WorldWideScience

Sample records for plate scanner aps

  1. Calibration and equivalency analysis of image plate scanners

    Energy Technology Data Exchange (ETDEWEB)

    Williams, G. Jackson, E-mail: williams270@llnl.gov; Maddox, Brian R.; Chen, Hui [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, California 94550 (United States); Kojima, Sadaoki [Institute of Laser Engineering, Osaka University, Yamada-oka, 2-6, Suita, Osaka 565-0871 (Japan); Millecchia, Matthew [Laboratory for Laser Energetics, University of Rochester, 250 East River Road, Rochester, New York 14623 (United States)

    2014-11-15

    A universal procedure was developed to calibrate image plate scanners using radioisotope sources. Techniques to calibrate scanners and sources, as well as cross-calibrate scanner models, are described to convert image plate dosage into physical units. This allows for the direct comparison of quantitative data between any facility and scanner. An empirical relation was also derived to establish sensitivity response settings for arbitrary gain settings. In practice, these methods may be extended to any image plate scanning system.

  2. Quality of Plate Copies Digitized with a Commercially Available Scanner

    Science.gov (United States)

    Strelnitski, V.; Davis, A.

    2004-12-01

    Digitization of all the (ca. 8,000) 8"x10" plates of the Maria Mitchell Observatory's plate collection with the commercially available scanner AgfaScan T5000 took about 1.5 years. Scanning these plates with the same nominal resolution (10-20 microns) using one of the best astronomical digital microdensitometers would be about 8 times longer, and, correspondingly, 8 times more expensive. Such a fast job may raise doubts in the quality of the scans. We show, by comparison with the control scans obtained with the STScI's GAMMA laser microdensitometer, that the additional random errors for stellar photometry introduced by AgfaScan T5000 are, typically, less than 0.05 mag, and that this scanner does not produce any detectable additional astrometric errors. This project was supported by the NSF/REU grant AST-0354056 and the Nantucket Maria Mitchell Association.

  3. A modified commercial scanner as an image plate for table-top optical applications

    Energy Technology Data Exchange (ETDEWEB)

    Casado-Rojo, S; Lorenzana, H E; Baonza, V G

    2008-12-09

    A reliable, accurate, and inexpensive optical detector for table-top applications is described here. Based on a commercial high resolution office scanner coupled to a projection on plate, it enables a large image plate surface, allowing recording of large images without systematic errors associated to coupling optics' aberrations. Several tests on distance-dependent and steady interference patterns will be presented and discussed. The extension to other types of optical measurement by substituting the projection on plate is proposed.

  4. X-ray modulation transfer functions of photostimulable phosphor image plates and scanners.

    Science.gov (United States)

    Seely, John F; Holland, Glenn E; Hudson, Lawrence T; Henins, Albert

    2008-11-01

    The modulation transfer functions of two types of photostimulable phosphor image plates were determined in the 10 keV to 50 keV x-ray energy range using a resolution test pattern with up to 10 line pairs per mm (LP/mm) and a wavelength dispersive x-ray spectrometer. Techniques were developed for correcting for the partial transmittance of the high energy x rays through the lead bars of the resolution test pattern, and the modulation transfer function (MTF) was determined from the measured change in contrast with LP/mm values. The MTF was convolved with the slit function of the image plate scanner, and the resulting point spread functions (PSFs) were in good agreement with the observed shapes and widths of x-ray spectral lines and with the PSF derived from edge spread functions. The shapes and the full width at half-maximum (FWHM) values of the PSF curves of the Fuji Superior Resolution (SR) and Fuji Maximum Sensitivity (MS) image plate detectors, consisting of the image plate and the scanner, determined by the three methods gave consistent results: The SR PSF is Gaussian with 0.13 mm FWHM, and the MS PSF is Lorentzian with 0.19 mm FWHM. These techniques result in the accurate determination of the spatial resolution achievable using image plate and scanner combinations and enable the optimization of spatial resolution for x-ray spectroscopy and radiography.

  5. Ultra-compact imaging plate scanner module using a MEMS mirror and specially designed MPPC

    Science.gov (United States)

    Miyamoto, Yuichi; Sasaki, Kensuke; Takasaka, Masaomi; Fujimoto, Masatoshi; Yamamoto, Koei

    2017-02-01

    Computed radiography (CR), which is one of the most useful methods for dental imaging and nondestructive testing, uses a phosphor imaging plate (IP) because it is flexible, reusable, and inexpensive. Conventional IP scanners utilize a galvanometer or a polygon mirror as a scanning device and a photomultiplier as an optical sensor. Microelectromechanical systems (MEMS) technology currently provides silicon-based devices and has the potential to replace such discrete devices and sensors. Using these devices, we constructed an ultra-compact IP scanner. Our extremely compact plate scanner utilizes a module that is composed of a one-dimensional MEMS mirror and a long multi-pixel photon counter (MPPC) that is combined with a specially designed wavelength filter and a rod lens. The MEMS mirror, which is a non-resonant electromagnetic type, is 2.6 mm in diameter with a recommended optical scanning angle up to +/-15°. The CR's wide dynamic range is maintained using a newly developed MPPC. The MPPC is a sort of silicon photomultiplier and is a high-sensitivity photon-counting device. To achieve such a wide dynamic range, we developed a long MPPC that has over 10,000 pixels. For size reduction and high optical efficiency, we set the MPPC close to an IP across the rod lens. To prevent the MPPC from detecting excitation light, which is much more intense than photo-stimulated light, we produced a sharp-cut wavelength filter that has a wide angle (+/-60°) of tolerance. We evaluated our constructed scanner module through gray chart and resolution chart images.

  6. Cross-calibration of Fuji TR image plate and RAR 2492 x-ray film to determine the response of a DITABIS Super Micron image plate scanner

    Science.gov (United States)

    Dunham, G.; Harding, E. C.; Loisel, G. P.; Lake, P. W.; Nielsen-Weber, L. B.

    2016-11-01

    Fuji TR image plate is frequently used as a replacement detector medium for x-ray imaging and spectroscopy diagnostics at NIF, Omega, and Z facilities. However, the familiar Fuji BAS line of image plate scanners is no longer supported by the industry, and so a replacement scanning system is needed. While the General Electric Typhoon line of scanners could replace the Fuji systems, the shift away from photo stimulated luminescence units to 16-bit grayscale Tag Image File Format (TIFF) leaves a discontinuity when comparing data collected from both systems. For the purposes of quantitative spectroscopy, a known unit of intensity applied to the grayscale values of the TIFF is needed. The DITABIS Super Micron image plate scanning system was tested and shown to potentially rival the resolution and dynamic range of Kodak RAR 2492 x-ray film. However, the absolute sensitivity of the scanner is unknown. In this work, a methodology to cross calibrate Fuji TR image plate and the absolutely calibrated Kodak RAR 2492 x-ray film is presented. Details of the experimental configurations used are included. An energy dependent scale factor to convert Fuji TR IP scanned on a DITABIS Super Micron scanner from 16-bit grayscale TIFF to intensity units (i.e., photons per square micron) is discussed.

  7. Cross-calibration of Fuji TR image plate and RAR 2492 x-ray film to determine the response of a DITABIS Super Micron image plate scanner

    Energy Technology Data Exchange (ETDEWEB)

    Dunham, G., E-mail: gsdunha@sandia.gov; Harding, E. C.; Loisel, G. P.; Lake, P. W.; Nielsen-Weber, L. B. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2016-11-15

    Fuji TR image plate is frequently used as a replacement detector medium for x-ray imaging and spectroscopy diagnostics at NIF, Omega, and Z facilities. However, the familiar Fuji BAS line of image plate scanners is no longer supported by the industry, and so a replacement scanning system is needed. While the General Electric Typhoon line of scanners could replace the Fuji systems, the shift away from photo stimulated luminescence units to 16-bit grayscale Tag Image File Format (TIFF) leaves a discontinuity when comparing data collected from both systems. For the purposes of quantitative spectroscopy, a known unit of intensity applied to the grayscale values of the TIFF is needed. The DITABIS Super Micron image plate scanning system was tested and shown to potentially rival the resolution and dynamic range of Kodak RAR 2492 x-ray film. However, the absolute sensitivity of the scanner is unknown. In this work, a methodology to cross calibrate Fuji TR image plate and the absolutely calibrated Kodak RAR 2492 x-ray film is presented. Details of the experimental configurations used are included. An energy dependent scale factor to convert Fuji TR IP scanned on a DITABIS Super Micron scanner from 16-bit grayscale TIFF to intensity units (i.e., photons per square micron) is discussed.

  8. Cross-calibration of Fuji TR image plate and RAR 2492 x-ray film to determine the response of a DITABIS Super Micron image plate scanner.

    Science.gov (United States)

    Dunham, G; Harding, E C; Loisel, G P; Lake, P W; Nielsen-Weber, L B

    2016-11-01

    Fuji TR image plate is frequently used as a replacement detector medium for x-ray imaging and spectroscopy diagnostics at NIF, Omega, and Z facilities. However, the familiar Fuji BAS line of image plate scanners is no longer supported by the industry, and so a replacement scanning system is needed. While the General Electric Typhoon line of scanners could replace the Fuji systems, the shift away from photo stimulated luminescence units to 16-bit grayscale Tag Image File Format (TIFF) leaves a discontinuity when comparing data collected from both systems. For the purposes of quantitative spectroscopy, a known unit of intensity applied to the grayscale values of the TIFF is needed. The DITABIS Super Micron image plate scanning system was tested and shown to potentially rival the resolution and dynamic range of Kodak RAR 2492 x-ray film. However, the absolute sensitivity of the scanner is unknown. In this work, a methodology to cross calibrate Fuji TR image plate and the absolutely calibrated Kodak RAR 2492 x-ray film is presented. Details of the experimental configurations used are included. An energy dependent scale factor to convert Fuji TR IP scanned on a DITABIS Super Micron scanner from 16-bit grayscale TIFF to intensity units (i.e., photons per square micron) is discussed.

  9. Astrometry with "Carte du Ciel" plates, San Fernando zone. I. Digitization and measurement using a flatbed scanner

    CERN Document Server

    Vicente, B; Garzón, F

    2007-01-01

    We present an original method of digitizing and astrometrically reducing "Carte du Ciel" plate material using an inexpensive flatbed scanner, to demonstrate that for this material there is an alternative to more specialized measuring machines that are very few in number and thus not readily available. The sample of plates chosen to develop this method are original "Carte du Ciel" plates of the San Fernando zone, photographic material with a mean epoch 1903.6, and a limiting photographic magnitude ~14.5, covering the declination range of -10 < dec < -2. Digitization has been made using a commercial flatbed scanner, demonstrating the internal precision that can be attained with such a device. A variety of post-scan corrections are shown to be necessary. In particular, the large distortion introduced by the non-uniform action of the scanner is modelled using multiple scans of each plate. We also tackle the specific problems associated with the triple-exposure images on some plates and the grid lines presen...

  10. The Multichannel Deflection Plates Control System for the ALF Facility at the APS

    CERN Document Server

    Deriy, Boris

    2005-01-01

    A deflection plate control system was developed as part of SPIRIT (Single Photon Ionization / Resonant Ionization to Threshold), a new secondary neutral mass spectrometry (SNMS) instrument that uses tunable vacuum ultraviolet light from the ALF (Argonne Linear Free-electron laser) facility at the APS for postionization. The system comprises a crate controller with PC104 embedded computer, 32 amplifiers, and two 1-kV power supplies. Thirty-two D/A converters are used to control voltages at the deflection plates within ± 400 V with 100-mV resolution. An algorithm of simultaneous sweeping of up to 16 XY areas with 10-μs time resolution also has been implemented in the embedded computer. The purpose of the system is to supply potentials to various ion optical elements for electrostatic control of keV primary and secondary ion beams in this SNMS instrument. The control system is of particular value in supplying (1) bipolar potentials for steering ions, (2) multiple potentials for octupole lenses...

  11. Scanner Art

    Science.gov (United States)

    Jaworski, Joy; Murphy, Kris

    2009-01-01

    In this article, the authors describe how they incorporated environmental awareness into their art curriculum. Here, they describe a digital photography project in which their students used flatbed scanners as cameras. Their students composed their objects directly on the scanner. The lesson enabled students to realize that artists have voices…

  12. Akinola, AP Olokuntoye, BA

    African Journals Online (AJOL)

    ... ELASTIC THIN PLATE. Akinola, A.P. Olokuntoye, B.A.; Fadodun, 0.0. and Borokinm', A.S. ... 54 Akinola et al.: Analysis of Vibration Frequency in Transverselyisotropic Semilinear Elastic Thin Plate ... mathematically quite complex. The main ...

  13. Evaluating Commercial Scanners for Astronomical Image Digitization

    Science.gov (United States)

    Simcoe, R. J.

    2009-08-01

    Many organizations have been interested in understanding if commercially available scanners are adequate for scientifically useful digitization. These scanners range in price from a few hundred to a few tens of thousands of dollars (USD), often with little apparent difference in performance specifications. This paper describes why the underlying technology used in flatbed scanners tends to effectively limit resolutions to the 600-1200 dots per inch (dpi) range and how the overall system Modulation Transfer Function (MTF) can be used to evaluate the quality of the digitized data for the small feature sizes found in astronomical images. Two scanners, the Epson V750 flatbed scanner and the Nikon Cool Scan 9000ED film strip scanner, are evaluated through their Modulation Transfer Functions (MTF). The MTF of the Harvard DASCH scanner is also shown for comparison. The particular goal of this evaluation was to understand if the scanners could be used for digitizing spectral plates at the University of Toronto. The plates of primary interest were about 15 mm (5/8 inch) wide by 180 mm (7~inches) long and ˜50 mm x 80 mm (2 x 3 inches). The results of the MTF work show that the Epson scanner, despite claims of high resolution, is of limited value for scientific imaging of feature sizes below about 50 μm and therefore not a good candidate for digitizing the spectral plates and problematic for scanning direct plates. The Nikon scanner is better and, except for some frustrating limitations in its software, its performance seems to hold promise as a digitizer for spectral plates in the University of Toronto collection.

