson in geometry with a learning platform called Meebook is analyzed using the instrumental approach. It is concluded that the interface in Meebook orients the teachers work toward what the students should do rather than what they should learn, although the latter......This paper investigates how mathematics teachers plan lessons with a recently implemented Danish learning platform designed to support teachers in planning lessons in line with a recent objective-oriented curriculum. Drawing on data from observations of and interviews with teachers, three...... is a key intention behind the implementation of the platform. It is also concluded that when the teachers succeed in using learning objectives actively in their planning, the objectives support the teachers in designing lessons that correspond with their intentions. The paper concludes with a discussion...

Collaborative Development Planning Model of Supporting Product in Platform Innovation Ecosystem

Directory of Open Access Journals (Sweden)

Wei Zhang

2014-01-01

Full Text Available In order to improve the market value of the product, the platform enterprise often participates in the development process of supporting product of emerging industry’s platform innovation ecosystem. This paper puts forward a revenue sharing contract between the platform company and the supporting company by creating a collaborative development model of the supporting product in the ecosystem, and this paper studies the platform enterprise investment resource property's (complementary or substitution impact on the supporting enterprise R&D efforts and the revenue sharing factor and analyzes collaborative development mechanism of supporting product of emerging industry platform innovation ecosystem. The research indicates that when platform enterprise and supporting enterprise's resources are complementary, the supporting enterprise R&D effort level and revenue sharing coefficient increase as the platform company’s investment increases. When platform enterprise and supporting enterprise's resources are substitutive, the supporting enterprise’s R&D effort level and revenue sharing coefficient decrease as the platform company’s investment increases.

RemoteLabs Platform

Directory of Open Access Journals (Sweden)

Nils Crabeel

2012-03-01

Full Text Available This paper reports on a first step towards the implementation of a framework for remote experimentation of electric machines – the RemoteLabs platform. This project was focused on the development of two main modules: the user Web-based and the electric machines interfaces. The Web application provides the user with a front-end and interacts with the back-end – the user and experiment persistent data. The electric machines interface is implemented as a distributed client server application where the clients, launched by the Web application, interact with the server modules located in platforms physically connected the electric machines drives. Users can register and authenticate, schedule, specify and run experiments and obtain results in the form of CSV, XML and PDF files. These functionalities were successfully tested with real data, but still without including the electric machines. This inclusion is part of another project scheduled to start soon.

Refinement and dissemination of a digital platform for sharing transportation education materials.

Science.gov (United States)

2015-07-01

National agencies have called for more widespread adoption of best practices in engineering education. To facilitate this sharing of practices a : web-based system framework used by transportation engineering educators to share curricular materials a...

Virtual platforms use: a useful monitoring tool

Directory of Open Access Journals (Sweden)

Jerónimo Torres-Porras

2018-03-01

Full Text Available The European Higher Education Area is motivating a substantial change in university education and is promoting the use of new Technologies of Information and Communication. The educational virtual platform Moodle is one of the most widely used worldwide and also facilitates the creation of online learning sites and provides data of monitoring platform by users. This study focuses on the extent of use of Moodle by university students, following the same groups in their first and last academic year, finding a significant relation with the marks obtained in the subjects analyzed. This relationship shows that students with lower marks have used less Moodle platform, which has been maintained until the end of the Degree. Therefore, it is suggested that records in virtual platforms could be used as an index of interest in the subjects and it is recommended that they be analyzed during the first academic year in order to detect the least motivated groups and thus be able to act.

IoT Platforms: Analysis for Building Projects

Directory of Open Access Journals (Sweden)

Rusu Liviu DUMITRU

2017-01-01

Full Text Available This paper presents a general survey of IoT platforms in terms of features for IoT project de-velopers. I will briefly summarize the state of knowledge in terms of technology regarding “In-ternet of Things” first steps in developing this technology, history, trends, sensors and micro-controllers used. I have evaluated a number of 5 IoT platforms in terms of the features needed to develop a IoT project. I have listed those components that are most appreciated by IoT pro-ject developers and the results have been highlighted in a comparative analysis of these plat-forms from the point of view of IoT project developers and which are strictly necessary as a de-velopment environment for an IoT project based. I’ve also considered the users' views of such platforms in terms of functionality, advantages, disadvantages and dangers presented by this technology.

Paper-based Platform for Urinary Creatinine Detection.

Science.gov (United States)

Sittiwong, Jarinya; Unob, Fuangfa

2016-01-01

A new paper platform was developed for the colorimetric detection of creatinine. The filter paper was coated with 3-propylsulfonic acid trimethoxysilane and used as the platform. Creatinine in a cationic form was extracted onto the paper via an ion-exchange mechanism and detected through the Jaffé reaction, resulting in a yellow-orange color complex. The color change on the paper could be observed visually, and the quantitative detection of creatinine was achieved through monitoring the color intensity change. The color intensity of creatinine complexes on the paper platform as a function of the creatinine concentration provided a linear range for creatinine detection in the range of 10 - 60 mg L(-1) and a detection limit of 4.2 mg L(-1). The accuracy of the proposed paper-based method was comparable to the conventional standard Jaffé method. This paper platform could be applied for simple and rapid detection of creatinine in human urine samples with a low consumption of reagent.

Leveraging socially networked mobile ICT platforms for the last-mile delivery problem.

Science.gov (United States)

Suh, Kyo; Smith, Timothy; Linhoff, Michelle

2012-09-04

Increasing numbers of people are managing their social networks on mobile information and communication technology (ICT) platforms. This study materializes these social relationships by leveraging spatial and networked information for sharing excess capacity to reduce the environmental impacts associated with "last-mile" package delivery systems from online purchases, particularly in low population density settings. Alternative package pickup location systems (PLS), such as a kiosk on a public transit platform or in a grocery store, have been suggested as effective strategies for reducing package travel miles and greenhouse gas emissions, compared to current door-to-door delivery models (CDS). However, our results suggest that a pickup location delivery system operating in a suburban setting may actually increase travel miles and emissions. Only once a social network is employed to assist in package pickup (SPLS) are significant reductions in the last-mile delivery distance and carbon emissions observed across both urban and suburban settings. Implications for logistics management's decades-long focus on improving efficiencies of dedicated distribution systems through specialization, as well as for public policy targeting carbon emissions of the transport sector are discussed.

Usability studies on e-learning platforms: Preliminary study in USM

Science.gov (United States)

Emang, Devinna Win Anak Boniface; Lukman, Raja Nurul Izzati Raja; Kamarulzaman, Muhammad Izzat Syafiq; Zaaba, Zarul Fitri

2017-10-01

This paper explores the end-users' experienced in regards to the usability issues in E-learning platform. An online survey utilising 116 participants were conducted to investigate the end-users understanding and satisfaction on E-learning platform in the Universiti Sains Malaysia (USM). The results indicates that mainly students still experiencing significant challenges in E-learning platform in regards to accessibility, technical terminologies and functionality. On the other hand, the 10 heuristic guideline is chosen to be a referral point to compare five E-learning platforms in order to assess each performance on regards to the usability criteria. Overall, USM E-learning platform can be considered in a good shape. However, there are more works to be done to improve the delivery system of the E-learning if it would like to sustain for a long period of time. Although the result is at the preliminary stage, it provides useful insights to improve the E-learning platform as one of the most popular education platform in Malaysia.

Handheld Microneedle-Based Electrolyte Sensing Platform.

Energy Technology Data Exchange (ETDEWEB)

Miller, Philip R. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Rivas, Rhiana [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Johnson, David [Aquila Technologies Group, Inc., Albuquerque, NM (United States); Edwards, Thayne L. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Koskelo, Markku [Aquila Technologies Group, Inc., Albuquerque, NM (United States); Shawa, Luay [Aquila Technologies Group, Inc., Albuquerque, NM (United States); Brener, Igal [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Chavez, Victor H. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Polsky, Ronen [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

2015-11-01

Sandia National Laboratories will provide technical assistance, within time and budget, to Requester on testing and analyzing a microneedle-based electrolyte sensing platform. Hollow microneedles will be fabricated at Sandia and integrated with a fluidic chip using plastic laminate prototyping technology available at Sandia. In connection with commercial ion selective electrodes the sensing platform will be tested for detection of electrolytes (sodium and/or potassium) within physiological relevant concent ration ranges.

Wearable Device Control Platform Technology for Network Application Development

Directory of Open Access Journals (Sweden)

Heejung Kim

2016-01-01

Full Text Available Application development platform is the most important environment in IT industry. There are a variety of platforms. Although the native development enables application to optimize, various languages and software development kits need to be acquired according to the device. The coexistence of smart devices and platforms has rendered the native development approach time and cost consuming. Cross-platform development emerged as a response to these issues. These platforms generate applications for multiple devices based on web languages. Nevertheless, development requires additional implementation based on a native language because of the coverage and functions of supported application programming interfaces (APIs. Wearable devices have recently attracted considerable attention. These devices only support Bluetooth-based interdevice communication, thereby making communication and device control impossible beyond a certain range. We propose Network Application Agent (NetApp-Agent in order to overcome issues. NetApp-Agent based on the Cordova is a wearable device control platform for the development of network applications, controls input/output functions of smartphones and wearable/IoT through the Cordova and Native API, and enables device control and information exchange by external users by offering a self-defined API. We confirmed the efficiency of the proposed platform through experiments and a qualitative assessment of its implementation.

Design and experiment of pneumatic EPB test platform

Directory of Open Access Journals (Sweden)

Jianshi GONG

2017-02-01

Full Text Available In order to verify the accuracy and reliability of the function and control strategy of the pneumatic electronic parking brake(EPB system, a test platform of the pneumatic EPB system is designed. The working principle of the air pressure type EPB test platform is introduced, the composition of the platform is confirmed, including air press storage module, braking module, man-machine interaction module, signal imitation module, data collection module, and fault diagnosis module, and the function of rapid charging and discharging of the pneumatic EPB system is carried out. The results show that, compared with manual control valve, the air pressure EPB braking process is more sensitive, and the test platform can meet the test requirements of the pneumatic electronic brake system.