  14. Modeling of a piezoelectric micro-scanner

    CERN Document Server

    Chaehoi, A; Cornez, D; Kirk, K

    2008-01-01

    Micro-scanners have been widely used in many optical applications. The micro-scanner presented in this paper uses multimorph-type bending actuators to tilt a square plate mirror. This paper presents a complete analytical model of the piezoelectric micro-scanner. This theoretical model based on strength of material equations calculates the force generated by the multimorphs on the mirror, the profile of the structure and the angular deflection of the mirror. The proposed model, used to optimize the design of the piezoelectric silicon micro-scanner, is intended for further HDL integration, allowing in this way system level simulation and optimization.

  15. PLATE

    DEFF Research Database (Denmark)

    Kling, Joyce; Hjulmand, Lise-Lotte

    2008-01-01

    ’s level of English is sufficient for the increasing number of courses offered in English each semester. This paper addresses these concerns and describes a pilot project initiated in 2003 at CBS to gauge the overall English language proficiency of those teaching content courses in English. Through......Copenhagen Business School (CBS) finds itself needing to address the issue of English-medium instruction for its increasing number of foreign exchange and full degree students. With internationalisation as a main pillar of the institution’s agenda, there are concerns whether the teaching faculty...... the Project in Language Assessment for Teaching in English (PLATE) language professionals from CBS’s Language Center observe teachers and provide feedback using evaluation criteria from the Common European Framework for Reference (CEFR) supplemented by some additional criteria which take the LSP nature...

  16. PLATE

    DEFF Research Database (Denmark)

    Kling, Joyce; Hjulmand, Lise-Lotte

    2008-01-01

    Copenhagen Business School (CBS) finds itself needing to address the issue of English-medium instruction for its increasing number of foreign exchange and full degree students. With internationalisation as a main pillar of the institution’s agenda, there are concerns whether the teaching faculty......’s level of English is sufficient for the increasing number of courses offered in English each semester. This paper addresses these concerns and describes a pilot project initiated in 2003 at CBS to gauge the overall English language proficiency of those teaching content courses in English. Through...... the Project in Language Assessment for Teaching in English (PLATE) language professionals from CBS’s Language Center observe teachers and provide feedback using evaluation criteria from the Common European Framework for Reference (CEFR) supplemented by some additional criteria which take the LSP nature...

  17. Open magnetic resonance imaging (MRI) scanners.

    Science.gov (United States)

    Hailey, D

    2006-11-01

    (1) In most MRI scanners, the patient examination table fits inside a long cylindrical tube. Large patients cannot be accommodated, and some persons experience claustrophobic reactions. Open MRI systems, in which the patient is placed between two plates, overcome these disadvantages. (2) Open MRI scanners are widely used in health care. High-field closed MRI systems are preferred for many examinations. (3) Early versions of open MRI scanners had low magnetic field strength, gave poorer image quality than most closed systems, and required longer examination times. Newer open scanners include machines with higher magnetic field strengths and improved image quality. (4) Closed high magnetic field scanners with short magnets and wide bore tubes offer improved comfort to patients, and may be an alternative to open scanners. (5) There is interest in using open systems for intra-operative and image-guided interventions.

  18. Network Security Scanner

    OpenAIRE

    2011-01-01

    Network Security Scanner (NSS) is a tool that allows auditing and monitoring remote network computers for possible vulnerabilities, checks your network for all potential methods that a hacker might use to attack it. Network Security Scanner is a complete networking utilities package that includes a wide range of tools for network security auditing, vulnerability Auditing, scanning, monitoring and more. Network Security Scanner (NSS) is an easy to use, intuitive network security scanner that c...

  19. Colorimetric Scanner Characterisation

    Directory of Open Access Journals (Sweden)

    Jon Y. Hardeberg

    2003-12-01

    Full Text Available In this paper, methods for the colorimetric characterisation of colour scanners are proposed and evaluated. These methods apply equally to other colour image input devices such as digital cameras. The goal of our characterisation is to establish the relationship between the device-dependent colour space of the scanner and the device-independent CIELAB colour space. The scanner characterisation is based on polynomial regression techniques. Several regression schemes have been tested. The retained method consists in applying a non-linear correction to the scanner RGB values followed by a 3rd order 3D polynomial regression function directly to CIELAB space. This method gives very good results in terms of residual colour differences. This is partly due to the fact that the RMS error that is minimised in the regression corresponds to ΔE*ab which is well correlated to visual colour differences.

  20. Ghost signals in Allison emittance scanners

    Energy Technology Data Exchange (ETDEWEB)

    Stockli, Martin P.; /SNS Project, Oak Ridge /Tennessee U.; Leitner, M.; /LBL, Berkeley; Moehs, D.P.; /Fermilab; Keller, R.; /LBL, Berkeley; Welton, R.F.; /SNS Project, Oak

    2004-12-01

    For over 20 years, Allison scanners have been used to measure emittances of low-energy ion beams. We show that scanning large trajectory angles produces ghost signals caused by the sampled beamlet impacting on an electric deflection plate. The ghost signal strength is proportional to the amount of beam entering the scanner. Depending on the ions, and their velocity, the ghost signals can have the opposite or the same polarity as the main beam signals. The ghost signals cause significant errors in the emittance estimates because they appear at large trajectory angles. These ghost signals often go undetected because they partly overlap with the real signals, are mostly below the 1% level, and often hide in the noise. A simple deflection plate modification is shown to reduce the ghost signal strength by over 99%.

  1. Twisting wire scanner

    CERN Document Server

    Gharibyan, V; Krouptchenkov, I; Nölle, D; Tiessen, H; Werner, M; Wittenburg, K

    2012-01-01

    A new type of 'two-in-one' wire scanner is proposed. Recent advances in linear motors' technology make it possible to combine translational and rotational movements. This will allow to scan the beam in two perpendicular directions using a single driving motor and a special fork attached to it. Vertical or horizontal mounting will help to escape problems associated with the 45 deg scanners. Test results of the translational part with linear motors is presented.

  2. Cobalt-60 Container Scanner

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    This paper presents a special container scanner in which the radiation source is a conventional radiography 60Co projector of (100-300)×3 .7×1010Bq. With a specia l sensitive array detector, invented by Institute of Nuclear Energy Technology ( INET) of Tsinghua University and other technical innovations, t he characteristics of the 60Co scanner qualify it for use in c ontainer insp ection. Its contrast indicator (CI) and image quality indicator (IQI) for 10 0 mm steel are equal to 0.7% and 2.5%, respectively, and the steel penetration ( SP) is about 240 mm. The 60Co container scanner is much more ec onomical and more reliable than those scanners using an accelerator source. Also, its penetr ation ability is much better than that of an X-ray machine scanner. This paper p resents the system design, the main difficulties and their technical solutions, the inspection characteristics and the special features of the 60Co sc anner.

  3. Portable biochip scanner device

    Energy Technology Data Exchange (ETDEWEB)

    Perov, Alexander (Troitsk, RU); Sharonov, Alexei (Moscow, RU); Mirzabekov, Andrei D. (Darien, IL)

    2002-01-01

    A portable biochip scanner device used to detect and acquire fluorescence signal data from biological microchips (biochips) is provided. The portable biochip scanner device employs a laser for emitting an excitation beam. An optical fiber delivers the laser beam to a portable biochip scanner. A lens collimates the laser beam, the collimated laser beam is deflected by a dichroic mirror and focused by an objective lens onto a biochip. The fluorescence light from the biochip is collected and collimated by the objective lens. The fluorescence light is delivered to a photomultiplier tube (PMT) via an emission filter and a focusing lens. The focusing lens focuses the fluorescence light into a pinhole. A signal output of the PMT is processed and displayed.

  4. Biochip scanner device

    Energy Technology Data Exchange (ETDEWEB)

    Perov, Alexander (Troitsk, RU); Belgovskiy, Alexander I. (Mayfield Heights, OH); Mirzabekov, Andrei D. (Darien, IL)

    2001-01-01

    A biochip scanner device used to detect and acquire fluorescence signal data from biological microchips or biochips and method of use are provided. The biochip scanner device includes a laser for emitting a laser beam. A modulator, such as an optical chopper modulates the laser beam. A scanning head receives the modulated laser beam and a scanning mechanics coupled to the scanning head moves the scanning head relative to the biochip. An optical fiber delivers the modulated laser beam to the scanning head. The scanning head collects the fluorescence light from the biochip, launches it into the same optical fiber, which delivers the fluorescence into a photodetector, such as a photodiode. The biochip scanner device is used in a row scanning method to scan selected rows of the biochip with the laser beam size matching the size of the immobilization site.

  5. Ionization beam scanner

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    Inner structure of an ionization beam scanner, a rather intricate piece of apparatus which permits one to measure the density distribution of the proton beam passing through it. On the outside of the tank wall there is the coil for the longitudinal magnetic field, on the inside, one can see the arrangement of electrodes creating a highly homogeneous transverse electric field.

  6. Scanner calibration revisited.

    Science.gov (United States)

    Pozhitkov, Alexander E

    2010-07-01

    Calibration of a microarray scanner is critical for accurate interpretation of microarray results. Shi et al. (BMC Bioinformatics, 2005, 6, Art. No. S11 Suppl. 2.) reported usage of a Full Moon BioSystems slide for calibration. Inspired by the Shi et al. work, we have calibrated microarray scanners in our previous research. We were puzzled however, that most of the signal intensities from a biological sample fell below the sensitivity threshold level determined by the calibration slide. This conundrum led us to re-investigate the quality of calibration provided by the Full Moon BioSystems slide as well as the accuracy of the analysis performed by Shi et al. Signal intensities were recorded on three different microarray scanners at various photomultiplier gain levels using the same calibration slide from Full Moon BioSystems. Data analysis was conducted on raw signal intensities without normalization or transformation of any kind. Weighted least-squares method was used to fit the data. We found that initial analysis performed by Shi et al. did not take into account autofluorescence of the Full Moon BioSystems slide, which led to a grossly distorted microarray scanner response. Our analysis revealed that a power-law function, which is explicitly accounting for the slide autofluorescence, perfectly described a relationship between signal intensities and fluorophore quantities. Microarray scanners respond in a much less distorted fashion than was reported by Shi et al. Full Moon BioSystems calibration slides are inadequate for performing calibration. We recommend against using these slides.

  7. Scanner calibration revisited

    Directory of Open Access Journals (Sweden)

    Pozhitkov Alexander E

    2010-07-01

    Full Text Available Abstract Background Calibration of a microarray scanner is critical for accurate interpretation of microarray results. Shi et al. (BMC Bioinformatics, 2005, 6, Art. No. S11 Suppl. 2. reported usage of a Full Moon BioSystems slide for calibration. Inspired by the Shi et al. work, we have calibrated microarray scanners in our previous research. We were puzzled however, that most of the signal intensities from a biological sample fell below the sensitivity threshold level determined by the calibration slide. This conundrum led us to re-investigate the quality of calibration provided by the Full Moon BioSystems slide as well as the accuracy of the analysis performed by Shi et al. Methods Signal intensities were recorded on three different microarray scanners at various photomultiplier gain levels using the same calibration slide from Full Moon BioSystems. Data analysis was conducted on raw signal intensities without normalization or transformation of any kind. Weighted least-squares method was used to fit the data. Results We found that initial analysis performed by Shi et al. did not take into account autofluorescence of the Full Moon BioSystems slide, which led to a grossly distorted microarray scanner response. Our analysis revealed that a power-law function, which is explicitly accounting for the slide autofluorescence, perfectly described a relationship between signal intensities and fluorophore quantities. Conclusions Microarray scanners respond in a much less distorted fashion than was reported by Shi et al. Full Moon BioSystems calibration slides are inadequate for performing calibration. We recommend against using these slides.

  8. Microarray Scanner for Fluorescence Detection

    Institute of Scientific and Technical Information of China (English)

    Wang Liqiang; Lu zukang; Li Yingsheng; Zheng Xufeng

    2003-01-01

    A novel pseudo confocal microarray scanner is introduced, in which one dimension scanning is performed by a galvanometer optical scanner and a telecentric objective, another dimension scanning is performed by a stepping motor.

  9. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  10. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  11. Development of scintillation materials for PET scanners

    CERN Document Server

    Korzhik, Mikhail; Annenkov, Alexander N; Borissevitch, Andrei; Dossovitski, Alexei; Missevitch, Oleg; Lecoq, Paul

    2007-01-01

    The growing demand on PET methodology for a variety of applications ranging from clinical use to fundamental studies triggers research and development of PET scanners providing better spatial resolution and sensitivity. These efforts are primarily focused on the development of advanced PET detector solutions and on the developments of new scintillation materials as well. However Lu containing scintillation materials introduced in the last century such as LSO, LYSO, LuAP, LuYAP crystals still remain the best PET species in spite of the recent developments of bright, fast but relatively low density lanthanum bromide scintillators. At the same time Lu based materials have several drawbacks which are high temperature of crystallization and relatively high cost compared to alkali-halide scintillation materials. Here we describe recent results in the development of new scintillation materials for PET application.

  12. Laser Scanner Demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Fuss, B.

    2005-09-06

    In the Summer of 2004 a request for proposals went out to potential vendors to offer a three-dimensional laser scanner for a number of unique metrology tasks at the Stanford Linear Accelerator Center (SLAC). Specifications were established including range, accuracy, scan density, resolution and field of view in consideration of anticipated department requirements. Four vendors visited the site to present their system and they were asked to perform three unique tests with their system on a two day visit to SLAC. Two of the three tests were created to emulate real-world applications at SLAC while the third was an accuracy and resolution series of experiments. The scope of these tests is presented and some of the vendor's results are included.