Towards A Framework of Digital Payment Platform Design

DEFF Research Database (Denmark)

Kazan, Erol; Damsgaard, Jan

This paper focuses on the triumph march of mobile phones that currently are annexing music players, navigation devices, and cameras as separate physical objects. The next target is set on payment. Through synthesizing available literature, we construct a framework for studying digital payment...... platforms that combines platform, technology and business design aspects. The framework is applied to conduct a comparative case study of digital payment platforms. Four types of market actors are considered: banks, mobile network operators, merchants, and startups, which are incumbents and disrupters....... By hosting third-party services, payment instruments are evolving from single-purpose to multi-functional ones. Our research extends existing payment literature from the MSP perspective to emphasize certain digital payment platform components, which impact strategies and complementary products....

Proba-V Mission Exploitation Platform

Science.gov (United States)

Goor, Erwin; Dries, Jeroen

2017-04-01

VITO and partners developed the Proba-V Mission Exploitation Platform (MEP) as an end-to-end solution to drastically improve the exploitation of the Proba-V (a Copernicus contributing mission) EO-data archive (http://proba-v.vgt.vito.be/), the past mission SPOT-VEGETATION and derived vegetation parameters by researchers, service providers and end-users. The analysis of time series of data (+1PB) is addressed, as well as the large scale on-demand processing of near real-time data on a powerful and scalable processing environment. Furthermore data from the Copernicus Global Land Service is in scope of the platform. From November 2015 an operational Proba-V MEP environment, as an ESA operation service, is gradually deployed at the VITO data center with direct access to the complete data archive. Since autumn 2016 the platform is operational and yet several applications are released to the users, e.g. - A time series viewer, showing the evolution of Proba-V bands and derived vegetation parameters from the Copernicus Global Land Service for any area of interest. - Full-resolution viewing services for the complete data archive. - On-demand processing chains on a powerfull Hadoop/Spark backend e.g. for the calculation of N-daily composites. - Virtual Machines can be provided with access to the data archive and tools to work with this data, e.g. various toolboxes (GDAL, QGIS, GrassGIS, SNAP toolbox, …) and support for R and Python. This allows users to immediately work with the data without having to install tools or download data, but as well to design, debug and test applications on the platform. - A prototype of jupyter Notebooks is available with some examples worked out to show the potential of the data. Today the platform is used by several third party projects to perform R&D activities on the data, and to develop/host data analysis toolboxes. In parallel the platform is further improved and extended. From the MEP PROBA-V, access to Sentinel-2 and landsat data will

USA Hire Testing Platform

Data.gov (United States)

Office of Personnel Management — The USA Hire Testing Platform delivers tests used in hiring for positions in the Federal Government. To safeguard the integrity of the hiring processes and ensure...

A QFD-based optimization method for a scalable product platform

Science.gov (United States)

Luo, Xinggang; Tang, Jiafu; Kwong, C. K.

2010-02-01

In order to incorporate the customer into the early phase of the product development cycle and to better satisfy customers' requirements, this article adopts quality function deployment (QFD) for optimal design of a scalable product platform. A five-step QFD-based method is proposed to determine the optimal values for platform engineering characteristics (ECs) and non-platform ECs of the products within a product family. First of all, the houses of quality (HoQs) for all product variants are developed and a QFD-based optimization approach is used to determine the optimal ECs for each product variant. Sensitivity analysis is performed for each EC with respect to overall customer satisfaction (OCS). Based on the obtained sensitivity indices of ECs, a mathematical model is established to simultaneously optimize the values of the platform and the non-platform ECs. Finally, by comparing and analysing the optimal solutions with different number of platform ECs, the ECs with which the worst OCS loss can be avoided are selected as platform ECs. An illustrative example is used to demonstrate the feasibility of this method. A comparison between the proposed method and a two-step approach is conducted on the example. The comparison shows that, as a kind of single-stage approach, the proposed method yields better average degree of customer satisfaction due to the simultaneous optimization of platform and non-platform ECs.

Design and experiment of pneumatic EPB test platform

OpenAIRE

Jianshi GONG; Tianle JIA; Dali TIAN; Hongliang WANG; Di HUANG

2017-01-01

In order to verify the accuracy and reliability of the function and control strategy of the pneumatic electronic parking brake(EPB) system, a test platform of the pneumatic EPB system is designed. The working principle of the air pressure type EPB test platform is introduced, the composition of the platform is confirmed, including air press storage module, braking module, man-machine interaction module, signal imitation module, data collection module, and fault diagnosis module, and the funct...

Delving into the heart of materials

CERN Multimedia

Caroline Duc

2012-01-01

In the middle of September, the HiRadMat platform was equipped with a new test bench designed by CERN teams, which should provide a greater insight into how matter behaves when impacted by high-energy, high-intensity particle beams.   Section of the new machine where images of the sample fragments being projected upon beam impact are recorded. The HiRadMat – High Irradiation to Materials – facility is designed to test the resistance to high-intensity beams of materials or components destined for particle accelerators. As part of the EU programme EUCARD, which finances a number of R&D projects including one to develop new materials for protecting the LHC against accidental beam losses, CERN's Mechanical and Materials Engineering (MME) Group, supported by teams from the EN, BE, TE and PH Departments, has designed a machine capable of testing six different materials in a single experiment. In total, twelve rows of up to ten 40-mm-diameter samples can be subjecte...

Superhydrophobic Materials for Biomedical Applications

Science.gov (United States)

Colson, Yolonda L.; Grinstaff, Mark W.

2016-01-01

Superhydrophobic surfaces are actively studied across a wide range of applications and industries, and are now finding increased use in the biomedical arena as substrates to control protein adsorption, cellular interaction, and bacterial growth, as well as platforms for drug delivery devices and for diagnostic tools. The commonality in the design of these materials is to create a stable or metastable air state at the material surface, which lends itself to a number of unique properties. These activities are catalyzing the development of new materials, applications, and fabrication techniques, as well as collaborations across material science, chemistry, engineering, and medicine given the interdisciplinary nature of this work. The review begins with a discussion of superhydrophobicity, and then explores biomedical applications that are utilizing superhydrophobicity in depth including material selection characteristics, in vitro performance, and in vivo performance. General trends are offered for each application in addition to discussion of conflicting data in the literature, and the review concludes with the authors’ future perspectives on the utility of superhydrophobic surfaces for biomedical applications. PMID:27449946

Compliant heterogeneous assemblies of micro-VCSELs as a new materials platform for integrated optoelectronics

Science.gov (United States)

Kang, Dongseok; Lee, Sung-Min; Kwong, Anthony; Yoon, Jongseung

2015-03-01

Despite many unique advantages, vertical cavity surface emitting lasers (VCSELs) have been available mostly on rigid, planar wafers over restricted areas, thereby limiting their usage for applications that can benefit from large-scale, programmable assemblies, hybrid integration with dissimilar materials and devices, or mechanically flexible constructions. Here, materials design and fabrication strategies that address these limitations of conventional VCSELs are presented. Specialized design of epitaxial materials and etching processes, together with printing-based deterministic assemblies and substrate thermal engineering, enabled defect-free release of microscale VCSELs and their device- and circuit-level implementation on non-native, flexible substrates with performance comparable to devices on the growth substrate.

Mechanically latchable tiltable platform for forming micromirrors and micromirror arrays

Science.gov (United States)

Garcia, Ernest J [Albuquerque, NM; Polosky, Marc A [Tijeras, NM; Sleefe, Gerard E [Cedar Crest, NM

2006-12-12

A microelectromechanical (MEM) apparatus is disclosed which includes a platform that can be electrostatically tilted from being parallel to a substrate on which the platform to being tilted at an angle of 1 20 degrees with respect to the substrate. Once the platform has been tilted to a maximum angle of tilt, the platform can be locked in position using an electrostatically-operable latching mechanism which engages a tab protruding below the platform. The platform has a light-reflective upper surface which can be optionally coated to provide an enhanced reflectivity and form a micromirror. An array of such micromirrors can be formed on a common substrate for applications including optical switching (e.g. for fiber optic communications), optical information processing, image projection displays or non-volatile optical memories.

Policy Framework for the Next Generation Platform as a Service

DEFF Research Database (Denmark)

Kentis, Angelos Mimidis; Ollora Zaballa, Eder; Soler, José

2018-01-01

The Platform-as-a-Service (PaaS) model, allows service providers to build and deploy their services following streamlined work-flows. However, platforms deployed through the PaaS model can be very diverse in terms of technologies and involved subsystems (e.g. infrastructure, orchestration). Thus,......-wide and technology-agnostic policies to NGPaaS, by means of abstraction of the underlying platforms and the use of generic interfaces. The paper also presents a specific use case for the proposed framework, which targets network-oriented policies......., the means for deploying and managing a service can significantly vary depending on the deployed platform. To address this issue, this paper proposes a policy-based framework designed for the Next Generation Platform-as-a-Service (NGPaaS). This framework allows service providers to define platform...

The Core Interaction of Platforms: How Startups Connect Users and Producers

Directory of Open Access Journals (Sweden)

Heidi M. E. Korhonen

2017-09-01

Full Text Available The platform economy is disrupting innovation while presenting both opportunities and challenges for startups. Platforms support value creation between multiple participant groups, and this operationalization of an ecosystem’s value co-creation represents the “core interaction” of a platform. This article focuses on that core interaction and studies how startups connect producers and users in value-creating core interaction through digital platforms. The study is based on an analysis of 29 cases of platform startups interviewed at a leading European startup event. The studied startups were envisioning even millions of users and hundreds or thousands of producers co-creating value on their platforms. In such platform businesses, our results highlight the importance of attracting a large user pool, providing novel services to those users, offering a new market for producers, supporting the core interaction in various ways, and utilizing elements of the platform canvas – an adaptation of the business model canvas, which we have accommodated for platform-based business models – to accomplish these goals.