  13. BEPC II wire scanner system

    Institute of Scientific and Technical Information of China (English)

    SUI Yan-Feng; WANG Lin; ZHAO Ying; YUE Jun-Hui; LI Xiao-Ping; CAO Jian-She; MA Li

    2010-01-01

    To monitor the beam profile at the end of the linac non-destructively,a wire scanner as a new diagnostic instrument was designed,manufactured and installed in 2007.Since then,several measurements have been carried out using this device.This paper describes the whole system of the wire scanner and the testing results.

  14. Pure Nano-Rotation Scanner

    Directory of Open Access Journals (Sweden)

    Moo-Yeon Lee

    2012-01-01

    Full Text Available We developed and tested a novel rotation scanner for nano resolution and accurate rotary motion about the rotation center. The scanner consists of circular hinges and leaf springs so that the parasitic error at the center of the scanner in the X and Y directions is minimized, and rotation performance is optimized. Each sector of the scanner's system was devised to have nano resolution by minimizing the parasitic errors of the rotation center that arise due to displacements other than rotation. The analytic optimal design results of the proposed scanner were verified using finite element analyses. The piezoelectric actuators were used to attain nano-resolution performances, and a capacitive sensor was used to measure displacement. A feedback controller was used to minimize the rotation errors in the rotation scanner system under practical conditions. Finally, the performance evaluation test results showed that the resonance frequency was 542 Hz, the resolution was 0.09 μrad, and the rotation displacement was 497.2 μrad. Our test results revealed that the rotation scanner exhibited accurate rotation about the center of the scanner and had good nano precision.

  15. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  16. Calibration procedure for a laser triangulation scanner with uncertainty evaluation

    Science.gov (United States)

    Genta, Gianfranco; Minetola, Paolo; Barbato, Giulio

    2016-11-01

    Most of low cost 3D scanning devices that are nowadays available on the market are sold without a user calibration procedure to correct measurement errors related to changes in environmental conditions. In addition, there is no specific international standard defining a procedure to check the performance of a 3D scanner along time. This paper aims at detailing a thorough methodology to calibrate a 3D scanner and assess its measurement uncertainty. The proposed procedure is based on the use of a reference ball plate and applied to a triangulation laser scanner. Experimental results show that the metrological performance of the instrument can be greatly improved by the application of the calibration procedure that corrects systematic errors and reduces the device's measurement uncertainty.

  17. APS and Open Access

    Science.gov (United States)

    2011-03-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review A, B, E, Focus, Letters, and X, Reviews of Modern Physics, and Physics will address your questions about publishing in this evolving environment.

  18. Intraoral 3D scanner

    Science.gov (United States)

    Kühmstedt, Peter; Bräuer-Burchardt, Christian; Munkelt, Christoph; Heinze, Matthias; Palme, Martin; Schmidt, Ingo; Hintersehr, Josef; Notni, Gunther

    2007-09-01

    Here a new set-up of a 3D-scanning system for CAD/CAM in dental industry is proposed. The system is designed for direct scanning of the dental preparations within the mouth. The measuring process is based on phase correlation technique in combination with fast fringe projection in a stereo arrangement. The novelty in the approach is characterized by the following features: A phase correlation between the phase values of the images of two cameras is used for the co-ordinate calculation. This works contrary to the usage of only phase values (phasogrammetry) or classical triangulation (phase values and camera image co-ordinate values) for the determination of the co-ordinates. The main advantage of the method is that the absolute value of the phase at each point does not directly determine the coordinate. Thus errors in the determination of the co-ordinates are prevented. Furthermore, using the epipolar geometry of the stereo-like arrangement the phase unwrapping problem of fringe analysis can be solved. The endoscope like measurement system contains one projection and two camera channels for illumination and observation of the object, respectively. The new system has a measurement field of nearly 25mm × 15mm. The user can measure two or three teeth at one time. So the system can by used for scanning of single tooth up to bridges preparations. In the paper the first realization of the intraoral scanner is described.

  19. Beam dumping ghost signals in electric sweep scanners

    Energy Technology Data Exchange (ETDEWEB)

    Stockli, M.P.; /SNS Project, Oak Ridge /Tennessee U.; Leitner, M.; /LBL, Berkeley; Moehs, D.P.; /Fermilab; Keller, R.; /LBL, Berkeley; Welton, R.F.; /SNS Project, Oak Ridge

    2004-12-01

    Over the last 20 years many labs started to use Allison scanners to measure low-energy ion beam emittances. We show that large trajectory angles produce ghost signals due to the impact of the beamlet on the electric deflection plates. The strength of the ghost signal is proportional to the amount of beam entering the scanner. Depending on the ions and their velocity, ghost signals can have the opposite polarity as the main beam signals or the same polarity. These ghost signals are easily overlooked because they partly overlap the real signals, they are mostly below the 1% level, and they are often hidden in the noise. However, they cause significant errors in emittance estimates because they are associated with large trajectory angles. The strength of ghost signals, and the associated errors, can be drastically reduced with a simple modification of the deflection plates.

  20. Nogle muligheder i scanner data

    DEFF Research Database (Denmark)

    Juhl, Hans Jørn

    2000-01-01

    I artiklen gives en diskussion af en række af de muligheder for effektivisering af marketingaktiviteter, der er til stede for såvel mærkevareudbyder som detaillist, ved udnyttelse af information fra scanner data......I artiklen gives en diskussion af en række af de muligheder for effektivisering af marketingaktiviteter, der er til stede for såvel mærkevareudbyder som detaillist, ved udnyttelse af information fra scanner data...

  1. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  2. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  3. A biaxial PZT optical scanner for pico-projector applications

    Science.gov (United States)

    Ikegami, K.; Koyama, T.; Saito, T.; Yasuda, Y.; Toshiyoshi, H.

    2015-02-01

    We report a newly developed two-dimensional MEMS optical scanner based on the ADRIP (Arc Discharge Reactive Ion-Plating) deposited piezoelectric PZT film of typical 4 μm. A circular mirror of 1.2 mm in diameter is suspended within a pair of resonant mechanism that oscillates at 25 kHz for ±12° mechanical angle with a typical voltage of 10 V. A gimbal plate including the mirror is supported with another pair of meandering suspensions to tilt the plate in the orthogonal direction at 60 Hz for the off-resonant vertical motion of ±8° mechanical. Overall power consumption of the piezoelectric actuation was 100 mW or less. As a mechanical reinforce, a rib-structure was designed on the backside of the mirror by using a structural optimization tool TOSCA to suppress the dynamic curvature to 100 nm or less. A piezoelectric sensor was also integrated in the identical PZT film after optimizing the electrode shape to pick up the mechanical angle of the scanner and to give a trigger signal to the control system. A plug-in type pico-projector optics and electronics has been assembled in a 7.5 cm × 12 cm × 5 cm volume with RGB lasers to demonstrate a HD (high definition) class image projection of 720 horizontal lines. The fundamental resonance of the entire scanner mechanism was made to be 1 kHz or higher, thereby exhibiting a compatibility with vehicle applications.

  4. High-speed two-dimensional laser scanner based on Bragg gratings stored in photothermorefractive glass.

    Science.gov (United States)

    Yaqoob, Zahid; Arain, Muzammil A; Riza, Nabeel A

    2003-09-10

    A high-speed free-space wavelength-multiplexed optical scanner with high-speed wavelength selection coupled with narrowband volume Bragg gratings stored in photothermorefractive (PTR) glass is reported. The proposed scanner with no moving parts has a modular design with a wide angular scan range, accurate beam pointing, low scanner insertion loss, and two-dimensional beam scan capabilities. We present a complete analysis and design procedure for storing multiple tilted Bragg-grating structures in a single PTR glass volume (for normal incidence) in an optimal fashion. Because the scanner design is modular, many PTR glass volumes (each having multiple tilted Bragg-grating structures) can be stacked together, providing an efficient throughput with operations in both the visible and the infrared (IR) regions. A proof-of-concept experimental study is conducted with four Bragg gratings in independent PTR glass plates, and both visible and IR region scanner operations are demonstrated.

  5. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  6. Wire Scanner Motion Control Card

    CERN Document Server

    Forde, S E

    2006-01-01

    Scientists require a certain beam quality produced by the accelerator rings at CERN. The discovery potential of LHC is given by the reachable luminosity at its interaction points. The luminosity is maximized by minimizing the beam size. Therefore an accurate beam size measurement is required for optimizing the luminosity. The wire scanner performs very accurate profile measurements, but as it can not be used at full intensity in the LHC ring, it is used for calibrating other profile monitors. As the current wire scanner system, which is used in the present CERN accelerators, has not been made for the required specification of the LHC, a new design of a wire scanner motion control card is part of the LHC wire scanner project. The main functions of this card are to control the wire scanner motion and to acquire the position of the wire. In case of further upgrades at a later stage, it is required to allow an easy update of the firmware, hence the programmable features of FPGAs will be used for this purpose. The...

  7. Aircraft Scanners = NASA Digital Aerial Scanners (TMS, TIMS, NS001): Pre 1996

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Aircraft Scanners data set contains digital imagery acquired from several multispectral scanners including NS-001 Mutispectral scanner, Daedalus thematic mapper...

  8. APS SCIENCE 2016

    Energy Technology Data Exchange (ETDEWEB)

    Fenner, Richard B. [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS)

    2017-05-01

    The Advanced Photon Source (APS) occupies an 80-acre site on the Argonne national laboratory campus, about 25 miles from downtown chicago, illinois. it shares the site with the center for nanoscale materials and the Advanced Protein characterization facility. for directions to Argonne, see http://www.anl.gov/directions-and-visitor-information. The APS, a national synchrotron radiation research facility operated by Argonne for the u.S. department of energy (doe) office of Science, provides this nation’s brightest high-energy x-ray beams for science. research by APS users extends from the center of the earth to outer space, from new information on combustion engines and microcircuits to new drugs and nanotechnologies whose scale is measured in billionths of a meter. The APS helps researchers illuminate answers to the challenges of our high-tech world, from developing new forms of energy, to sustaining our nation’s technological and economic competitiveness, to pushing back against the ravages of disease. research at the APS promises to have far-reaching

  9. A case study in scanner optimisation.

    Science.gov (United States)

    Dudley, N J; Gibson, N M

    2014-02-01

    Ultrasound scanner preset programmes are factory set or tailored to user requirements. Scanners may, therefore, have different settings for the same application, even on similar equipment in a single department. The aims of this study were: (1) to attempt to match the performance of two scanners, where one was preferred and (2) to assess differences between six scanners used for breast ultrasound within our organisation. The Nottingham Ultrasound Quality Assurance software was used to compare imaging performance. Images of a Gammex RMI 404GS test object were collected from six scanners, using default presets, factory presets and settings matched to a preferred scanner. Resolution, low contrast performance and high contrast performance were measured. The performance of two scanners was successfully matched, where one had been preferred. Default presets varied across the six scanners, three different presets being used. The most used preset differed in settings across the scanners, most notably in the use of different frequency modes. The factory preset was more consistent across the scanners, the main variation being in dynamic range (55-70 dB). Image comparisons showed significant differences, which were reduced or eliminated by adjustment of settings to match a reference scanner. It is possible to match scanner performance using the Nottingham Ultrasound Quality Assurance software as a verification tool. Ultrasound users should be aware that scanners may not behave in a similar fashion, even with apparently equivalent presets. It should be possible to harmonise presets by consensus amongst users.

  10. Compensation strategies for PET scanners with unconventional scanner geometry

    CERN Document Server

    Gundlich, B; Oehler, M

    2006-01-01

    The small animal PET scanner ClearPET®Neuro, developed at the Forschungszentrum Julich GmbH in cooperation with the Crystal Clear Collaboration (CERN), represents scanners with an unconventional geometry: due to axial and transaxial detector gaps ClearPet®Neuro delivers inhomogeneous sinograms with missing data. When filtered backprojection (FBP) or Fourier rebinning (FORE) are applied, strong geometrical artifacts appear in the images. In this contribution we present a method that takes the geometrical sensitivity into account and converts the measured sinograms into homogeneous and complete data. By this means artifactfree images are achieved using FBP or FORE. Besides an advantageous measurement setup that reduces inhomogeneities and data gaps in the sinograms, a modification of the measured sinograms is necessary. This modification includes two steps: a geometrical normalization and corrections for missing data. To normalize the measured sinograms, computed sinograms are used that describe the geometric...

  11. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  12. A New Proton CT Scanner

    CERN Document Server

    Coutrakon, G; Boi, S; Dyshkant, A; Erdelyi, B; Hedin, D; Johnson, E; Krider, J; Rykalin, V; Uzunyan, S A; Zutshi, V; Fordt, R; Sellberg, G; Rauch, J E; Roman, M; Rubinov, P; Wilson, P; Naimuddin, M

    2014-01-01

    The design, construction, and preliminary testing of a second generation proton CT scanner is presented. All current treatment planning systems at proton therapy centers use X-ray CT as the primary imaging modality for treatment planning to calculate doses to tumor and healthy tissues. One of the limitations of X-ray CT is in the conversion of X-ray attenuation coefficients to relative (proton) stopping powers, or RSP. This results in more proton range uncertainty, larger target volumes and therefore, more dose to healthy tissues. To help improve this, we present a novel scanner capable of high dose rates, up to 2~MHz, and large area coverage, 20~x~24~cm$^2$, for imaging an adult head phantom and reconstructing more accurate RSP values.

  13. Microfabrication of fiber optic scanners

    Science.gov (United States)

    Fauver, Mark; Crossman-Bosworth, Janet L.; Seibel, Eric J.