Rebalancing interests and power structures on crowdworking platforms

Directory of Open Access Journals (Sweden)

Ayad Al-Ani

2016-06-01

Full Text Available Crowdwork on virtual platforms is developing into a recognisable employment and business model on the internet. Despite their many differences, the platforms that have emerged over the last few years have one thing in common: a crowd of individual producers and capabilities is mobilised – in the form of labour, accommodation or durable goods – onto the market in cooperation and competition with firms from traditional industries. This study analyses the factors crowdworkers consider relevant in their work and the measures they view as helpful in improving their working relationship with platforms. It is apparent that, in the best tradition of the peer economy, this new type of worker still considers learning and fun important factors for his or her engagement. Despite these effectively intrinsic factors, workers are quite aware of their situation, which does not put them on equal terms with the platform’s algorithms and customer focus. This awareness of power disparities does not lead them, however, to reconsider their effectiveness when it comes to renegotiating terms with the platform: when specifically asked about the role of unions, the majority of crowdworkers did not expect help in self-organisation from these institutions. Considering the difficulties in regulating the market for platforms, (self- organisation of crowdworkers, however, is an important prerequisite in rebalancing the power structure dominated by platform owners and their customers. Self-organisation is something digital natives are quite familiar with and we have to assume that crowdworkers are perhaps overconfident in their abilities. And due to the novelty of this industry, this confidence has not been shaken yet by labour disputes or even by growing dissatisfaction with platforms.

AutoCAD platform customization autolisp

CERN Document Server

Ambrosius, Lee

2014-01-01

Customize and personalize programs built on the AutoCAD platform AutoLISP is the key to unlocking the secrets of a more streamlined experience using industry leading software programs like AutoCAD, Civil 3D, Plant 3D, and more. AutoCAD Platform Customization: AutoLISP provides real-world examples that show you how to do everything from modifying graphical objects and reading and setting system variables to communicating with external programs. It also features a resources appendix and downloadable datasets and customization examples-tools that ensure swift and easy adoption. Find out how to r

Access database application in medical treatment management platform

International Nuclear Information System (INIS)

Wu Qingming

2014-01-01

For timely, accurate and flexible access to medical expenses data, we applied Microsoft Access 2003 database management software, and we finished the establishment of a management platform for medical expenses. By developing management platform for medical expenses, overall hospital costs for medical expenses can be controlled to achieve a real-time monitoring of medical expenses. Using the Access database management platform for medical expenses not only changes the management model, but also promotes a sound management system for medical expenses. (authors)

THE NEED FOR FUNCTION PLATFORMS IN ENGINEER TO ORDER INDUSTRIES

NARCIS (Netherlands)

Alblas, Alex; Wortmann, Hans; Bergendahl, MN; Grimheden, M; Leifer, L; Skogstad, P; Cantamessa, M

2009-01-01

Many industries base their innovations on product platforms. Platforms have predefined modularity with standardized interfaces. However, product platforms provide significant challenges to engineering industries that rely heavily on R&D, such as microlithography systems. Developing these systems

Integration of Magneto-Optical Materials for Novel Optical Devices & Magnetophotonic Crystals, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — This work proposes to capitalize on our Phase I success in monolithically integrating magneto-optic and magnetic materials with semiconductor platforms in order to...

A truly Lego®-like modular microfluidics platform

Science.gov (United States)

Vittayarukskul, Kevin; Lee, Abraham Phillip

2017-03-01

Ideally, a modular microfluidics platform should be simple to assemble and support 3D configurations for increased versatility. The modular building blocks should also be mass producible like electrical components. These are fundamental features of world-renowned Legos® and why Legos® inspire many existing modular microfluidics platforms. In this paper, a truly Lego®-like microfluidics platform is introduced, and its basic feasibility is demonstrated. Here, PDMS building blocks resembling 2  ×  2 Lego® bricks are cast from 3D-printed master molds. The blocks are pegged and stacked on a traditional Lego® plate to create simple, 3D microfluidic networks, such as a single basket weave. Characteristics of the platform, including reversible sealing and automatic alignment of channels, are also analyzed and discussed in detail.

A truly Lego®-like modular microfluidics platform

International Nuclear Information System (INIS)

Vittayarukskul, Kevin; Lee, Abraham Phillip

2017-01-01

Ideally, a modular microfluidics platform should be simple to assemble and support 3D configurations for increased versatility. The modular building blocks should also be mass producible like electrical components. These are fundamental features of world-renowned Legos ® and why Legos ® inspire many existing modular microfluidics platforms. In this paper, a truly Lego ® -like microfluidics platform is introduced, and its basic feasibility is demonstrated. Here, PDMS building blocks resembling 2  ×  2 Lego ® bricks are cast from 3D-printed master molds. The blocks are pegged and stacked on a traditional Lego ® plate to create simple, 3D microfluidic networks, such as a single basket weave. Characteristics of the platform, including reversible sealing and automatic alignment of channels, are also analyzed and discussed in detail. (paper)

Materials Challenges and Testing for Supply of Energy and Resources

CERN Document Server

Bollinghaus, Thomas

2012-01-01

One major goal of the World Materials Research Institute Forum - WMRIF is to promote young scientists in the field of materials science and engineering. To enhance the international knowledge exchange between young postdoctoral scientists all over the world, WMRIF meanwhile regularly organizes joint workshops among the member institutes. These workshops also represent an increasingly appreciated platform to get known to each other and to build co-operations. For such workshops, various topics are selected, pointing to future perspectives and challenges in the field of Materials Science and Eng

Strategies Used by Professors through Virtual Educational Platforms in Face-to-Face Classes: A View from the Chamilo Platform

Science.gov (United States)

Valencia, Heriberto Gonzalez; Villota Enriquez, Jackeline Amparo; Agredo, Patricia Medina

2017-01-01

This study consisted in characterizing the strategies used by professors; implemented through virtual educational platforms. The context of this research were the classrooms of the Santiago de Cali University and the virtual space of the Chamilo virtual platform, where two professors from the Faculty of Education of the same university…

Automated microfluidic platform for systematic studies of colloidal perovskite nanocrystals: towards continuous nano-manufacturing.

Science.gov (United States)

Epps, Robert W; Felton, Kobi C; Coley, Connor W; Abolhasani, Milad

2017-11-21

Colloidal organic/inorganic metal-halide perovskite nanocrystals have recently emerged as a potential low-cost replacement for the semiconductor materials in commercial photovoltaics and light emitting diodes. However, unlike III-V and IV-VI semiconductor nanocrystals, studies of colloidal perovskite nanocrystals have yet to develop a fundamental and comprehensive understanding of nucleation and growth kinetics. Here, we introduce a modular and automated microfluidic platform for the systematic studies of room-temperature synthesized cesium-lead halide perovskite nanocrystals. With abundant data collection across the entirety of four orders of magnitude reaction time span, we comprehensively characterize nanocrystal growth within a modular microfluidic reactor. The developed high-throughput screening platform features a custom-designed three-port flow cell with translational capability for in situ spectral characterization of the in-flow synthesized perovskite nanocrystals along a tubular microreactor with an adjustable length, ranging from 3 cm to 196 cm. The translational flow cell allows for sampling of twenty unique residence times at a single equilibrated flow rate. The developed technique requires an average total liquid consumption of 20 μL per spectra and as little as 2 μL at the time of sampling. It may continuously sample up to 30 000 unique spectra per day in both single and multi-phase flow formats. Using the developed plug-and-play microfluidic platform, we study the growth of cesium lead trihalide perovskite nanocrystals through in situ monitoring of their absorption and emission band-gaps at residence times ranging from 100 ms to 17 min. The automated microfluidic platform enables a systematic study of the effect of mixing enhancement on the quality of the synthesized nanocrystals through a direct comparison between single- and multi-phase flow systems at similar reaction time scales. The improved mixing characteristics of the multi-phase flow

Advances in the development of the Mexican platform for analysis and design of nuclear reactors: AZTLAN Platform; Avances en el desarrollo de la plataforma mexicana para analisis y diseno de reactores nucleares: AZTLAN Platform

Energy Technology Data Exchange (ETDEWEB)

Gomez T, A. M.; Puente E, F. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Del Valle G, E. [IPN, Escuela Superior de Fisica y Matematicas, Av. IPN s/n, 07738 Ciudad de Mexico (Mexico); Francois L, J. L. [UNAM, Facultad de Ingenieria, Departamento de Sistemas Energeticos, Paseo Cuauhnahuac 8532, Col. Progreso, 62550 Jiutepec, Morelos (Mexico); Espinosa P, G., E-mail: armando.gomez@inin.gob.mx [Universidad Autonoma Metropolitana, Unidad Iztapalapa, Av. San Rafael Atlixco 186, Col. Vicentina, 09340 Ciudad de Mexico (Mexico)

2017-09-15

The AZTLAN platform project: development of a Mexican platform for the analysis and design of nuclear reactors, financed by the SENER-CONACYT Energy Sustain ability Fund, was approved in early 2014 and formally began at the end of that year. It is a national project led by the Instituto Nacional de Investigaciones Nucleares (ININ) and with the collaboration of Instituto Politecnico Nacional (IPN), the Universidad Autonoma Metropolitana (UAM) and Universidad Nacional Autonoma de Mexico (UNAM) as part of the development team and with the participation of the Laguna Verde Nuclear Power Plant, the National Commission of Nuclear Safety and Safeguards, the Ministry of Energy and the Karlsruhe Institute of Technology (Kit, Germany) as part of the user group. The general objective of the project is to modernize, improve and integrate the neutronic, thermo-hydraulic and thermo-mechanical codes, developed in Mexican institutions, in an integrated platform, developed and maintained by Mexican experts for the benefit of Mexican institutions. Two years into the process, important steps have been taken that have consolidated the platform. The main results of these first two years have been presented in different national and international forums. In this congress, some of the most recent results that have been implemented in the platform codes are shown in more detail. The current status of the platform from a more executive view point is summarized in this paper. (Author)

Parallel application of plasma equilibrium fitting based on inhomogeneous platforms

International Nuclear Information System (INIS)

Liao Min; Zhang Jinhua; Chen Liaoyuan; Li Yongge; Pan Wei; Pan Li

2008-01-01

An online analysis and online display platform EFIT, which is based on the equilibrium-fitting mode, is inducted in this paper. This application can realize large data transportation between inhomogeneous platforms by designing a communication mechanism using sockets. It spends approximately one minute to complete the equilibrium fitting reconstruction by using a finite state machine to describe the management node and several node computers of cluster system to fulfill the parallel computation, this satisfies the online display during the discharge interval. An effective communication model between inhomogeneous platforms is provided, which could transport the computing results from Linux platform to Windows platform for online analysis and display. (authors)

Adaptation Criteria for the Personalised Delivery of Learning Materials: A Multi-Stage Empirical Investigation

Science.gov (United States)

Thalmann, Stefan

2014-01-01

Personalised e-Learning represents a major step-change from the one-size-fits-all approach of traditional learning platforms to a more customised and interactive provision of learning materials. Adaptive learning can support the learning process by tailoring learning materials to individual needs. However, this requires the initial preparation of…

Hot air balloons fill gap in atmospheric and sensing platforms

Science.gov (United States)

Watson, Steven M.; Price, Russ

Eric Edgerton was having a problem he could not solve: how to noninvasively collect in situ incinerator plume data. So he called in the Air Force and learned about its Atmospheric and Sensor Test Platform program; its platform is a manned hot air balloon. Many investigators are discovering the advantages of hot air balloons as stable, inexpensive platforms for performing in situ atmospheric measurements. Some are also using remote sensing capabilities on the balloon platforms.

Study of New Materials Design based on Hadoop

Directory of Open Access Journals (Sweden)

Wu Jun

2016-01-01

Full Text Available With the rapid development of information technology, the scientific research shows that the data mining and other information technology could be used in the design of new materials. It is explicit that Intelligent Materials research focuses on using physical and chemical principles combined with computer techniques such as Big Data, Cloud computing and Intelligent modeling and simulation to solve chemical problems. In this paper, based on the cluster based outlier algorithm as the main body, this paper discusses the definition New Materials research In the Hadoop cloud platform, and the parallel processing of Map-Reduce model. The performance this model of new material was established by using the method of Map-Reduction provided the basis for the performance optimization.

Analyzing Cyber-Physical Threats on Robotic Platforms.

Science.gov (United States)

Ahmad Yousef, Khalil M; AlMajali, Anas; Ghalyon, Salah Abu; Dweik, Waleed; Mohd, Bassam J

2018-05-21

Robots are increasingly involved in our daily lives. Fundamental to robots are the communication link (or stream) and the applications that connect the robots to their clients or users. Such communication link and applications are usually supported through client/server network connection. This networking system is amenable of being attacked and vulnerable to the security threats. Ensuring security and privacy for robotic platforms is thus critical, as failures and attacks could have devastating consequences. In this paper, we examine several cyber-physical security threats that are unique to the robotic platforms; specifically the communication link and the applications. Threats target integrity, availability and confidential security requirements of the robotic platforms, which use MobileEyes/arnlServer client/server applications. A robot attack tool (RAT) was developed to perform specific security attacks. An impact-oriented approach was adopted to analyze the assessment results of the attacks. Tests and experiments of attacks were conducted in simulation environment and physically on the robot. The simulation environment was based on MobileSim; a software tool for simulating, debugging and experimenting on MobileRobots/ActivMedia platforms and their environments. The robot platform PeopleBot TM was used for physical experiments. The analysis and testing results show that certain attacks were successful at breaching the robot security. Integrity attacks modified commands and manipulated the robot behavior. Availability attacks were able to cause Denial-of-Service (DoS) and the robot was not responsive to MobileEyes commands. Integrity and availability attacks caused sensitive information on the robot to be hijacked. To mitigate security threats, we provide possible mitigation techniques and suggestions to raise awareness of threats on the robotic platforms, especially when the robots are involved in critical missions or applications.

Analyzing Cyber-Physical Threats on Robotic Platforms

Directory of Open Access Journals (Sweden)

Khalil M. Ahmad Yousef

2018-05-01

Full Text Available Robots are increasingly involved in our daily lives. Fundamental to robots are the communication link (or stream and the applications that connect the robots to their clients or users. Such communication link and applications are usually supported through client/server network connection. This networking system is amenable of being attacked and vulnerable to the security threats. Ensuring security and privacy for robotic platforms is thus critical, as failures and attacks could have devastating consequences. In this paper, we examine several cyber-physical security threats that are unique to the robotic platforms; specifically the communication link and the applications. Threats target integrity, availability and confidential security requirements of the robotic platforms, which use MobileEyes/arnlServer client/server applications. A robot attack tool (RAT was developed to perform specific security attacks. An impact-oriented approach was adopted to analyze the assessment results of the attacks. Tests and experiments of attacks were conducted in simulation environment and physically on the robot. The simulation environment was based on MobileSim; a software tool for simulating, debugging and experimenting on MobileRobots/ActivMedia platforms and their environments. The robot platform PeopleBotTM was used for physical experiments. The analysis and testing results show that certain attacks were successful at breaching the robot security. Integrity attacks modified commands and manipulated the robot behavior. Availability attacks were able to cause Denial-of-Service (DoS and the robot was not responsive to MobileEyes commands. Integrity and availability attacks caused sensitive information on the robot to be hijacked. To mitigate security threats, we provide possible mitigation techniques and suggestions to raise awareness of threats on the robotic platforms, especially when the robots are involved in critical missions or applications.

Dynamic posturography using a new movable multidirectional platform driven by gravity.

NARCIS (Netherlands)

Commissaris, D.A.C.M.; Nieuwenhuijzen, P.H.J.A.; Overeem, S.; Vos, A. de; Duysens, J.E.J.; Bloem, B.R.

2002-01-01

Human upright balance control can be quantified using movable platforms driven by servo-controlled torque motors (dynamic posturography). We introduce a new movable platform driven by the force of gravity acting upon the platform and the subject standing on it. The platform consists of a 1 m2 metal

Dynamic posturography using a new movable multidirectional platform driven by gravity

NARCIS (Netherlands)

Commissaris, D.A.C.M.; Nieuwenhuijzen, P.H.J.A.; Overeem, S.; Vos, A. de; Duysens, J.E.J.; Bloem, B.R.

2002-01-01

Human upright balance control can be quantified using movable platforms driven by servo-controlled torque motors (dynamic posturography). We introduce a new movable platform driven by the force of gravity acting upon the platform and the subject standing on it. The platform consists of a 1 m(2)

Analysis and design of energy monitoring platform for smart city

Science.gov (United States)

Wang, Hong-xia

2016-09-01

The development and utilization of energy has greatly promoted the development and progress of human society. It is the basic material foundation for human survival. City running is bound to consume energy inevitably, but it also brings a lot of waste discharge. In order to speed up the process of smart city, improve the efficiency of energy saving and emission reduction work, maintain the green and livable environment, a comprehensive management platform of energy monitoring for government departments is constructed based on cloud computing technology and 3-tier architecture in this paper. It is assumed that the system will provide scientific guidance for the environment management and decision making in smart city.

An Experimental Platform for Autonomous Bus Development

Directory of Open Access Journals (Sweden)

Héctor Montes

2017-11-01

Full Text Available Nowadays, with highly developed instrumentation, sensing and actuation technologies, it is possible to foresee an important advance in the field of autonomous and/or semi-autonomous transportation systems. Intelligent Transport Systems (ITS have been subjected to very active research for many years, and Bus Rapid Transit (BRT is one area of major interest. Among the most promising transport infrastructures, the articulated bus is an interesting, low cost, high occupancy capacity and friendly option. In this paper, an experimental platform for research on the automatic control of an articulated bus is presented. The aim of the platform is to allow full experimentation in real conditions for testing technological developments and control algorithms. The experimental platform consists of a mobile component (a commercial articulated bus fully instrumented and a ground test area composed of asphalt roads inside the Consejo Superior de Investigaciones Científicas (CSIC premises. This paper focuses also on the development of a human machine interface to ease progress in control system evaluation. Some experimental results are presented in order to show the potential of the proposed platform.

A gimbal platform stabilization for topographic applications

Energy Technology Data Exchange (ETDEWEB)

Michele, Mangiameli, E-mail: michele.mangiameli@dica.unict.it; Giuseppe, Mussumeci [Dept. of Civil Engineering and Architecture, University of Catania, Catania (Italy)

2015-03-10

The aim of this work is the stabilization of a Gimbal platform for optical sensors acquisitions in topographic applications using mobile vehicles. The stabilization of the line of sight (LOS) consists in tracking the command velocity in presence of nonlinear noise due to the external environment. The hardware architecture is characterized by an Ardupilot platform that allows the control of both the mobile device and the Gimbal. Here we developed a new approach to stabilize the Gimbal platform, which is based on neural network. For the control system, we considered a plant that represents the transfer function of the servo system control model for an inertial stabilized Gimbal platform. The transductor used in the feed-back line control is characterized by the Rate Gyro transfer function installed onboard of Ardupilot. For the simulation and investigation of the system performance, we used the Simulink tool of Matlab. Results show that the hardware/software approach is efficient, reliable and cheap for direct photogrammetry, as well as for general purpose applications using mobile vehicles.

Complementor embeddedness in platform ecosystems : The case of google apps

NARCIS (Netherlands)

Angeren, van J.; Blijleven, V.B; Jansen, S.; Brinkkemper, S.