    2002-06-01

    A cantilevered optical fiber is micromachined to function as a miniature resonant opto-mechanical scanner. By driving the base of the cantilevered fiber at a resonance frequency using a piezoelectric actuator, the free end of the cantilever beam becomes a scanned light source. The fiber scanners are designed to achieve wide field-of-view (FOV) and high scan frequency. We employ a non-linearly tapered profile fiber to achieve scan amplitudes of 1 mm at scan frequencies above 20 KHz. Scan angles of over 120 degree(s) (full angle) have been achieved. Higher order modes are also employed for scanning applications that require compactness while maintaining large angular FOV. Etching techniques are used to create the non-linearly tapered sections in single mode optical fiber. Additionally, micro-lenses are fabricated on the tips of the etched fibers, with lens diameters as small as 15 microns. Such lenses are capable of reducing the divergence angle of the emitted light to 5 degree(s) (full angle), with greater reduction expected by employing novel lens shaping techniques. Microfabricated optical fiber scanners have display applications ranging from micro-optical displays to larger panoramic displays. Applications for micro-image acquisition include small barcode readers to medical endoscopes.

  14. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.

    1994-07-01

    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  15. Optimization of PET scanner geometry

    Energy Technology Data Exchange (ETDEWEB)

    Adam, Lars-Eric; Karp, J.S. [Univ. of Pennsylvania, Department of Radiology, Philadelphia, PA (United States)

    2000-12-01

    Modern positron emission tomographs (PET), when used for 3D imaging, have a wide open gantry without intra plane septa and only little shielding. In order to reduce the scatter contamination from activity inside and outside the field-of-view (FOV), and to block radiation originating from activity outside-the-FOV, we have investigated the implementation of septa and additional patient shielding on our existing whole body PET scanner. A series of Monte Carlo simulations, based on EGS4, were performed to predict the potential benefits. Our simulations include point and line sources at various radial and axial positions in the FOV of the scanner, and different sized uniform cylinders (up to 100 cm long and 50 cm in diameter). The scanner itself is based on 6 continuous NaI(Tl) crystals, an axial FOV of 25.6 cm, a ring diameter of 90 cm, and a transaxial FOV of 56 cm. The results show that septa can reduce the relative scatter fraction and effectively block radiation from outside-the-FOV, but they also reduce the sensitivity for true events, leading to a decrease of the trues-to-singles ratio that is not desirable. The use of septa is only advantageous for large objects, if the loss of true events is compensated for by increasing the injected activity. Patient shields that are mounted outside-the-FOV reduce the contamination from scattered and single events without interfering with true events. They are more effective for objects with a small diameter and less effective for objects with a large diameter. (author)

  16. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  17. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  18. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  19. Laser Scanner For Automatic Storage

    Science.gov (United States)

    Carvalho, Fernando D.; Correia, Bento A.; Rebordao, Jose M.; Rodrigues, F. Carvalho

    1989-01-01

    The automated magazines are beeing used at industry more and more. One of the problems related with the automation of a Store House is the identification of the products envolved. Already used for stock management, the Bar Codes allows an easy way to identify one product. Applied to automated magazines, the bar codes allows a great variety of items in a small code. In order to be used by the national producers of automated magazines, a devoted laser scanner has been develloped. The Prototype uses an He-Ne laser whose beam scans a field angle of 75 degrees at 16 Hz. The scene reflectivity is transduced by a photodiode into an electrical signal, which is then binarized. This digital signal is the input of the decodifying program. The machine is able to see barcodes and to decode the information. A parallel interface allows the comunication with the central unit, which is responsible for the management of automated magazine.

  20. Non-Destructive Testing Scanner

    Science.gov (United States)

    1990-01-01

    Bio-Imaging Research's technology that originated in an aerospace program has come full circle with a new aerospace adaptation called the Advanced Computed Tomography Inspection System, or ACTIS. The medical version of CT scans the human body for tumors or other abnormalities, the ACTIS system finds imperfections in aerospace structures and components, such as castings, assemblies, rocket motors and nozzles. ACTIS is described by its developer as the most versatile CT scanner available for non-destructive testing applications. ACTIS is a variable geometry system. ACTIS source and detectors can be moved closer together or farther apart to optimize the geometry for different sizes of test objects. The combination of variable geometry, three sources, and focusing detectors makes ACTIS cost effective for a broad range of applications. System can scan anything from very small turbine blades to large rocket assemblies.

  1. Combined PET/MRI scanner

    Science.gov (United States)

    Schlyer, David; Woody, Craig L.; Rooney, William; Vaska, Paul; Stoll, Sean; Pratte, Jean-Francois; O'Connor, Paul

    2007-10-23

    A combined PET/MRI scanner generally includes a magnet for producing a magnetic field suitable for magnetic resonance imaging, a radiofrequency (RF) coil disposed within the magnetic field produced by the magnet and a ring tomograph disposed within the magnetic field produced by the magnet. The ring tomograph includes a scintillator layer for outputting at least one photon in response to an annihilation event, a detection array coupled to the scintillator layer for detecting the at least one photon outputted by the scintillator layer and for outputting a detection signal in response to the detected photon and a front-end electronic array coupled to the detection array for receiving the detection signal, wherein the front-end array has a preamplifier and a shaper network for conditioning the detection signal.

  2. 3D whole body scanners revisited

    NARCIS (Netherlands)

    Daanen, H.A.M.; Haar, F.B. ter

    2013-01-01

    An overview of whole body scanners in 1998 (H.A.M. Daanen, G.J. Van De Water. Whole body scanners, Displays 19 (1998) 111-120) shortly after they emerged to the market revealed that the systems were bulky, slow, expensive and low in resolution. This update shows that new developments in sensing and

  3. Long-Range WindScanner System

    DEFF Research Database (Denmark)

    Vasiljevic, Nikola; Lea, Guillaume; Courtney, Michael

    2016-01-01

    The technical aspects of a multi-Doppler LiDAR instrument, the long-range WindScanner system, are presented accompanied by an overview of the results from several field campaigns. The long-range WindScanner system consists of three spatially-separated, scanning coherent Doppler LiDARs and a remot...

  4. Operating and maintenance manual for the HFIR production model homogeneity scanner

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, J.W.; Shipp, R.L.; Sliski, T.F.; Longaker, W.H.; Klindt, K.K.

    1984-12-01

    The fuel material in a HFIR fuel is U/sub 3/O/sub 8/ dispersed in aluminum, resembling an airfoil in cross section. To ensure uniform generation of heat within the plate, all plates must be tested (nondestructively) to determine that the U/sub 3/O/sub 8/ content is within specified limits. The HFIR homogeneity scanner developed for this purpose is a density/thickness gauge that bombards a plate with a highly collimated, 0.062-in.-diam beam of x rays and detects those transmitted through the plate. Variations in the transmitted x rays due to absorption in the fuel plate are a measure of fuel denisty. In addition to the fuel plates for HFIR, fuel plates for several other reactors, such as the Oak Ridge Research Reactor (ORR) are also checked by the homogeneity scanner by using other sets of standards. All of the other reactors have a uniform cross section. This manual describes procedures for its electronic components.

  5. Learning about Antiphospholipid Syndrome (APS)

    Science.gov (United States)

    ... other autoimmune disorders, including myasthenia gravis, Graves' disease, autoimmune hemolytic anemia, and Evan's syndrome. Top of page How is APS diagnosed? A diagnosis of APS is made based on both clinical and ... Autoimmune Related Diseases Association, Inc. [aarda.org] An organization ...

  6. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-03-04

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  7. APS Editorial Q&A: APS and Open Access

    Science.gov (United States)

    2011-04-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review C, D, Letters, and X, Physical Review Special Topics - Accelerators and Beams, Physical Review Special Topics - Physics Education Research, and Reviews of Modern Physics will address your questions about publishing in this evolving environment.

  8. A Cross-Platform Smartphone Brain Scanner

    DEFF Research Database (Denmark)

    Larsen, Jakob Eg; Stopczynski, Arkadiusz; Stahlhut, Carsten

    We describe a smartphone brain scanner with a low-costwireless 14-channel Emotiv EEG neuroheadset interfacingwith multiple mobile devices. This personal informaticssystem enables minimally invasive and continuouscapturing of brain imaging data in natural settings. Thesystem applies an inverse...

  9. Biomechanical Study of the Fixation Strength of Anteromedial Plating for Humeral Shaft Fractures

    Directory of Open Access Journals (Sweden)

    Yin-Feng Zheng

    2016-01-01

    Conclusions: Anteromedial plating was superior to anterolateral or posterior plating in all mechanical tests except in AP four-point bending fatigue tests compared to the anterolateral plating group. We can suggest that anteromedial plating is a clinically safe and effective way for humeral shaft fractures.

  10. How flatbed scanners upset accurate film dosimetry.

    Science.gov (United States)

    van Battum, L J; Huizenga, H; Verdaasdonk, R M; Heukelom, S

    2016-01-21

    Film is an excellent dosimeter for verification of dose distributions due to its high spatial resolution. Irradiated film can be digitized with low-cost, transmission, flatbed scanners. However, a disadvantage is their lateral scan effect (LSE): a scanner readout change over its lateral scan axis. Although anisotropic light scattering was presented as the origin of the LSE, this paper presents an alternative cause. Hereto, LSE for two flatbed scanners (Epson 1680 Expression Pro and Epson 10000XL), and Gafchromic film (EBT, EBT2, EBT3) was investigated, focused on three effects: cross talk, optical path length and polarization. Cross talk was examined using triangular sheets of various optical densities. The optical path length effect was studied using absorptive and reflective neutral density filters with well-defined optical characteristics (OD range 0.2-2.0). Linear polarizer sheets were used to investigate light polarization on the CCD signal in absence and presence of (un)irradiated Gafchromic film. Film dose values ranged between 0.2 to 9 Gy, i.e. an optical density range between 0.25 to 1.1. Measurements were performed in the scanner's transmission mode, with red-green-blue channels. LSE was found to depend on scanner construction and film type. Its magnitude depends on dose: for 9 Gy increasing up to 14% at maximum lateral position. Cross talk was only significant in high contrast regions, up to 2% for very small fields. The optical path length effect introduced by film on the scanner causes 3% for pixels in the extreme lateral position. Light polarization due to film and the scanner's optical mirror system is the main contributor, different in magnitude for the red, green and blue channel. We concluded that any Gafchromic EBT type film scanned with a flatbed scanner will face these optical effects. Accurate dosimetry requires correction of LSE, therefore, determination of the LSE per color channel and dose delivered to the film.

  11. A Novel Method for the Image Quality assessment of PET Scanners by Monte Carlo simulations: Effect of the scintillator

    Science.gov (United States)

    Karpetas, G. E.; Michail, C. M.; Fountos, G. P.; Kalyvas, N. I.; Valais, I. G.; Kandarakis, I. S.; Panayiotakis, G. S.

    2014-03-01

    The aim of the present study was to propose a comprehensive method for PET scanners image quality assessment, by the simulation of a thin layer chromatography (TLC) flood source with a previous validated Monte-Carlo (MC) model. The model was developed by using the GATE MC package and reconstructed images were obtained using the STIR software, with cluster computing. The PET scanner simulated was the GE Discovery-ST. The TLC source was immersed in 18F-FDG bath solution (1MBq) in order to assess image quality. The influence of different scintillating crystals on PET scanner's image quality, in terms of the MTF, the NNPS and the DQE, was investigated. Images were reconstructed by the commonly used FBP2D, FPB3DRP and the OSMAPOSL (15 subsets, 3 iterations) reprojection algorithms. The PET scanner configuration, incorporating LuAP crystals, provided the optimum MTF values in both 2D and 3DFBP whereas the corresponding configuration with BGO crystals was found with the higher MTF values after OSMAPOSL. The scanner incorporating BGO crystals were also found with the lowest noise levels and the highest DQE values after all image reconstruction algorithms. The plane source can be also useful for the experimental image quality assessment of PET and SPECT scanners in clinical practice.

  12. Uncertainty Propagation for Terrestrial Mobile Laser Scanner

    Science.gov (United States)

    Mezian, c.; Vallet, Bruno; Soheilian, Bahman; Paparoditis, Nicolas

    2016-06-01

    Laser scanners are used more and more in mobile mapping systems. They provide 3D point clouds that are used for object reconstruction and registration of the system. For both of those applications, uncertainty analysis of 3D points is of great interest but rarely investigated in the literature. In this paper we present a complete pipeline that takes into account all the sources of uncertainties and allows to compute a covariance matrix per 3D point. The sources of uncertainties are laser scanner, calibration of the scanner in relation to the vehicle and direct georeferencing system. We suppose that all the uncertainties follow the Gaussian law. The variances of the laser scanner measurements (two angles and one distance) are usually evaluated by the constructors. This is also the case for integrated direct georeferencing devices. Residuals of the calibration process were used to estimate the covariance matrix of the 6D transformation between scanner laser and the vehicle system. Knowing the variances of all sources of uncertainties, we applied uncertainty propagation technique to compute the variance-covariance matrix of every obtained 3D point. Such an uncertainty analysis enables to estimate the impact of different laser scanners and georeferencing devices on the quality of obtained 3D points. The obtained uncertainty values were illustrated using error ellipsoids on different datasets.

  13. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  14. MEMS temperature scanner: principles, advances, and applications

    Science.gov (United States)

    Otto, Thomas; Saupe, Ray; Stock, Volker; Gessner, Thomas

    2010-02-01

    Contactless measurement of temperatures has gained enormous significance in many application fields, ranging from climate protection over quality control to object recognition in public places or military objects. Thereby measurement of linear or spatially temperature distribution is often necessary. For this purposes mostly thermographic cameras or motor driven temperature scanners are used today. Both are relatively expensive and the motor drive devices are limited regarding to the scanning rate additionally. An economic alternative are temperature scanner devices based on micro mirrors. The micro mirror, attached in a simple optical setup, reflects the emitted radiation from the observed heat onto an adapted detector. A line scan of the target object is obtained by periodic deflection of the micro scanner. Planar temperature distribution will be achieved by perpendicularly moving the target object or the scanner device. Using Planck radiation law the temperature of the object is calculated. The device can be adapted to different temperature ranges and resolution by using different detectors - cooled or uncooled - and parameterized scanner parameters. With the basic configuration 40 spatially distributed measuring points can be determined with temperatures in a range from 350°C - 1000°C. The achieved miniaturization of such scanners permits the employment in complex plants with high building density or in direct proximity to the measuring point. The price advantage enables a lot of applications, especially new application in the low-price market segment This paper shows principle, setup and application of a temperature measurement system based on micro scanners working in the near infrared range. Packaging issues and measurement results will be discussed as well.