2013-01-01

Platforms and their marketplaces with complementarities are prominent in the software industry. As the proprietary platform itself exhibits elementary or generic functionality, platform owners depend on a complementor ecosystem populated by third-parties. At present, little is known about mechanisms

Ultrathin coatings of nanoporous materials as property enhancements for advanced functional materials

International Nuclear Information System (INIS)

Coker, Eric Nicholas

2010-01-01

This report summarizes the findings of a five-month LDRD project funded through Sandia's NTM Investment Area. The project was aimed at providing the foundation for the development of advanced functional materials through the application of ultrathin coatings of microporous or mesoporous materials onto the surface of substrates such as silicon wafers. Prior art teaches that layers of microporous materials such as zeolites may be applied as, e.g., sensor platforms or gas separation membranes. These layers, however, are typically several microns to several hundred microns thick. For many potential applications, vast improvements in the response of a device could be realized if the thickness of the porous layer were reduced to tens of nanometers. However, a basic understanding of how to synthesize or fabricate such ultra-thin layers is lacking. This report describes traditional and novel approaches to the growth of layers of microporous materials on silicon wafers. The novel approaches include reduction of the quantity of nutrients available to grow the zeolite layer through minimization of solution volume, and reaction of organic base (template) with thermally-oxidized silicon wafers under a steam atmosphere to generate ultra-thin layers of zeolite MFI.

Studying the Effectiveness of an Online Language Learning Platform in China

Science.gov (United States)

Baker, Ryan; Wang, Feng; Ma, Zhenjun; Ma, Wei; Zheng, Shiyue

2018-01-01

In this paper we evaluate the effectiveness of an adaptive online learning platform, designed to support Chinese students in learning the English language. The adaptive platform is studied in three studies, where the experimental platform is compared to an alternate, non-adaptive platform, with random assignment to conditions (the adaptive…

An integrated web medicinal materials DNA database: MMDBD (Medicinal Materials DNA Barcode Database

Directory of Open Access Journals (Sweden)

But Paul

2010-06-01

Full Text Available Abstract Background Thousands of plants and animals possess pharmacological properties and there is an increased interest in using these materials for therapy and health maintenance. Efficacies of the application is critically dependent on the use of genuine materials. For time to time, life-threatening poisoning is found because toxic adulterant or substitute is administered. DNA barcoding provides a definitive means of authentication and for conducting molecular systematics studies. Owing to the reduced cost in DNA authentication, the volume of the DNA barcodes produced for medicinal materials is on the rise and necessitates the development of an integrated DNA database. Description We have developed an integrated DNA barcode multimedia information platform- Medicinal Materials DNA Barcode Database (MMDBD for data retrieval and similarity search. MMDBD contains over 1000 species of medicinal materials listed in the Chinese Pharmacopoeia and American Herbal Pharmacopoeia. MMDBD also contains useful information of the medicinal material, including resources, adulterant information, medical parts, photographs, primers used for obtaining the barcodes and key references. MMDBD can be accessed at http://www.cuhk.edu.hk/icm/mmdbd.htm. Conclusions This work provides a centralized medicinal materials DNA barcode database and bioinformatics tools for data storage, analysis and exchange for promoting the identification of medicinal materials. MMDBD has the largest collection of DNA barcodes of medicinal materials and is a useful resource for researchers in conservation, systematic study, forensic and herbal industry.

Efficient Sensor Integration on Platforms (NeXOS)

Science.gov (United States)

Memè, S.; Delory, E.; Del Rio, J.; Jirka, S.; Toma, D. M.; Martinez, E.; Frommhold, L.; Barrera, C.; Pearlman, J.

2016-12-01

In-situ ocean observing platforms provide power and information transmission capability to sensors. Ocean observing platforms can be mobile, such as ships, autonomous underwater vehicles, drifters and profilers, or fixed, such as buoys, moorings and cabled observatories. The process of integrating sensors on platforms can imply substantial engineering time and resources. Constraints range from stringent mechanical constraints to proprietary communication and control firmware. In NeXOS, the implementation of a PUCK plug and play capability is being done with applications to multiple sensors and platforms. This is complemented with a sensor web enablement that addresses the flow of information from sensor to user. Open standards are being tested in order to assess their costs and benefits in existing and future observing systems. Part of the testing implied open-source coding and hardware prototyping of specific control devices in particular for closed commercial platforms where firmware upgrading is not straightforward or possible without prior agreements or service fees. Some platform manufacturers such as European companies ALSEAMAR[1] and NKE Instruments [2] are currently upgrading their control and communication firmware as part of their activities in NeXOS. The sensor development companies Sensorlab[3] SMID[4] and TRIOS [5]upgraded their firmware with this plug and play functionality. Other industrial players in Europe and the US have been sent NeXOS sensors emulators to test the new protocol on their platforms. We are currently demonstrating that with little effort, it is also possible to have such middleware implemented on very low-cost compact computers such as the open Raspberry Pi[6], and have a full end-to-end interoperable communication path from sensor to user with sensor plug and play capability. The result is an increase in sensor integration cost-efficiency and the demonstration will be used to highlight the benefit to users and ocean observatory

Vývoj aplikací na platformě Java FX 8

OpenAIRE

Macháček, Martin

2014-01-01

Bachelor thesis is focused at JavaFX 8 platform. The main goal of thesis it to get read-ers familiar with this platform, its new elements and possibilities, and offer them a manual for developing RIA applications running on this platform. Thesis mainly uses authors expe-rience supported by adequate literature and technical documentation of platform for achieving its goals. The contribution consists of prepared manual written in Czech lan-guage, as well as described Scene Builder tool designed...

Industry Platforms and New Industrial Policy in Russia

Directory of Open Access Journals (Sweden)

Svetlana V. Orekhova

2017-12-01

Full Text Available The article aims at clarifying Russian industrial policy as a result of business models changing and market reconstruction. The research bass on the hypothesis that the choice of the industrial policy administrative measures depends on the object of management. It is important to link government regulation of markets with corporate strategies. We reveal that modern economic systems based on using of electronic technologies, big data, and innovative activity. Technological platforms as the single organizational and economic mechanisms affect economic systems very much. We study the content and main characteristics of a business model, is called the "technological platform". We also identify the main required changes in industrial policy. We analyze the matching between scientific and technological scenarios of the Russian economic development and the technological platform. There are two areas of the new industrial policy. They are: a multi-sectoral approach to regulating and improving the quality of the national institutional environment. The industrial and cluster management approaches are inefficient in modern conditions. There is a need for each platform of its technological development scenario. We also clarify the role of the state in the functioning of technological platforms.

[Porting Radiotherapy Software of Varian to Cloud Platform].

Science.gov (United States)

Zou, Lian; Zhang, Weisha; Liu, Xiangxiang; Xie, Zhao; Xie, Yaoqin

2017-09-30

To develop a low-cost private cloud platform of radiotherapy software. First, a private cloud platform which was based on OpenStack and the virtual GPU hardware was builded. Then on the private cloud platform, all the Varian radiotherapy software modules were installed to the virtual machine, and the corresponding function configuration was completed. Finally the software on the cloud was able to be accessed by virtual desktop client. The function test results of the cloud workstation show that a cloud workstation is equivalent to an isolated physical workstation, and any clients on the LAN can use the cloud workstation smoothly. The cloud platform transplantation in this study is economical and practical. The project not only improves the utilization rates of radiotherapy software, but also makes it possible that the cloud computing technology can expand its applications to the field of radiation oncology.

E-LEARNING PLATFORMS IN ROMANIAN HIGHER EDUCATION

Directory of Open Access Journals (Sweden)

LUCIAN LUPU DIMA

2010-01-01

Full Text Available Master’s Degree Programs generally use specific e-learning methods as a complementary training. The University of Petrosani has a partnership with Siveco Romania in the IT field focusing on ERP systems and on e-learning platforms through AeL product. We selected two Master’s Degree programmes due to the qualifications it provided on the labour market, for implementing an online master. The design of master’s degree academic curricula in e-learning system will involve the curricular development, the designing of the learning resources with the help of the e-learning technology as well as the development and simulation of the instructive-educational web-based process; all these aspects using AeL which is a universal and integrated e-learning solution, offering facilities for the management and presentation of various types of educational content, such as multimedia interactive materials, simulations, and tests, covering a wide range of subjects.

Autonomous platform for distributed sensing and actuation over bluetooth

OpenAIRE

Carvalhal, Paulo; Coelho, Ezequiel T.; Ferreira, Manuel João Oliveira; Afonso, José A.; Santos, Cristina

2006-01-01

This paper presents a short range wireless network platform based on Bluetooth technology and on a Round Robin scheduling algotithm. The main goal is to provide an application independent platform in order to support a distributed data acquisition and control system used to control a model of a greenhouse. This platform enables the advantages of wireless communications while assuring low weight, small energy consumption and reliable communications.

A Self-Sustained Wireless Multi-Sensor Platform Integrated with Printable Organic Sensors for Indoor Environmental Monitoring.

Science.gov (United States)

Wu, Chun-Chang; Chuang, Wen-Yu; Wu, Ching-Da; Su, Yu-Cheng; Huang, Yung-Yang; Huang, Yang-Jing; Peng, Sheng-Yu; Yu, Shih-An; Lin, Chih-Ting; Lu, Shey-Shi

2017-03-29

A self-sustained multi-sensor platform for indoor environmental monitoring is proposed in this paper. To reduce the cost and power consumption of the sensing platform, in the developed platform, organic materials of PEDOT:PSS and PEDOT:PSS/EB-PANI are used as the sensing films for humidity and CO₂ detection, respectively. Different from traditional gas sensors, these organic sensing films can operate at room temperature without heating processes or infrared transceivers so that the power consumption of the developed humidity and the CO₂ sensors can be as low as 10 μW and 5 μW, respectively. To cooperate with these low-power sensors, a Complementary Metal-Oxide-Semiconductor (CMOS) system-on-chip (SoC) is designed to amplify and to read out multiple sensor signals with low power consumption. The developed SoC includes an analog-front-end interface circuit (AFE), an analog-to-digital convertor (ADC), a digital controller and a power management unit (PMU). Scheduled by the digital controller, the sensing circuits are power gated with a small duty-cycle to reduce the average power consumption to 3.2 μW. The designed PMU converts the power scavenged from a dye sensitized solar cell (DSSC) module into required supply voltages for SoC circuits operation under typical indoor illuminance conditions. To our knowledge, this is the first multiple environmental parameters (Temperature/CO₂/Humidity) sensing platform that demonstrates a true self-powering functionality for long-term operations.