  15. Detective quantum efficiency (DQE) in PET scanners: A simulation study.

    Science.gov (United States)

    Karpetas, George E; Michail, Christos M; Fountos, George P; Kalyvas, Nektarios I; Valais, Ioannis G; Kandarakis, Ioannis S; Panayiotakis, George S

    2017-07-01

    The aim of the present study is to introduce the detective quantum efficiency (DQE) for the image quality assessment of positron emission tomography (PET) scanners. For this purpose, a thin layer chromatography (TLC) plane source was simulated using a previously validated, scanner and source geometry, Monte Carlo (MC) model. The model was developed with the Geant4 application for tomographic emission (GATE) MC package and reconstructed images obtained with the software for tomographic image reconstruction (STIR), with cluster computing. The GE Discovery ST PET scanner was simulated by using a previously validated code. A plane source consisting of a TLC plate, was simulated by a layer of silica gel on aluminum (Al) foil substrate, immersed in 18F-FDG bath solution (1MBq). Image quality was assessed in terms of the modulation transfer function (MTF) and the normalized noise power spectrum (NNPS) in order to obtain the detective quantum efficiency (DQE). MTF curves were estimated from transverse reconstructed images of the plane source, whereas the NNPS data were estimated from the corresponding coronal images. Images were reconstructed by the maximum likelihood estimation ordered subsets maximum a posteriori one step late (MLE)-OS-MAP-OSL algorithm, by using various subsets 1-21) and iterations 1-20). MTF values were found to increase up to the 12th iteration whereas remain almost constant thereafter. However, the range of the increase in the MTF is limited as the number of subsets increases. The noise levels were found to increase with the corresponding increase of both the number of iterations and subsets. The maximum NNPS value (0.517mm(2)) was observed for the 420 MLEM-equivalent iterations reconstructed image at 0cycles/mm. Finally DQE values were found to increase for spatial frequencies up to 0.038cycles/mm and to decrease thereafter with the corresponding increase in both number of iterations and subsets. The maximum DQE value (0.48 at 0.038cycles/mm) was

  16. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  17. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  18. Manually operated small envelope scanner system

    Energy Technology Data Exchange (ETDEWEB)

    Sword, Charles Keith

    2017-04-18

    A scanner system and method for acquisition of position-based ultrasonic inspection data are described. The scanner system includes an inspection probe and a first non-contact linear encoder having a first sensor and a first scale to track inspection probe position. The first sensor is positioned to maintain a continuous non-contact interface between the first sensor and the first scale and to maintain a continuous alignment of the first sensor with the inspection probe. The scanner system may be used to acquire two-dimensional inspection probe position data by including a second non-contact linear encoder having a second sensor and a second scale, the second sensor positioned to maintain a continuous non-contact interface between the second sensor and the second scale and to maintain a continuous alignment of the second sensor with the first sensor.

  19. A flexible and wearable terahertz scanner

    Science.gov (United States)

    Suzuki, D.; Oda, S.; Kawano, Y.

    2016-12-01

    Imaging technologies based on terahertz (THz) waves have great potential for use in powerful non-invasive inspection methods. However, most real objects have various three-dimensional curvatures and existing THz technologies often encounter difficulties in imaging such configurations, which limits the useful range of THz imaging applications. Here, we report the development of a flexible and wearable THz scanner based on carbon nanotubes. We achieved room-temperature THz detection over a broad frequency band ranging from 0.14 to 39 THz and developed a portable THz scanner. Using this scanner, we performed THz imaging of samples concealed behind opaque objects, breakages and metal impurities of a bent film and multi-view scans of a syringe. We demonstrated a passive biometric THz scan of a human hand. Our results are expected to have considerable implications for non-destructive and non-contact inspections, such as medical examinations for the continuous monitoring of health conditions.

  20. Characterization of the Ferrara animal PET scanner

    CERN Document Server

    Di Domenico, G; Damiani, C; Del Guerra, A; Gilardi, M C; Motta, A; Zavattini, G

    2002-01-01

    A dedicated small animal PET scanner, YAPPET, was designed and built at Ferrara University. Each detector consists of a 20x20 matrix of 2x2x30 mm sup 3 YAP:Ce finger-like crystals glued together and directly coupled to a Hamamatsu position sensitive photomultiplier. The scanner is made from four detectors positioned on a rotating gantry at a distance of 7.5 cm from the center and the field of view (FOV) is 4 cm both in the transaxial direction and in the axial direction. The system operates in 3D acquisition mode. The performance parameters of YAPPET scanner such as spatial, energy and time resolution, as well as its sensitivity and counting rate have been determined. The average spatial resolution over the whole FOV is 1.8 mm at FWHM and 4.2 mm at FWTM. The sensitivity at the center is 640 cps/mu Ci.

  1. Metal Optics For Laser Profile Scanners

    Science.gov (United States)

    Klauke, T.; Hock, F.

    1987-01-01

    Laser scanners are a valuable tool for qualitiy control in hostile hot and vibrating environments. Their high measuring speed allows time minimisation of disturbing influences. The loss of accuracy of systems due to thermal distortion could be minimised by designing mechanical-optical systems with low temperature gradients and small differences between thermal expansions of the components. For application in the forging production a laser scanner measuring in situ a series of profile lines describing the hot forging tools has been designed using aluminium for all distortion sensitive mechanical and optical components.

  2. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  3. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  4. AP2γ regulates neural and epidermal development downstream of the BMP pathway at early stages of ectodermal patterning

    Institute of Scientific and Technical Information of China (English)

    Yunbo Qiao; Yue Zhu; Nengyin Sheng; Jun Chen; Ran Tao; Qingqing Zhu; Ting Zhang; Cheng Qian; Naihe Jing

    2012-01-01

    Bone morphogenetic protein (BMP) inhibits neural specification and induces epidermal differentiation during ectodermal patterning.However,the mechanism of this process is not well understood.Here we show that AP2γ,a transcription factor activator protein (AP)-2 family member,is upregulated by BMP4 during neural differentiation of pluripotent stem cells.Knockdown of AP2γ facilitates mouse embryonic stem cell (ESC) neural fate determination and impairs epidermal differentiation,whereas AP2γ overexpression inhibits neural conversion and promotes epidermal commitment.In the early chick embryo,AP2γ is expressed in the entire epiblast before HH stage 3 and gradually shifts to the putative epidermal ectoderm during HH stage 4.In the future neural plate AP2γ inhibits excessive neural expansion and it also promotes epidermal development in the surface ectoderm.Moreover,AP2γ knockdown in ESCs and chick embryos partially rescued the neural inhibition and epidermal induction effects of BMP4.Mechanistic studies showed that BMP4 directly regulates AP2γ expression through Smad1 binding to the AP2γ promoter.Taken together,we propose that during the early stages of ectodermal patterning in the chick embryo,AP2γ acts downstream of the BMP pathway to restrict precocious neural expansion in the prospective neural plate and initiates epidermal differentiation in the future epidermal ectoderm.

  5. Dedicated PET scanners for breast imaging

    Energy Technology Data Exchange (ETDEWEB)

    Freifelder, Richard; Karp, Joel S. [University of Pennsylvania, Department of Radiology, 110 Donner, 3400 Spruce Street, Philadelphia, PA 19104 (United States)

    1997-12-01

    We have used computer simulations to compare two designs for a PET scanner dedicated to breast imaging with a whole-body PET scanner. The new designs combine high spatial resolution, high sensitivity, and good energy resolution to detect small, low-contrast masses. The detectors are position sensitive NaI(Tl) scintillators. The first design is a ring scanner surrounding the breast and the second consists of two planar detectors placed on opposite sides of the breast. We have employed standard performance measures to compare the different designs: contrast, percentage standard deviation of the background, and signal-to-noise ratios of reconstructed images. The results of the simulations show that both of the proposed designs have better lesion detectability than a whole-body scanner. The results also show that contrast is higher in the ring breast system but that the noise is lower in the planar breast system. Overall, the ring system yields images with the best signal-to-noise ratios, although the planar system offers practical advantages for imaging the breast and axilla. (author)

  6. Dedicated PET scanners for breast imaging.

    Science.gov (United States)

    Freifelder, R; Karp, J S

    1997-12-01

    We have used computer simulations to compare two designs for a PET scanner dedicated to breast imaging with a whole-body PET scanner. The new designs combine high spatial resolution, high sensitivity, and good energy resolution to detect small, low-contrast masses. The detectors are position sensitive NaI(Tl) scintillators. The first design is a ring scanner surrounding the breast and the second consists of two planar detectors placed on opposite sides of the breast. We have employed standard performance measures to compare the different designs: contrast, percentage standard deviation of the background, and signal-to-noise ratios of reconstructed images. The results of the simulations show that both of the proposed designs have better lesion detectability than a whole-body scanner. The results also show that contrast is higher in the ring breast system but that the noise is lower in the planar breast system. Overall, the ring system yields images with the best signal-to-noise ratios, although the planar system offers practical advantages for imaging the breast and axilla.

  7. Dedicated PET scanners for breast imaging

    Science.gov (United States)

    Freifelder, Richard; Karp, Joel S.

    1997-12-01

    We have used computer simulations to compare two designs for a PET scanner dedicated to breast imaging with a whole-body PET scanner. The new designs combine high spatial resolution, high sensitivity, and good energy resolution to detect small, low-contrast masses. The detectors are position sensitive NaI(Tl) scintillators. The first design is a ring scanner surrounding the breast and the second consists of two planar detectors placed on opposite sides of the breast. We have employed standard performance measures to compare the different designs: contrast, percentage standard deviation of the background, and signal-to-noise ratios of reconstructed images. The results of the simulations show that both of the proposed designs have better lesion detectability than a whole-body scanner. The results also show that contrast is higher in the ring breast system but that the noise is lower in the planar breast system. Overall, the ring system yields images with the best signal-to-noise ratios, although the planar system offers practical advantages for imaging the breast and axilla.

  8. The PS Booster Fast Wire Scanner

    CERN Document Server

    Burger, S; Priestnall, K; Raich, U

    2003-01-01

    The very tight emittance budget for LHC type beams makes precise emittance measurements in the injector complex a necessity. The PS machine uses 2 fast wire scanners per transverse plane for emittance measurement of the circulating beams. In order to ease comparison the same type of wire scanners have been newly installed in the upstream machine, the PS Booster, where each of the 4 rings is equipped with 2 wire scanners measuring the horizontal and vertical profiles. Those wire scanners use new and more modern control and readout electronics featuring dedicated intelligent motor movement controllers, which relieves the very stringent real time constraints due to the very high speed of 20m/s. In order to be able to measure primary beams at the very low injection energy of the Booster (50MeV) secondary emission currents from the wire can be measured as well as secondary particle flows at higher primary particle energies during and after acceleration. The solution adopted for the control of the devices is descri...

  9. submitter Dynamical Models of a Wire Scanner

    CERN Document Server

    Barjau, Ana; Dehning, Bernd

    2016-01-01

    The accuracy of the beam profile measurements achievable by the current wire scanners at CERN is limited by the vibrations of their mechanical parts. In particular, the vibrations of the carbon wire represent the major source of wire position uncertainty which limits the beam profile measurement accuracy. In the coming years, due to the Large Hadron Collider (LHC) luminosity upgrade, a wire traveling speed up to 20 $m s^{−1}$ and a position measurement accuracy of the order of 1 μm will be required. A new wire scanner design based on the understanding of the wire vibration origin is therefore needed. We present the models developed to understand the main causes of the wire vibrations observed in an existing wire scanner. The development and tuning of those models are based on measurements and tests performed on that CERN proton synchrotron (PS) scanner. The final model for the (wire + fork) system has six degrees-of-freedom (DOF). The wire equations contain three different excitation terms: inertia...

  10. Learning and Teaching with a Computer Scanner

    Science.gov (United States)

    Planinsic, G.; Gregorcic, B.; Etkina, E.

    2014-01-01

    This paper introduces the readers to simple inquiry-based activities (experiments with supporting questions) that one can do with a computer scanner to help students learn and apply the concepts of relative motion in 1 and 2D, vibrational motion and the Doppler effect. We also show how to use these activities to help students think like…

  11. Inter laboratory comparison of industrial CT scanners

    DEFF Research Database (Denmark)

    Angel, Jais Andreas Breusch; Cantatore, Angela; De Chiffre, Leonardo

    2012-01-01

    In this report results from an intercomparison of industrial CT scanners are presented. Three audit items, similar to common industrial parts, were selected for circulation: a single polymer part with complex geometry (Item 1), a simple geometry part made of two polymers (Item 2) and a miniature...

  12. Rail profile control using laser triangulation scanners

    Science.gov (United States)

    Boronahin, Ð. ńlexandr M.; Larionov, Daniil Yu.; Podgornaya, Liudmila N.; Shalymov, Roman V.; Filatov, Yuri V.; Bokhman, Evgueny D.

    2016-11-01

    Rail track geometric parameters measurement requires knowledge of left and right rail head location in each section. First of all displacement in transverse plane of rail head point located at a distance of 14 mm below the running surface, must be controlled [1]. It is carried out by detecting of each rail profile using triangulation laser scanners. Optical image recognition is carried out successfully in the laboratory, approaches used for this purpose are widely known. However, laser scanners operation has several features on railways leading to necessity of traditional approaches adaptation for solving these particular problems. The most significant problem is images noisiness due to the solar flashes and the effect of "Moon path" on the smooth rail surface. Using of optical filters gives inadequate result, because scanner laser diodes radiation frequency varies with temperature changes that forbid the use of narrow-band filters. Consideration of these features requires additional constructive and algorithmic solutions, including involvement of information from other sensors of the system. The specific usage of optical scanners for rail profiles control is the subject of the paper.

  13. A PET scanner developed by CERN

    CERN Multimedia

    Laurent Guiraud

    1998-01-01

    This image shows a Position Emission Tomography (PET) scanner at the Hopital Cantonal Universitaire de Genève. Development of the multiwire proportional chamber at CERN in the mid-1970s was soon seen as a potential device for medical imaging. It is much more sensitive than previous devices and greatly reduced the dose of radiation received by the patient.

  14. Occurrence and characteristics of mutual interference between LIDAR scanners

    Science.gov (United States)

    Kim, Gunzung; Eom, Jeongsook; Park, Seonghyeon; Park, Yongwan

    2015-05-01

    The LIDAR scanner is at the heart of object detection of the self-driving car. Mutual interference between LIDAR scanners has not been regarded as a problem because the percentage of vehicles equipped with LIDAR scanners was very rare. With the growing number of autonomous vehicle equipped with LIDAR scanner operated close to each other at the same time, the LIDAR scanner may receive laser pulses from other LIDAR scanners. In this paper, three types of experiments and their results are shown, according to the arrangement of two LIDAR scanners. We will show the probability that any LIDAR scanner will interfere mutually by considering spatial and temporal overlaps. It will present some typical mutual interference scenario and report an analysis of the interference mechanism.

  15. 21 CFR 892.1330 - Nuclear whole body scanner.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1330 Nuclear whole body scanner. (a) Identification. A nuclear whole body scanner is a device intended to measure and image the distribution of... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Nuclear whole body scanner. 892.1330 Section...

  16. The use of mobile 3D scanners in maxillofacial surgery.

    Science.gov (United States)

    Peters, Florian; Möhlhenrich, Stephan Christian; Ayoub, Nassim; Goloborodko, Evgeny; Ghassemi, Alireza; Lethaus, Bernd; Hölzle, Frank; Modabber, Ali

    There are many possibilities for the use of three-dimensional (3D) scanners in maxillofacial surgery. This study aimed to investigate whether the bundling and syncing of two 3D scanners has advantages over single-scanner acquisition in terms of scan quality and the time required to scan an object. Therefore, the speed and precision of 3D data acquisition with one scanner versus two synced scanners was measured in 30 subjects. This was done by analyzing the results obtained by scanning test objects attached to the forehead and cheeks of the subjects. Statistical methods included the Student t test for paired samples. Single-scanner recording resulted in significantly lower mean error of measurement than synced recording with two scanners for length (P scanner method resulted in a significantly lowermean error of measurement than the two-scanner method for frontal/lower plane angles (P scanners resulted in a significant reduction of scanning time (P 3D scanner, the bundling of two 3D scanners resulted in faster scanning times but lower scan quality.

  17. Using of scanner on the evaluation of pesticides mobility by thin-layer chromatography; Utilizacao do scanner na avaliacao da mobilidade de agrotoxicos por cromatografia de camada delgada

    Energy Technology Data Exchange (ETDEWEB)

    Tornisielo, V.L.; Costa, M.A.; Furlan, G.R. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)

    1995-12-31

    Knowledge of pesticide leaching potential is an essential information to preview environmental fate. The experiment confirms the possibility of using radiochromatogram scanning as a substitute for X-ray autoradiography, when Thin Layer Chromatografy (TLC) methodogy is used to determine mobility of a pesticide. Three types of soil from Sao Paulo state and five herbicides (metolachlor, asulan, simazing, 2,4-D and trifluralin), labeled with {sup 14} C, were used. The radiochromatogram scanners permits a quick detection of the position of the radioactive spots to determine the Rf for each pesticide, while X-ray film has to be placed on the plate on the dark room for several days or weeks and then developed to detect spots, subsequently measure and calculate Rf. The results showed that the evaluation by scanner and X-ray were similar. Hence we conclude that the use of the scanner should be considered since this methodology is faster and as accurate as the X-ray methodology. (author). 4 refs, 1 fig, 2 tabs.

  18. Validation of radiocarpal joint contact models based on images from a clinical MRI scanner.

    Science.gov (United States)

    Johnson, Joshua E; McIff, Terence E; Lee, Phil; Toby, E Bruce; Fischer, Kenneth J

    2014-01-01

    This study was undertaken to assess magnetic resonance imaging (MRI)-based radiocarpal surface contact models of functional loading in a clinical MRI scanner for future in vivo studies, by comparison with experimental measures from three cadaver forearm specimens. Experimental data were acquired using a Tekscan sensor during simulated light grasp. Magnetic resonance (MR) images were used to obtain model geometry and kinematics (image registration). Peak contact pressures (PPs) and average contact pressures (APs), contact forces and contact areas were determined in the radiolunate and radioscaphoid joints. Contact area was also measured directly from MR images acquired with load and compared with model data. Based on the validation criteria (within 25% of experimental data), out of the six articulations (three specimens with two articulations each), two met the criterion for AP (0%, 14%); one for peak pressure (20%); one for contact force (5%); four for contact area with respect to experiment (8%, 13%, 19% and 23%), and three contact areas met the criterion with respect to direct measurements (14%, 21% and 21%). Absolute differences between model and experimental PPs were reasonably low (within 2.5 MPa). Overall, the results indicate that MRI-based models generated from 3T clinical MR scanner appear sufficient to obtain clinically relevant data.

  19. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  20. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  1. Laser scanner 3D terrestri e mobile

    Directory of Open Access Journals (Sweden)

    Mario Ciamba

    2013-08-01

    Full Text Available Recentemente si è svolto a Roma un evento dimostrativo per informare, professionisti e ricercatori del settore inerente il rilievo strumentale, sulle recenti innovazioni che riguardano i laser scanner 3d. Il mercato della strumentazione dedicata al rilevamento architettonico e dell'ambiente, offre molte possibilità di scelta. Oggi i principali marchi producono strumenti sempre più efficienti ed ideati per ambiti di applicazione specifici, permettendo ai professionisti, la giusta scelta in termini di prestazioni ed economia.A demonstration event was recently held in Rome with the aim to inform professionals and researchers on recent innovations on instrumental survey related to the 3d laser scanner. The market of instrumentation for architectural survey offers many possibilitiesof choice. Today the major brands produce instruments that are more efficient and designed for specific areas of application, allowing the right choice in terms of performance and economy.

  2. Compact beamforming in medical ultrasound scanners

    DEFF Research Database (Denmark)

    Tomov, Borislav Gueorguiev

    2003-01-01

    This Ph.D. project was carried out at the Center for Fast Ultrasound Imaging, Technical University of Denmark, under the supervision of Prof. Jørgen Arendt Jensen, Assoc. Prof. Jens Sparsø and Prof. Erik Bruun. The goal was to investigate methods for efficient beamforming, which make it possible...... compact implementation of the beamformer compared to the case where conventional A/D conversion is used. The compact and economic beamforming is a key aspect in the progress of medical ultrasound imaging. Currently, 64 or 128 channels are widely used in scanners, top-of-the-range scanners have 256...... with an introduction into medical ultrasound, its basic principles, system evolution and its place among medical imaging techniques. Then, ultrasound acoustics is introduced, as a necessary base for understanding the concepts of acoustic focusing and beamforming, which follow. The necessary focusing information...

  3. Digitization and Position Measurement of Astronomical Plates of Saturnian Satellites

    Science.gov (United States)

    Yan, D.; Yu, Y.; Zhang, H. Y.; Qiao, R. C.

    2014-05-01

    Using the advanced commercial scanners to digitize astronomical plates may be a simple and effective way. In this paper, we discuss the method of digitizing and astrometrically reducing six astronomical plates of Saturnian satellites, which were taken from the 1 m RCC (Ritchey Chretien Coude) telescope of Yunnan Observatory in 1988, by using the 10000XL scanner of Epson. The digitized images of the astronomical plates of Saturnian satellites are re-reduced, and the positions of Saturnian satellites based on the UCAC2 (The Second US Naval Observatory CCD Astrograph Catalog) catalogue are given. A comparison of our measured positions with the IMCCE (Institut de Mecanique Celeste et de Calcul des Ephemerides) ephemeris of Saturnian satellites shows the high quality of our measurements, which have an accuracy of 106 mas in right ascension and 89 mas in declination. Moreover, our measurements appear to be consistent with this ephemeris within only about 56 mas in right ascension and 9 mas in declination.

  4. Get Mobile – The Smartphone Brain Scanner

    DEFF Research Database (Denmark)

    Stahlhut, Carsten; Stopczynski, Arkadiusz; Petersen, Michael Kai

    This demonstration will provide live-interaction with a smartphone brain scanner consisting of a low-cost wireless 14-channel EEG headset (Emotiv Epoc) and a mobile device. With our system it is possible to perform real-time functional brain imaging on a smartphone device, including stimulus deli......) that are based on Linux operating systems. Thus our system runs on multiple platforms, including Maemo/MeeGo based smartphones, Android-based smartphones and tablet devices....

  5. A near-infrared confocal scanner

    Science.gov (United States)

    Lee, Seungwoo; Yoo, Hongki

    2014-06-01

    In the semiconductor industry, manufacturing of three-dimensional (3D) packages or 3D integrated circuits is a high-performance technique that requires combining several functions in a small volume. Through-silicon vias, which are vertical electrical connections extending through a wafer, can be used to direct signals between stacked chips, thus increasing areal density by stacking and connecting multiple patterned chips. While defect detection is essential in the semiconductor manufacturing process, it is difficult to identify defects within a wafer or to monitor the bonding results between bonded surfaces because silicon and many other semiconductor materials are opaque to visible wavelengths. In this context, near-infrared (NIR) imaging is a promising non-destructive method to detect defects within silicon chips, to inspect bonding between chips and to monitor the chip alignment since NIR transmits through silicon. In addition, a confocal scanner provides high-contrast, optically-sectioned images of the specimen due to its ability to reject out-of-focus noise. In this study, we report an NIR confocal scanner that rapidly acquires high-resolution images with a large field of view through silicon. Two orthogonal line-scanning images can be acquired without rotating the system or the specimen by utilizing two orthogonally configured resonant scanning mirrors. This NIR confocal scanner can be efficiently used as an in-line inspection system when manufacturing semiconductor devices by rapidly detecting defects on and beneath the surface.

  6. Create Your Plate

    Medline Plus

    Full Text Available ... A A A Listen En Español Create Your Plate Create Your Plate is a simple and effective ... and that your options are endless. Create Your Plate! Click on the plate sections below to add ...

  7. Fellow's Apéro

    CERN Multimedia

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  8. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  9. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  10. Diadenosine polyphosphates Ap3A and Ap4A, but not Ap5A or Ap6A, induce proliferation of vascular smooth muscle cells.

    Science.gov (United States)

    Bobbert, Peter; Schlüter, Hartmut; Schultheiss, Heinz Peter; Reusch, Hans Peter

    2008-05-15

    Depending on the number of phosphate groups, diadenosine polyphosphates (ApnA, Ap3A, Ap4A, Ap5A and Ap6A) differ in properties such as proliferation, apoptosis, vasoconstriction and vasodilatation of vascular smooth muscle cells (VSMCs). Possible signaling pathways leading to effects such as proliferation are still unknown. This study examined the proliferative effects of diadenosine polyphosphates on VSMCs and their intracellular pathways. Proliferation of VSMCs was measured by the cell count and [(3)H] thymidine incorporation. Phosphorylation of the MAP kinases ERK1/2 was determined by Western blotting. Single-cell [Ca(2+)](i) measurements were done to determine the influence of [Ca(2+)](i) on intracellular signaling. Stress fiber formation was assessed by fluorescence microscopy to detect an influence of G alpha(12). Ap3A and Ap4A, but not Ap5A or Ap6A, were shown to increase proliferation of VSMCs by activating P2Y receptors, which leads to stimulation of the Ras-Raf-MEK-ERK1/2 cascade. Ap3A- and Ap4A-induced activation of the MAP kinases ERK1/2 was dependent on a signaling pathway that included the EGF receptor, PKC, PLCbeta and the increase of [Ca(2+)](i). In conclusion, Ap3A and Ap4A, but not Ap5A or Ap6A, induce proliferation of VSMCs by a signaling pathway that begins with activation of P2Y receptors and leads to stimulation of the MAP kinases ERK1/2.

  11. Magnetic Measurements of Storage Ring Magnets for the APS Upgrade Project

    Energy Technology Data Exchange (ETDEWEB)

    Doose, C.; Dejus, R.; Jaski, M.; Jansma, W.; Collins, J.; Donnelly, A.; Liu, J.; Cease, H.; Decker, G.; Jain, A.; DiMarco, J.

    2017-06-01

    Extensive prototyping of storage ring magnets is ongoing at the Advanced Photon Source (APS) in support of the APS Multi-Bend Achromat (MBA) upgrade project (APS-U) [1]. As part of the R&D activities four quadrupole magnets with slightly different geometries and pole tip materials, and one sextupole magnet with vanadium permendur (VP) pole tips were designed, built and tested. Magnets were measured individually using a rotating coil and a Hall probe for detailed mapping of the magnetic field. Magnets were then assembled and aligned relative to each other on a steel support plate and concrete plinth using precision machined surfaces to gain experience with the alignment method chosen for the APS-U storage ring magnets. The required alignment of magnets on a common support structure is 30 μm rms. Measurements of magnetic field quality, strength and magnet alignment after subjecting the magnets and assemblies to different tests are presented.