A Self-Sustained Wireless Multi-Sensor Platform Integrated with Printable Organic Sensors for Indoor Environmental Monitoring

Directory of Open Access Journals (Sweden)

Chun-Chang Wu

2017-03-01

Full Text Available A self-sustained multi-sensor platform for indoor environmental monitoring is proposed in this paper. To reduce the cost and power consumption of the sensing platform, in the developed platform, organic materials of PEDOT:PSS and PEDOT:PSS/EB-PANI are used as the sensing films for humidity and CO2 detection, respectively. Different from traditional gas sensors, these organic sensing films can operate at room temperature without heating processes or infrared transceivers so that the power consumption of the developed humidity and the CO2 sensors can be as low as 10 μW and 5 μW, respectively. To cooperate with these low-power sensors, a Complementary Metal-Oxide-Semiconductor (CMOS system-on-chip (SoC is designed to amplify and to read out multiple sensor signals with low power consumption. The developed SoC includes an analog-front-end interface circuit (AFE, an analog-to-digital convertor (ADC, a digital controller and a power management unit (PMU. Scheduled by the digital controller, the sensing circuits are power gated with a small duty-cycle to reduce the average power consumption to 3.2 μW. The designed PMU converts the power scavenged from a dye sensitized solar cell (DSSC module into required supply voltages for SoC circuits operation under typical indoor illuminance conditions. To our knowledge, this is the first multiple environmental parameters (Temperature/CO2/Humidity sensing platform that demonstrates a true self-powering functionality for long-term operations.

Using crosslinkable diacetylene phospholipids to construct two-dimensional packed beds in supported lipid bilayer separation platforms

Directory of Open Access Journals (Sweden)

Shu-Kai Hu, Sheng-Wen Hsiao, Hsun-Yen Mao, Ya-Ming Chen, Yung Chang and Ling Chao

2013-01-01

Full Text Available Separating and purifying cell membrane-associated biomolecules has been a challenge owing to their amphiphilic property. Taking these species out of their native lipid membrane environment usually results in biomolecule degradation. One of the new directions is to use supported lipid bilayer (SLB platforms to separate the membrane species while they are protected in their native environment. Here we used a type of crosslinkable diacetylene phospholipids, diynePC (1,2-bis(10,12-tricosadiynoyl-sn-glycero-3-phosphocholine, as a packed material to create a 'two-dimensional (2D packed bed' in a SLB platform. After the diynePC SLB is exposed to UV light, some of the diynePC lipids in the SLB can crosslink and the non-crosslinked monomer lipids can be washed away, leaving a 2D porous solid matrix. We incorporated the lipid vesicle deposition method with a microfluidic device to pattern the location of the packed-bed region and the feed region with species to be separated in a SLB platform. Our atomic force microscopy result shows that the nano-scaled structure density of the '2D packed bed' can be tuned by the UV dose applied to the diynePC membrane. When the model membrane biomolecules were forced to transport through the packed-bed region, their concentration front velocities were found to decrease linearly with the UV dose, indicating the successful creation of packed obstacles in these 2D lipid membrane separation platforms.

Volttron: An Agent Platform for the Smart Grid

Energy Technology Data Exchange (ETDEWEB)

Haack, Jereme N.; Akyol, Bora A.; Carpenter, Brandon J.; Tews, Cody W.; Foglesong, Lance W.

2013-05-06

VOLLTRON platform enables the deployment of intelligent sensors and controllers in the smart grid and provides a stable, secure and flexible framework that expands the sensing and control capabilities. VOLTTRON platform provides services fulfilling the essential requirements of resource management and security for agent operation in the power grid. The facilities provided by the platform allow agent developers to focus on the implementation of their agent system and not on the necessary "plumbing' code. For example, a simple collaborative demand response application was written in less than 200 lines of Python.

A platform independent communication library for distributed computing

NARCIS (Netherlands)

Groen, D.; Rieder, S.; Grosso, P.; de Laat, C.; Portegies Zwart, S.

2010-01-01

We present MPWide, a platform independent communication library for performing message passing between supercomputers. Our library couples several local MPI applications through a long distance network using, for example, optical links. The implementation is deliberately kept light-weight, platform

Automated Detection of Salt Marsh Platforms : a Topographic Method

Science.gov (United States)

Goodwin, G.; Mudd, S. M.; Clubb, F. J.

2017-12-01

Monitoring the topographic evolution of coastal marshes is a crucial step toward improving the management of these valuable landscapes under the pressure of relative sea level rise and anthropogenic modification. However, determining their geometrically complex boundaries currently relies on spectral vegetation detection methods or requires labour-intensive field surveys and digitisation.We propose a novel method to reproducibly isolate saltmarsh scarps and platforms from a DEM. Field observations and numerical models show that saltmarshes mature into sub-horizontal platforms delineated by sub-vertical scarps: based on this premise, we identify scarps as lines of local maxima on a slope*relief raster, then fill landmasses from the scarps upward, thus isolating mature marsh platforms. Non-dimensional search parameters allow batch-processing of data without recalibration. We test our method using lidar-derived DEMs of six saltmarshes in England with varying tidal ranges and geometries, for which topographic platforms were manually isolated from tidal flats. Agreement between manual and automatic segregation exceeds 90% for resolutions of 1m, with all but one sites maintaining this performance for resolutions up to 3.5m. For resolutions of 1m, automatically detected platforms are comparable in surface area and elevation distribution to digitised platforms. We also find that our method allows the accurate detection of local bloc failures 3 times larger than the DEM resolution.Detailed inspection reveals that although tidal creeks were digitised as part of the marsh platform, automatic detection classifies them as part of the tidal flat, causing an increase in false negatives and overall platform perimeter. This suggests our method would benefit from a combination with existing creek detection algorithms. Fallen blocs and pioneer zones are inconsistently identified, particularly in macro-tidal marshes, leading to differences between digitisation and the automated method

Paper based electronics platform

KAUST Repository

Nassar, Joanna Mohammad; Sevilla, Galo Andres Torres; Hussain, Muhammad Mustafa

2017-01-01

A flexible and non-functionalized low cost paper-based electronic system platform fabricated from common paper, such as paper based sensors, and methods of producing paper based sensors, and methods of sensing using the paper based sensors

Multiscale Modeling using Molecular Dynamics and Dual Domain Material Point Method

Energy Technology Data Exchange (ETDEWEB)

Dhakal, Tilak Raj [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Theoretical Division. Fluid Dynamics and Solid Mechanics Group, T-3; Rice Univ., Houston, TX (United States)

2016-07-07

For problems involving large material deformation rate, the material deformation time scale can be shorter than the material takes to reach a thermodynamical equilibrium. For such problems, it is difficult to obtain a constitutive relation. History dependency become important because of thermodynamic non-equilibrium. Our goal is to build a multi-scale numerical method which can bypass the need for a constitutive relation. In conclusion, multi-scale simulation method is developed based on the dual domain material point (DDMP). Molecular dynamics (MD) simulation is performed to calculate stress. Since the communication among material points is not necessary, the computation can be done embarrassingly parallel in CPU-GPU platform.

Moodle vs. Social Media Platforms

DEFF Research Database (Denmark)

Gulieva, Valeria

Given the competition coming from various social media platforms, it is explored in this paper how students could be encouraged to use Moodle more proactively during their studies. Moodle is a course management system for online learning. It is designed to be a flexible template-based system, which......, known and widely used social platforms. It might be also due to the fact that students do not see the benefits in investing time and efforts in learning the new system. Another reason might be the mandatory nature of Moodle, i.e., it is imposed on students, rather than a free choice – and this might...

Design and development of college managerment platform of application for visiting abroad based on primeton software platform

Directory of Open Access Journals (Sweden)

CUI Yueping

2016-02-01

Full Text Available In the traditional mode,colleges use paper application form to apply for visiting abroad.This process is very complicated and takes a long time.What′s more,the audit results is not timely feedback,existing data cannot be shared,and the data are not easy to be calculated,etc.To solve the above problems,this paper introduces workflow engine,based on the Primeton Business Process Suite,the College Management Platform of application for visiting abroad is developed which can solve the operation and monitoring issues of application and review processes.Meanwhile,several elements in designing flow chart is stated combining with the platform,which include:branch,polymerization,participants,work items.After development and on-line use,it is proved that the platform can reduce labor costs,improve software quality,enhance the user experience,and effectively improve the efficiency of various departments.

Sequential development of platform to off-platform facies of the great American carbonate bank in the central Appalachians: chapter 15

Science.gov (United States)

Brezinski, David K.; Taylor, John F.; Repetski, John E.

2012-01-01

In the central Appalachians, carbonate deposition of the great American carbonate bank began during the Early Cambrian with the creation of initial ramp facies of the Vintage Formation and lower members of the Tomstown Formation. Vertical stacking of bioturbated subtidal ramp deposits (Bolivar Heights Member) and dolomitized microbial boundtsone (Fort Duncan Member) preceded the initiation of platform sedimentation and creation of sand shoal facies (Benevola Member) that was followed by the development of peritidal cyclicity (Daragan Member). Initiation of peritidal deposition coincided with the development of a rimmed platform that would persist throughout much of the Cambrian and Early Odrovician. At the end of deposition of the Waynesboro Formation, the platform became subaerially exposed because of the Hawke Bay regression, bringing the Sauk I supersequence to and end. In the Conestoga Valley of eastern Pennsylvania, Early Cambrian ramp deposition was succeeded by deposition of platform-margin and periplatfrom facies of the Kinzers Formation.

Murine pluripotent stem cells derived scaffold-free cartilage grafts from a micro-cavitary hydrogel platform.

Science.gov (United States)

He, Pengfei; Fu, Jiayin; Wang, Dong-An

2016-04-15

By means of appropriate cell type and scaffold, tissue-engineering approaches aim to construct grafts for cartilage repair. Pluripotent stem cells especially induced pluripotent stem cells (iPSCs) are of promising cell candidates due to the pluripotent plasticity and abundant cell source. We explored three dimensional (3D) culture and chondrogenesis of murine iPSCs (miPSCs) on an alginate-based micro-cavity hydrogel (MCG) platform in pursuit of fabricating synthetic-scaffold-free cartilage grafts. Murine embryonic stem cells (mESCs) were employed in parallel as the control. Chondrogenesis was fulfilled using a consecutive protocol via mesoderm differentiation followed by chondrogenic differentiation; subsequently, miPSC and mESC-seeded constructs were further respectively cultured in chondrocyte culture (CC) medium. Alginate phase in the constructs was then removed to generate a graft only comprised of induced chondrocytic cells and cartilaginous extracellular matrix (ECMs). We found that from the mESC-seeded constructs, formation of intact grafts could be achieved in greater sizes with relatively fewer chondrocytic cells and abundant ECMs; from miPSC-seeded constructs, relatively smaller sized cartilaginous grafts could be formed by cells with chondrocytic phenotype wrapped by abundant and better assembled collagen type II. This study demonstrated successful creation of pluripotent stem cells-derived cartilage/chondroid graft from a 3D MCG interim platform. By the support of materials and methodologies established from this study, particularly given the autologous availability of iPSCs, engineered autologous cartilage engraftment may be potentially fulfilled without relying on the limited and invasive autologous chondrocytes acquisition. In this study, we explored chondrogenic differentiation of pluripotent stem cells on a 3D micro-cavitary hydrogel interim platform and creation of pluripotent stem cells-derived cartilage/chondroid graft via a consecutive

Rheem: Enabling Multi-Platform Task Execution

KAUST Repository

Agrawal, Divy; Kruse, Sebastian; Ouzzani, Mourad; Papotti, Paolo; Quiane-Ruiz, Jorge-Arnulfo; Tang, Nan; Zaki, Mohammed J.; Ba, Lamine; Berti-Equille, Laure; Chawla, Sanjay; Elmagarmid, Ahmed; Hammady, Hossam; Idris, Yasser; Kaoudi, Zoi; Khayyat, Zuhair

2016-01-01

Many emerging applications, from domains such as healthcare and oil & gas, require several data processing systems for complex analytics. This demo paper showcases Rheem, a framework that provides multi-platform task execution for such applications. It features a three-layer data processing abstraction and a new query optimization approach for multi-platform settings. We will demonstrate the strengths of Rheem by using real-world scenarios from three different applications, namely, machine learning, data cleaning, and data fusion. © 2016 ACM.

Rheem: Enabling Multi-Platform Task Execution

KAUST Repository

Agrawal, Divy

2016-06-16

Many emerging applications, from domains such as healthcare and oil & gas, require several data processing systems for complex analytics. This demo paper showcases Rheem, a framework that provides multi-platform task execution for such applications. It features a three-layer data processing abstraction and a new query optimization approach for multi-platform settings. We will demonstrate the strengths of Rheem by using real-world scenarios from three different applications, namely, machine learning, data cleaning, and data fusion. © 2016 ACM.

The Prodiguer Messaging Platform

Science.gov (United States)

Denvil, S.; Greenslade, M. A.; Carenton, N.; Levavasseur, G.; Raciazek, J.

2015-12-01

CONVERGENCE is a French multi-partner national project designed to gather HPC and informatics expertise to innovate in the context of running French global climate models with differing grids and at differing resolutions. Efficient and reliable execution of these models and the management and dissemination of model output are some of the complexities that CONVERGENCE aims to resolve.At any one moment in time, researchers affiliated with the Institut Pierre Simon Laplace (IPSL) climate modeling group, are running hundreds of global climate simulations. These simulations execute upon a heterogeneous set of French High Performance Computing (HPC) environments. The IPSL's simulation execution runtime libIGCM (library for IPSL Global Climate Modeling group) has recently been enhanced so as to support hitherto impossible realtime use cases such as simulation monitoring, data publication, metrics collection, simulation control, visualizations … etc. At the core of this enhancement is Prodiguer: an AMQP (Advanced Message Queue Protocol) based event driven asynchronous distributed messaging platform. libIGCM now dispatches copious amounts of information, in the form of messages, to the platform for remote processing by Prodiguer software agents at IPSL servers in Paris. Such processing takes several forms: Persisting message content to database(s); Launching rollback jobs upon simulation failure; Notifying downstream applications; Automation of visualization pipelines; We will describe and/or demonstrate the platform's: Technical implementation; Inherent ease of scalability; Inherent adaptiveness in respect to supervising simulations; Web portal receiving simulation notifications in realtime.

AZTLAN platform: Mexican platform for analysis and design of nuclear reactors

International Nuclear Information System (INIS)

Gomez T, A. M.; Puente E, F.; Del Valle G, E.; Francois L, J. L.; Martin del Campo M, C.; Espinosa P, G.

2014-10-01

The Aztlan platform Project is a national initiative led by the Instituto Nacional de Investigaciones Nucleares (ININ) which brings together the main public houses of higher studies in Mexico, such as: Instituto Politecnico Nacional, Universidad Nacional Autonoma de Mexico and Universidad Autonoma Metropolitana in an effort to take a significant step toward the calculation autonomy and analysis that seeks to place Mexico in the medium term in a competitive international level on software issues for analysis of nuclear reactors. This project aims to modernize, improve and integrate the neutron, thermal-hydraulic and thermo-mechanical codes, developed in Mexican institutions, within an integrated platform, developed and maintained by Mexican experts to benefit from the same institutions. This project is financed by the mixed fund SENER-CONACYT of Energy Sustain ability, and aims to strengthen substantially to research institutions, such as educational institutions contributing to the formation of highly qualified human resources in the area of analysis and design of nuclear reactors. As innovative part the project includes the creation of a user group, made up of members of the project institutions as well as the Comision Nacional de Seguridad Nuclear y Salvaguardias, Central Nucleoelectrica de Laguna Verde (CNLV), Secretaria de Energia (Mexico) and Karlsruhe Institute of Technology (Germany) among others. This user group will be responsible for using the software and provide feedback to the development equipment in order that progress meets the needs of the regulator and industry; in this case the CNLV. Finally, in order to bridge the gap between similar developments globally, they will make use of the latest super computing technology to speed up calculation times. This work intends to present to national nuclear community the project, so a description of the proposed methodology is given, as well as the goals and objectives to be pursued for the development of the

Advances in product family and product platform design methods & applications

CERN Document Server

Jiao, Jianxin; Siddique, Zahed; Hölttä-Otto, Katja

2014-01-01

Advances in Product Family and Product Platform Design: Methods & Applications highlights recent advances that have been made to support product family and product platform design and successful applications in industry. This book provides not only motivation for product family and product platform design—the “why” and “when” of platforming—but also methods and tools to support the design and development of families of products based on shared platforms—the “what”, “how”, and “where” of platforming. It begins with an overview of recent product family design research to introduce readers to the breadth of the topic and progresses to more detailed topics and design theory to help designers, engineers, and project managers plan, architect, and implement platform-based product development strategies in their companies. This book also: Presents state-of-the-art methods and tools for product family and product platform design Adopts an integrated, systems view on product family and pro...

Modal shapes optimization and feasibility analysis of NFAL platform

Directory of Open Access Journals (Sweden)

Bin WEI

2017-08-01

Full Text Available In order to avoid friction and scratching between the conveyor and the precision components when conveying object, an compact non-contact acoustic levitation prototype is designed, and the feasibility is theoretically and experimentally verified. The symmetry model is established through kinetic analysis with ANSYS. The modal and the coupled field computation at the central point of the transfer platform are simulated. The simulation results show that pure flexural or mixed flexural wave shapes appear with different wave numbers on the platform. Sweep frequency test is conducted on the compact platform prototype. The levitation experimental results confirm the feasibility of the ultrasound transfer process, the levitation frequency range and the mode of vibration. The theoretical and experimental results show that the optimal design of the modal and the carrying capacity of the driving platform is necessary according to different conditions. The research results provide a reference for the design of the mode and bandwidth of the ultrasonic levitation platform.

Demand for online platforms for medical word-of-mouth.

Science.gov (United States)

Lin, Shih Han; Lin, Tom M Y

2018-05-01

The choice of medical services affects an individual's treatment and health. However, few studies have focused on medical electronic word-of-mouth (eWOM), which has the greatest impact on such choices. This study was performed to explore the need for and general public's attitude toward medical eWOM and provide a reference for government, media, and medical practitioners. In this study, 84% of the respondents had experience using online evaluation platforms to search for eWOM, and those who were satisfied with the online evaluation platforms substantially outnumbered those who were dissatisfied. The respondents generally believed that there is a need for physician evaluation platforms, although a difference remained between respondents who needed the online evaluation platforms (72.0%) and were willing to reference them (72.0%) and those who trusted them (46.5%) and were willing to provide their opinions (55.0%). These results could signify that despite the public's need, the public remains doubtful of the information provided by these online evaluation platforms.

Licensing experience with SPINLINE digital I/C platform - 15099

International Nuclear Information System (INIS)

Jegou, H.; Duthou, A.; Bach, J.; Burzynski, M.