  12. Recent micro-CT scanner developments at UGCT

    Science.gov (United States)

    Dierick, Manuel; Van Loo, Denis; Masschaele, Bert; Van den Bulcke, Jan; Van Acker, Joris; Cnudde, Veerle; Van Hoorebeke, Luc

    2014-04-01

    This paper describes two X-ray micro-CT scanners which were recently developed to extend the experimental possibilities of microtomography research at the Centre for X-ray Tomography (www.ugct.ugent.be) of the Ghent University (Belgium). The first scanner, called Nanowood, is a wide-range CT scanner with two X-ray sources (160 kVmax) and two detectors, resolving features down to 0.4 μm in small samples, but allowing samples up to 35 cm to be scanned. This is a sample size range of 3 orders of magnitude, making this scanner well suited for imaging multi-scale materials such as wood, stone, etc. Besides the traditional cone-beam acquisition, Nanowood supports helical acquisition, and it can generate images with significant phase-contrast contributions. The second scanner, known as the Environmental micro-CT scanner (EMCT), is a gantry based micro-CT scanner with variable magnification for scanning objects which are not easy to rotate in a standard micro-CT scanner, for example because they are physically connected to external experimental hardware such as sensor wiring, tubing or others. This scanner resolves 5 μm features, covers a field-of-view of about 12 cm wide with an 80 cm vertical travel range. Both scanners will be extensively described and characterized, and their potential will be demonstrated with some key application results.

  13. Recent micro-CT scanner developments at UGCT

    Energy Technology Data Exchange (ETDEWEB)

    Dierick, Manuel, E-mail: Manuel.Dierick@UGent.be [UGCT-Department of Physics and Astronomy, Faculty of Sciences, Ghent University, Proeftuinstraat 86, 9000 Ghent (Belgium); XRE, X-Ray Engineering bvba, De Pintelaan 111, 9000 Ghent (Belgium); Van Loo, Denis, E-mail: info@XRE.be [XRE, X-Ray Engineering bvba, De Pintelaan 111, 9000 Ghent (Belgium); Masschaele, Bert [UGCT-Department of Physics and Astronomy, Faculty of Sciences, Ghent University, Proeftuinstraat 86, 9000 Ghent (Belgium); XRE, X-Ray Engineering bvba, De Pintelaan 111, 9000 Ghent (Belgium); Van den Bulcke, Jan [UGCT-Woodlab-UGent, Department of Forest and Water Management, Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, 9000 Ghent (Belgium); Van Acker, Joris, E-mail: Joris.VanAcker@UGent.be [UGCT-Woodlab-UGent, Department of Forest and Water Management, Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, 9000 Ghent (Belgium); Cnudde, Veerle, E-mail: Veerle.Cnudde@UGent.be [UGCT-SGIG, Department of Geology and Soil Science, Faculty of Sciences, Ghent University, Krijgslaan 281, S8, 9000 Ghent (Belgium); Van Hoorebeke, Luc, E-mail: Luc.VanHoorebeke@UGent.be [UGCT-Department of Physics and Astronomy, Faculty of Sciences, Ghent University, Proeftuinstraat 86, 9000 Ghent (Belgium)

    2014-04-01

    This paper describes two X-ray micro-CT scanners which were recently developed to extend the experimental possibilities of microtomography research at the Centre for X-ray Tomography ( (www.ugct.ugent.be)) of the Ghent University (Belgium). The first scanner, called Nanowood, is a wide-range CT scanner with two X-ray sources (160 kV{sub max}) and two detectors, resolving features down to 0.4 μm in small samples, but allowing samples up to 35 cm to be scanned. This is a sample size range of 3 orders of magnitude, making this scanner well suited for imaging multi-scale materials such as wood, stone, etc. Besides the traditional cone-beam acquisition, Nanowood supports helical acquisition, and it can generate images with significant phase-contrast contributions. The second scanner, known as the Environmental micro-CT scanner (EMCT), is a gantry based micro-CT scanner with variable magnification for scanning objects which are not easy to rotate in a standard micro-CT scanner, for example because they are physically connected to external experimental hardware such as sensor wiring, tubing or others. This scanner resolves 5 μm features, covers a field-of-view of about 12 cm wide with an 80 cm vertical travel range. Both scanners will be extensively described and characterized, and their potential will be demonstrated with some key application results.

  14. Positron Scanner for Locating Brain Tumors

    Science.gov (United States)

    Rankowitz, S.; Robertson, J. S.; Higinbotham, W. A.; Rosenblum, M. J.

    1962-03-01

    A system is described that makes use of positron emitting isotopes for locating brain tumors. This system inherently provides more information about the distribution of radioactivity in the head in less time than existing scanners which use one or two detectors. A stationary circular array of 32 scintillation detectors scans a horizontal layer of the head from many directions simultaneously. The data, consisting of the number of counts in all possible coincidence pairs, are coded and stored in the memory of a Two-Dimensional Pulse-Height Analyzer. A unique method of displaying and interpreting the data is described that enables rapid approximate analysis of complex source distribution patterns. (auth)

  15. A volume scanner for diffuse imaging

    Science.gov (United States)

    Vafa, Elham; Roberts, Nicolas; Sharafutdinova, Galiya; Holdsworth, John

    2016-11-01

    Non-invasive optical screening mammography has a significant barrier in the extreme scatter of human tissue at optical wavelengths. A volume scanner suited for high numerical aperture capture of scattered light from diffuse media has been designed, modelled using Trace Pro software and experimentally constructed. Modelling results indicate the presence of an embedded volume with different scatter properties from the bulk yields a measurable difference in the overall scatter pattern and intensity recorded. Work towards a full tomographic reconstruction from scattered light recorded on the two dimensional array detector is currently underway.

  16. A Cartographic Electron Beam Scanner Design Study.

    Science.gov (United States)

    1981-04-01

    0132 UNCLASSIFIED 6005 ETL-0257 NLEhmnnnnnununu lllhllIIhhlh EIIIIIIIIuuh hhhhhhhw-: o~"c ETL OVDFR U-C0EESE25SR7TINULIiE U..ARMYCOPSOFENINER ENINE ...17 2.3.4.4 Data Retrieval Process . . . . 2-21 2.3.5 Software .. ........... ... 2-25 2.4 Details of Scanner Experiments. 2-26 2.4.1 General...point processor and suitable interfaces were installed in the experimental Cartographic EBR System to provide complete compatibility with the software

  17. The Lick Observatory image-dissector scanner.

    Science.gov (United States)

    Robinson, L. B.; Wampler, E. J.

    1972-01-01

    A scanner that uses an image dissector to scan the output screen of an image tube has proven to be a sensitive and linear detector for faint astronomical spectra. The image-tube phosphor screen acts as a short-term storage element and allows the system to approach the performance of an ideal multichannel photon counter. Pulses resulting from individual photons, emitted from the output phosphor and detected by the image dissector, trigger an amplifier-discriminator and are counted in a 24-bit, 4096-word circulating memory. Aspects of system performance are discussed, giving attention to linearity, dynamic range, sensitivity, stability, and scattered light properties.

  18. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  19. Circumference estimation using 3D-whole body scanners and shadow scanner

    NARCIS (Netherlands)

    Daanen, H.A.M.

    1998-01-01

    Clothing designers and manufacturers use traditional body dimensions as their basis. When 3D-whole body scanners are introduced to determine the body dimensions, a conversion has to be made, since scan determined circumference measures are slightly larger than the traditional values. This pilot stud

  20. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  1. Antenna Near-Field Probe Station Scanner

    Science.gov (United States)

    Zaman, Afroz J. (Inventor); Lee, Richard Q. (Inventor); Darby, William G. (Inventor); Barr, Philip J. (Inventor); Lambert, Kevin M (Inventor); Miranda, Felix A. (Inventor)

    2011-01-01

    A miniaturized antenna system is characterized non-destructively through the use of a scanner that measures its near-field radiated power performance. When taking measurements, the scanner can be moved linearly along the x, y and z axis, as well as rotationally relative to the antenna. The data obtained from the characterization are processed to determine the far-field properties of the system and to optimize the system. Each antenna is excited using a probe station system while a scanning probe scans the space above the antenna to measure the near field signals. Upon completion of the scan, the near-field patterns are transformed into far-field patterns. Along with taking data, this system also allows for extensive graphing and analysis of both the near-field and far-field data. The details of the probe station as well as the procedures for setting up a test, conducting a test, and analyzing the resulting data are also described.

  2. Interferometric Laser Scanner for Direction Determination.

    Science.gov (United States)

    Kaloshin, Gennady; Lukin, Igor

    2016-01-21

    In this paper, we explore the potential capabilities of new laser scanning-based method for direction determination. The method for fully coherent beams is extended to the case when interference pattern is produced in the turbulent atmosphere by two partially coherent sources. The performed theoretical analysis identified the conditions under which stable pattern may form on extended paths of 0.5-10 km in length. We describe a method for selecting laser scanner parameters, ensuring the necessary operability range in the atmosphere for any possible turbulence characteristics. The method is based on analysis of the mean intensity of interference pattern, formed by two partially coherent sources of optical radiation. Visibility of interference pattern is estimated as a function of propagation pathlength, structure parameter of atmospheric turbulence, and spacing of radiation sources, producing the interference pattern. It is shown that, when atmospheric turbulences are moderately strong, the contrast of interference pattern of laser scanner may ensure its applicability at ranges up to 10 km.

  3. Interferometric Laser Scanner for Direction Determination

    Directory of Open Access Journals (Sweden)

    Gennady Kaloshin

    2016-01-01

    Full Text Available In this paper, we explore the potential capabilities of new laser scanning-based method for direction determination. The method for fully coherent beams is extended to the case when interference pattern is produced in the turbulent atmosphere by two partially coherent sources. The performed theoretical analysis identified the conditions under which stable pattern may form on extended paths of 0.5–10 km in length. We describe a method for selecting laser scanner parameters, ensuring the necessary operability range in the atmosphere for any possible turbulence characteristics. The method is based on analysis of the mean intensity of interference pattern, formed by two partially coherent sources of optical radiation. Visibility of interference pattern is estimated as a function of propagation pathlength, structure parameter of atmospheric turbulence, and spacing of radiation sources, producing the interference pattern. It is shown that, when atmospheric turbulences are moderately strong, the contrast of interference pattern of laser scanner may ensure its applicability at ranges up to 10 km.

  4. Recent micro-CT scanner developments at UGCT

    OpenAIRE

    Dierick, Manuel; Van Loo, Denis; Masschaele, Bert; Boone, Matthieu; Van Hoorebeke, Luc; Cnudde, Veerle

    2013-01-01

    UGCT is a user facility for multidisciplinary micro-CT research. The scanners at UGCT are custom designed and built by the Radiation Physics research group (UGent). This paper describes the two latest scanners that were developed in collaboration with XRE: HECTOR, a high energy micro-CT scanner, and EMCT, a gantry based micro-CT scanner with variable magnification. HECTOR is a 240 kV 280 W system with a nominal resolution of 4 micrometer. A 40x40 cm² flat panel detector which can be tiled res...

  5. Was the Scanner Calibration Slide used for its intended purpose?

    Science.gov (United States)

    2011-01-01

    In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response [1]. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported. PMID:21510874

  6. Was the Scanner Calibration Slide used for its intended purpose?

    Directory of Open Access Journals (Sweden)

    Zong Yaping

    2011-04-01

    Full Text Available Abstract In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response 1. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported.

  7. Consumo de antimicrobianos en APS

    Directory of Open Access Journals (Sweden)

    María Cristina Lara Bastanzuri

    2003-08-01

    Full Text Available Con el propósito de describir el patrón de uso de los medicamentos para el tratamiento con antimicrobianos en APS en Cuba en el período de 1989 al 2000, se diseñó un estudio descriptivo, observacional y retrospectivo clasificado dentro de los estudios de utilización de medicamentos como de consumo. Para ello se calcularon las dosis diarias definidas cada día de determinado fármaco de los grupos clasificados según ATC como tetraciclinas, anfenicoles, penicilinas de amplio espectro, cefalosporinas, sulfonamidas y trimetoprim, macrólidos, estreptomicinas y quinolonas. Además, se tomaron las cifras de pacientes inscriptos a penicilina benzatínica y se comparó con la población expuesta obtenida a partir de las DHD. Las penicilinas son las de mayor consumo con tendencia al aumento, igual que los aminoglucósidos, mientras que la tetraciclina presenta cifras mayores de DHD. La tendencia del cloranfenicol es a disminuir. La población expuesta está muy por debajo de los pacientes inscriptos en penicilina benzatínica y las líneas de tendencia no son similares. Excepto la docixiclina, el resto de los antimicrobianos recomendados en la Guía Terapéutica para APS se encuentran en el Listado Básico de Medicamentos del país para el nivel primario de atención médica.With the objective of describing the pattern of drug use in antimicrobial-based treatment in the primary health care in Cuba from 1989 to 2000, we designed a retrospective descriptive and observational study, classified into the study of drug use as consumption. To this end, the daily doses of certain drugs from the ATC-classified groups were calculated, which included tetracycline, amphenicols, broad spectrum penicilins, cephalosporins, sulfonamides, trimethoprim, macrolides, streptomycin and quinolones. Also, the number of patients registered as benzathine peniciline consumers was taken and compared to the exposed population data obtained from the DHD. Penicillins are the

  8. Simulation of ultrasonic lamb wave generation, propagation and detection for a reconfigurable air coupled scanner.

    Science.gov (United States)

    Dobie, Gordon; Spencer, Andrew; Burnham, Kenneth; Pierce, S Gareth; Worden, Keith; Galbraith, Walter; Hayward, Gordon

    2011-04-01

    A computer simulator, to facilitate the design and assessment of a reconfigurable, air-coupled ultrasonic scanner is described and evaluated. The specific scanning system comprises a team of remote sensing agents, in the form of miniature robotic platforms that can reposition non-contact Lamb wave transducers over a plate type of structure, for the purpose of non-destructive evaluation (NDE). The overall objective is to implement reconfigurable array scanning, where transmission and reception are facilitated by different sensing agents which can be organised in a variety of pulse-echo and pitch-catch configurations, with guided waves used to generate data in the form of 2-D and 3-D images. The ability to reconfigure the scanner adaptively requires an understanding of the ultrasonic wave generation, its propagation and interaction with potential defects and boundaries. Transducer behaviour has been simulated using a linear systems approximation, with wave propagation in the structure modelled using the local interaction simulation approach (LISA). Integration of the linear systems and LISA approaches are validated for use in Lamb wave scanning by comparison with both analytic techniques and more computationally intensive commercial finite element/difference codes. Starting with fundamental dispersion data, the paper goes on to describe the simulation of wave propagation and the subsequent interaction with artificial defects and plate boundaries, before presenting a theoretical image obtained from a team of sensing agents based on the current generation of sensors and instrumentation.