2015-01-01

Rolls-Royce recently received a safety evaluation report from the NRC for the SPINLINE 3 digital safety instrumentation and control platform. The main Rolls-Royce interest in the NRC review was approval of the fail-safe, fault-tolerance, self-monitoring, deterministic, and communication independence features of the platform. The SPINLINE 3 platform consists of a set of standardized, modular hardware and software components and associated development tools. Rolls-Royce used a set of EPRI guidance documents to successfully develop a commercial grade dedication case of the platform. It was important to describe the technical critical characteristics for performance and dependability in the documentation submitted to NRC. The NRC audit forum was an important opportunity to effectively communicate complex technical information about the SPINLINE 3 platform. The NRC review had five interesting focus areas that offer opportunities for lessons learned. The main lesson learned is to put the same emphasis on the review for communication effectiveness as is put on the review for technical completeness and accuracy

Vertical Wave Impacts on Offshore Wind Turbine Inspection Platforms

DEFF Research Database (Denmark)

Bredmose, Henrik; Jacobsen, Niels Gjøl

2011-01-01

Breaking wave impacts on a monopile at 20 m depth are computed with a VOF (Volume Of Fluid) method. The impacting waves are generated by the second-order focused wave group technique, to obtain waves that break at the position of the monopile. The subsequent impact from the vertical run-up flow...... on a horizontal inspection platform is computed for five different platform levels. The computational results show details of monopile impact such as slamming pressures from the overturning wave front and the formation of run-up flow. The results show that vertical platform impacts can occur at 20 m water depth....... The dependence of the vertical platform load to the platform level is discussed. Attention is given to the significant downward force that occur after the upward force associated with the vertical impact. The effect of the numerical resolution on the results is assessed. The position of wave overturning is found...

Researching intimacy through social media: A cross-platform approach

Directory of Open Access Journals (Sweden)

Cristina Miguel

2016-06-01

Full Text Available This paper aims to contribute to the understanding of how to study the way people build intimacy and manage privacy through social media interaction. It explores the research design and methodology of a research project based on a multi-sited case study composed of three different social media platforms: Badoo, CouchSurfing, and Facebook. This cross-platform approach is useful to observe how intimacy is often negotiated across different platforms. The research project focuses on the cities of Leeds (UK and Barcelona (Spain. In particular, this article discusses the methods used to recruit participants and collect data for that study - namely, participant observation, semi-structured interviews, and user profiles analysis. This cross-platform approach and multi-method research design is helpful to investigate the nature of intimacy practices facilitated by social media at several levels: online/offline, across different platforms, among different types of relationships, within both new and existing relationships, and in different locations

Creating Math Videos: Comparing Platforms and Software

Science.gov (United States)

Abbasian, Reza O.; Sieben, John T.

2016-01-01

In this paper we present a short tutorial on creating mini-videos using two platforms--PCs and tablets such as iPads--and software packages that work with these devices. Specifically, we describe the step-by-step process of creating and editing videos using a Wacom Intuos pen-tablet plus Camtasia software on a PC platform and using the software…

Systems Biology Modeling of the Radiation Sensitivity Network: A Biomarker Discovery Platform

International Nuclear Information System (INIS)

Eschrich, Steven; Zhang Hongling; Zhao Haiyan; Boulware, David; Lee, Ji-Hyun; Bloom, Gregory; Torres-Roca, Javier F.

2009-01-01

Purpose: The discovery of effective biomarkers is a fundamental goal of molecular medicine. Developing a systems-biology understanding of radiosensitivity can enhance our ability of identifying radiation-specific biomarkers. Methods and Materials: Radiosensitivity, as represented by the survival fraction at 2 Gy was modeled in 48 human cancer cell lines. We applied a linear regression algorithm that integrates gene expression with biological variables, including ras status (mut/wt), tissue of origin and p53 status (mut/wt). Results: The biomarker discovery platform is a network representation of the top 500 genes identified by linear regression analysis. This network was reduced to a 10-hub network that includes c-Jun, HDAC1, RELA (p65 subunit of NFKB), PKC-beta, SUMO-1, c-Abl, STAT1, AR, CDK1, and IRF1. Nine targets associated with radiosensitization drugs are linked to the network, demonstrating clinical relevance. Furthermore, the model identified four significant radiosensitivity clusters of terms and genes. Ras was a dominant variable in the analysis, as was the tissue of origin, and their interaction with gene expression but not p53. Overrepresented biological pathways differed between clusters but included DNA repair, cell cycle, apoptosis, and metabolism. The c-Jun network hub was validated using a knockdown approach in 8 human cell lines representing lung, colon, and breast cancers. Conclusion: We have developed a novel radiation-biomarker discovery platform using a systems biology modeling approach. We believe this platform will play a central role in the integration of biology into clinical radiation oncology practice.

NADIM-Travel: A Multiagent Platform for Travel Services Aggregation

OpenAIRE

Ben Ameur, Houssein; Bédard, François; Vaucher, Stéphane; Kropf, Peter; Chaib-draaa, Brahim; Gérin-Lajoie, Robert

2010-01-01

With the Internet as a growing channel for travel services distribution, sophisticated travel services aggregators are increasingly in demand. A travel services aggregation platform should be able to manage the heterogeneous characteristics of the many existing travel services. It should also be as scalable, robust, and flexible as possible. Using multiagent technology, we designed and implemented a multiagent platform for travel services aggregation called NADIM-Travel. In this platform, a p...

Research and development of common DAQ platform

International Nuclear Information System (INIS)

Higuchi, T.; Igarashi, Y.; Nakao, M.; Suzuki, S.Y.; Tanaka, M.; Nagasaka, Y.; Varner, G.

2003-01-01

The upgrade of the KEKB accelerator toward L=10 35 cm -2 s -1 requires an upgrade of the Belle data acquisition system. To match the market trend, we develop a DAQ platform based on the PCI bus that enables fastest DAQ with longer lifetime of the system. The platform is a VME-9U motherboard comprising of four slots for signal digitization modules and three PMC slots to house CPU for data compression. The platform is equipped with event FIFOs for data buffering to minimize the dead-time. A trigger module residing on VME-6U size rear board is connected to the 9U board via PCI-PCI bridge to make an interrupt for the CPU upon the level-1 trigger. (author)

Acoustic Signature Monitoring and Management of Naval Platforms

NARCIS (Netherlands)

Basten, T.G.H.; Jong, C.A.F. de; Graafland, F.; Hof, J. van 't

2015-01-01

Acoustic signatures make naval platforms susceptible to detection by threat sensors. The variable operational conditions and lifespan of a platform cause variations in the acoustic signature. To deal with these variations, a real time signature monitoring capability is being developed, with advisory

Gesture therapy: an upper limb virtual reality-based motor rehabilitation platform.

Science.gov (United States)

Sucar, Luis Enrique; Orihuela-Espina, Felipe; Velazquez, Roger Luis; Reinkensmeyer, David J; Leder, Ronald; Hernández-Franco, Jorge

2014-05-01

Virtual reality platforms capable of assisting rehabilitation must provide support for rehabilitation principles: promote repetition, task oriented training, appropriate feedback, and a motivating environment. As such, development of these platforms is a complex process which has not yet reached maturity. This paper presents our efforts to contribute to this field, presenting Gesture Therapy, a virtual reality-based platform for rehabilitation of the upper limb. We describe the system architecture and main features of the platform and provide preliminary evidence of the feasibility of the platform in its current status.

Study on concept of web-based reactor piping design data platform

International Nuclear Information System (INIS)

Wang Yu; Zhou Yu; Dong Jianling; Meng Yang

2005-01-01

For solving the piping design problems such as design data deficiency, designer communication inconvenience and design project inconsistence, Reactor Piping Design Database Platform, which is the main part of the Integrated Nuclear Project Research Platform, is proposed by analyzing the nuclear piping designs in detail. The functions and system structures of the platform are described in the paper for the sake of the realization of the Reactor Piping Design Database Platform. The platform is constituted by web-based management interface, AutoPlant selected as CAD software, and relation database management system (DBMS). (authors)

Towards multi-platform software architecture for Collaborative Teleoperation

Science.gov (United States)

Domingues, Christophe; Otmane, Samir; Davesne, Frederic; Mallem, Malik

2009-03-01

Augmented Reality (AR) can provide to a Human Operator (HO) a real help in achieving complex tasks, such as remote control of robots and cooperative teleassistance. Using appropriate augmentations, the HO can interact faster, safer and easier with the remote real world. In this paper, we present an extension of an existing distributed software and network architecture for collaborative teleoperation based on networked human-scaled mixed reality and mobile platform. The first teleoperation system was composed by a VR application and a Web application. However the 2 systems cannot be used together and it is impossible to control a distant robot simultaneously. Our goal is to update the teleoperation system to permit a heterogeneous collaborative teleoperation between the 2 platforms. An important feature of this interface is based on the use of different Virtual Reality platforms and different Mobile platforms to control one or many robots.

Towards multi-platform software architecture for Collaborative Teleoperation

International Nuclear Information System (INIS)

Domingues, Christophe; Otmane, Samir; Davesne, Frederic; Mallem, Malik

2009-01-01

Augmented Reality (AR) can provide to a Human Operator (HO) a real help in achieving complex tasks, such as remote control of robots and cooperative teleassistance. Using appropriate augmentations, the HO can interact faster, safer and easier with the remote real world. In this paper, we present an extension of an existing distributed software and network architecture for collaborative teleoperation based on networked human-scaled mixed reality and mobile platform. The first teleoperation system was composed by a VR application and a Web application. However the 2 systems cannot be used together and it is impossible to control a distant robot simultaneously. Our goal is to update the teleoperation system to permit a heterogeneous collaborative teleoperation between the 2 platforms. An important feature of this interface is based on the use of different Virtual Reality platforms and different Mobile platforms to control one or many robots.

Aero-hydro-elastic simulation platform for wave energy systems and floating wind turbines