  9. Identification of scanner models by comparison of scanned hologram images.

    Science.gov (United States)

    Sugawara, Shigeru

    2014-08-01

    A method to identify scanner models that had been used to forge low-level counterfeit currencies was proposed in this study. The method identified a scanner model by characterizing differences between hologram images that exist in low-level counterfeit currencies. Twenty scanners of 18 different models were used to make samples of hologram images used in this study. The method was divided into two steps: identification of capturing conditions and identification of the scanner model. The first proposed protocol used correlations of spatial distribution of brightness to identify capturing conditions. A second proposed protocol used correlations of color distributions to identify a scanner model. The effectiveness of the protocols was demonstrated with numerical methods and sample images. The preliminary study revealed that it is necessary to consider the orientation of the holograms when the scanner models were identified, but 180° rotations can be ignored. Moreover, it is necessary to consider position in the main scanning direction of the bed for charged-coupled-device scanners. The demonstration showed that the first protocol could correctly identify the capturing conditions of almost all hologram images. However, one image could not be identified correctly; the protocol could distinguish images captured by charged-coupled-device scanners and those captured by contact image sensor scanners if the hologram was placed on the right or left edge of the scanner bed, but could not distinguish them if the hologram was placed on the inside. The demonstration also showed that the second protocol could correctly identify scanner models of all hologram images.

  10. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  11. Gigapixel microscopy using a flatbed scanner

    CERN Document Server

    Zheng, Guoan; Yang, Changhuei

    2012-01-01

    Microscopy imaging systems with a very wide field-of-view (FOV) are highly sought in biomedical applications. In this paper, we report a wide FOV microscopy imaging system that uses a low-cost scanner and a closed-circuit-television (CCTV) lens. We show that such an imaging system is capable to capture a 10 mm * 7.5 mm FOV image with 0.77 micron resolution, resulting in 0.54 gigapixels (109 pixels) across the entire image (26400 pixels * 20400 pixels). The resolution and field curve of the proposed system were characterized by imaging a USAF resolution target and a hole-array target. A 1.6 gigapixel microscopy image (0.54 gigapixel with 3 colors) of a pathology slide was acquired by using such a system for application demonstration.

  12. Vision Assisted Laser Scanner Navigation for Autonomous Robots

    DEFF Research Database (Denmark)

    Andersen, Jens Christian; Andersen, Nils Axel; Ravn, Ole

    2008-01-01

    This paper describes a navigation method based on road detection using both a laser scanner and a vision sensor. The method is to classify the surface in front of the robot into traversable segments (road) and obstacles using the laser scanner, this classifies the area just in front of the robot ...

  13. Convenient integrating sphere scanner for accurate luminous flux measurements

    Science.gov (United States)

    Winter, S.; Lindemann, M.; Jordan, W.; Binder, U.; Anokhin, M.

    2009-08-01

    Measurement results and applications of a recently developed device for the measurement of the spatial uniformity of integrating spheres are presented. Due to the complexity of their implementation, sphere scanners are mainly used by national metrology institutes to increase the accuracy of relative and absolute luminous flux measurements (Ohno et al 1997 J. IES 26 107-14, Ohno and Daubach 2001 J. IES 30 105-15, Ohno 1998 Metrologia 35 473-8, Hovila et al 2004 Metrologia 41 407-13). The major drawback of traditional scanners for integrating spheres is the necessity of a complex and time-consuming sphere modification, as the lamp holder has to be replaced by a new scanner holder with additional cables for power supply and for communication with the stepping motor control unit (Ohno et al 1997 J. IES 26 107-14). Therefore, with traditional scanners the relative spatial sphere responsivity already changes due to the installation of a special scanner holder. The new scanner simply substitutes the lamp under test: it can be screwed into an E27 lamp socket, as it needs only two electrical contacts. Two wires are simultaneously used for the power supply of the stepping motor control unit, the scanner light source (LED) and for the signal transmission of commands and results. The benefits of scanner-assisted measurements are shown for spotlight lamp calibrations.

  14. Verification of a CT scanner using a miniature step gauge

    DEFF Research Database (Denmark)

    Cantatore, Angela; Andreasen, J.L.; Carmignato, S.;

    2011-01-01

    The work deals with performance verification of a CT scanner using a 42mm miniature replica step gauge developed for optical scanner verification. Errors quantification and optimization of CT system set-up in terms of resolution and measurement accuracy are fundamental for use of CT scanning...

  15. Quantitative Assay for Starch by Colorimetry Using a Desktop Scanner

    Science.gov (United States)

    Matthews, Kurt R.; Landmark, James D.; Stickle, Douglas F.

    2004-01-01

    The procedure to produce standard curve for starch concentration measurement by image analysis using a color scanner and computer for data acquisition and color analysis is described. Color analysis is performed by a Visual Basic program that measures red, green, and blue (RGB) color intensities for pixels within the scanner image.

  16. Thermionic scanner pinpoints work function of emitter surfaces

    Science.gov (United States)

    Rasor, N. S.

    1966-01-01

    In the electron tube testing, a thermionic scanner makes accurate spatial resolution measurements of the metallic surface work functions of emitters. The scanner determines the emitter function and its local departures from the mean value on a point-by-point basis for display on an oscilloscope.

  17. Flux profile scanners for scattered high-energy electrons

    Science.gov (United States)

    Hicks, R. S.; Decowski, P.; Arroyo, C.; Breuer, M.; Celli, J.; Chudakov, E.; Kumar, K. S.; Olson, M.; Peterson, G. A.; Pope, K.; Ricci, J.; Savage, J.; Souder, P. A.

    2005-11-01

    The paper describes the design and performance of flux integrating Cherenkov scanners with air-core reflecting light guides used in a high-energy, high-flux electron scattering experiment at the Stanford Linear Accelerator Center. The scanners were highly radiation resistant and provided a good signal to background ratio leading to very good spatial resolution of the scattered electron flux profile scans.

  18. A ’Millipede’ scanner model - Energy consumption and performance

    NARCIS (Netherlands)

    Engelen, Johan B.C.; Khatib, Mohammed G.

    2008-01-01

    This short report (1) describes an energy model for the seek and read/write operations in a mass-balanced Y-scanner for parallel-probe storage by IBM [1] and (2) updates the settings of the MEMS model in DiskSim with recent published figures from this XY-scanner. To speedup system simulations, a str

  19. Study of PET scanner designs using clinical metrics to optimize the scanner axial FOV and crystal thickness

    Science.gov (United States)

    Surti, S.; Werner, M. E.; Karp, J. S.

    2013-06-01

    The aim of this study is to understand the trade-off between crystal thickness and scanner axial field-of-view FOV (AFOV) for clinical PET imaging. Clinical scanner design has evolved towards 20-25 mm thick crystals and 16-22 cm long scanner AFOV, as well as time-of-flight (TOF) imaging. While Monte Carlo studies demonstrate that longer AFOV and thicker crystals will lead to higher scanner sensitivity, cost has prohibited the building of commercial scanners with >22 cm AFOV. In this study, we performed a series of system simulations to optimize the use of a given amount of crystal material by evaluating the impact on system sensitivity and noise equivalent counts (NEC), as well as image quality in terms of lesion detectability. We evaluated two crystal types (LSO and LaBr3) and fixed the total crystal volume used for each type (8.2 L of LSO and 17.1 L of LaBr3) while varying the crystal thickness and scanner AFOV. In addition, all imaging times were normalized so that the total scan time needed to scan a 100 cm long object with multiple bed positions was kept constant. Our results show that the highest NEC cm-1 in a 35 cm diameter ×70 cm long line source cylinder is achieved for an LSO scanner with 10 mm long crystals and AFOV of 36 cm, while for LaBr3 scanners, the highest NEC cm-1 is obtained with 20 mm long crystals and an AFOV of 38 cm. Lesion phantom simulations show that the best lesion detection performance is achieved in scanners with long AFOV (≥36 cm) and using thin crystals (≤10 mm of LSO and ≤20 mm of LaBr3). This is due to a combination of improved NEC, as well as improved lesion contrast estimation due to better spatial resolution in thinner crystals. Alternatively, for lesion detection performance similar to that achieved in standard clinical scanner designs, the long AFOV scanners can be used to reduce the total scan time without increasing the amount of crystal used in the scanner. In addition, for LaBr3 based scanners, the reduced lesion

  20. On the spectral quality of scanner illumination with LEDs

    Science.gov (United States)

    Cui, Chengwu

    2013-01-01

    Document scanner illumination has evolved along with general illumination technologies. LEDs have become more and more popular as the illumination sources for document scanning. LED technologies provide a wide range of choices both in terms of structural design and spectral compositions. In this report, we examine some popular LED technologies used for document scanner. We evaluate the color rendering performance of scanner models with different illumination technologies by examining their rendering of the Macbeth ColorChecker™ in sRGB. We found that more phosphors in phosphor conversion types of white LEDs may not be necessarily advantageous in terms of scanner color rendering performance. Also CIS type of scanner may be sensitive to the peak wavelength shift and can be particularly problematic when the peaks are out of certain range.

  1. Ultra-Miniature Lidar Scanner for Launch Range Data Collection

    Science.gov (United States)

    Geng, Jason

    2012-01-01

    The most critical component in lidar is its laser scanner, which delivers pulsed or CW laser to target with desirable field of view (FOV). Most existing lidars use a rotating or oscillating mirror for scanning, resulting in several drawbacks. A lidar scanning technology was developed that could achieve very high scanning speed, with an ultra-miniature size and much lighter weight. This technology promises at least a 10x performance improvement in these areas over existing lidar scanners. Features of the proposed ultra-miniature lidar scanner include the ability to make the entire scanner <2 mm in diameter; very high scanning speed (e.g. 5 - 20 kHz, in contrast to several hundred Hz in existing scanners); structure design to meet stringent requirements on size, weight, power, and compactness for various applications; and the scanning speed and FOV can be altered for obtaining high image resolutions of targeted areas and for diversified uses.

  2. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  3. Processless offset printing plates

    Directory of Open Access Journals (Sweden)

    Sanja Mahović Poljaček

    2015-06-01

    Full Text Available With the implementation of platesetters in the offset printing plate making process, imaging of the printing plate became more stable and ensured increase of the printing plate quality. But as the chemical processing of the printing plates still highly influences the plate making process and the graphic reproduction workflow, development of printing plates that do not require chemical processing for offset printing technique has been one of the top interests in graphic technology in the last few years. The main reason for that came from the user experience, where majority of the problems with plate making process could be connected with the chemical processing of the printing plate. Furthermore, increased environmental standards lead to reducing of the chemicals used in the industrial processes. Considering these facts, different types of offset printing plates have been introduced to the market today. This paper presents some of the processless printing plates.

  4. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2016-09-14

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  5. APLIKASI INFO HALAL MENGGUNAKAN BARCODE SCANNER UNTUK SMARTPHONE ANDROID

    Directory of Open Access Journals (Sweden)

    Beki Subeki

    2016-05-01

    Full Text Available Abstract – In the production and trade of food products in the era of globalization, people are consuming, especially Muslims need to be given the knowledge, information and access to adequate in order to obtain the correct information about the halal status of products bought. The use of barcode scanners halal product information using the mobile platform is effective and useful for the public to find out information on a product. Barcode scanners can be read by optical scanners called barcode readers or scanned from an image by special software. In Indonesia, most mobile phones have the scanning software for 2D codes, and similar devices available via smartphone.   Keywords : Barcode Scanner, Mobile Platform, Halal Products, Smartphone     Abstrak - Dalam kegiatan produksi dan perdagangan produk pangan di era globalisasi ini, masyarakat yang mengkonsumsi, khususnya umat islam perlu diberikan pengetahuan tentang kehalalan produk, informasi dan akses yang memadai agar memperoleh informasi yang benar tentang status kehalalan produk yang dibelinya. Penggunaan barcode scanner informasi produk halal dengan menggunakan mobile platform dinilai cukup efektif dan berguna bagi masyarakat luas untuk mengetahui informasi sebuah produk. Barcode scanner dapat dibaca oleh pemindai optik yang disebut pembaca kode batang atau dipindai dari sebuah gambar oleh perangkat lunak khusus. Di Indonesia, kebanyakan telepon genggam memiliki perangkat lunak pemindai untuk kode 2D, dan perangkat sejenis tersedia melalui smartphone.   Kata Kunci: Barcode Scanner, Mobile Platform, Produk Halal, Smartphone

  6. AP1000{sup TM} plant modularization

    Energy Technology Data Exchange (ETDEWEB)

    Cantarero L, C.; Demetri, K. J. [Westinghouse Electric Co., 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States); Quintero C, F. P., E-mail: cantarc@westinghouse.com [Westinghouse Electric Spain, Padilla 17, 28006 Madrid (Spain)

    2016-09-15

    The AP1000{sup TM} plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  7. Peculiar Traits of Coarse AP (Briefing Charts)

    Science.gov (United States)

    2014-12-01

    Self Combustion 3 Thom L. Boggs Parallel ridges and valley surfaces seen at 1000 to 1500 psi Isolated AP vertical needle pockets at 1500 and 1800 psi...Negative exponents, bouncing flamlets between 2000 to 4000 psi Extremely irregular AP surface regression Hightower and Price 16 Air Force Research...supported by vertical gas jetlets from active centers? Did Boggs burn a few samples at 1000 to 2000 psi with orthorhombic main axis normal to

  8. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  9. Flatbed scanners as a source of imaging. Brightness assessment and additives determination in a nickel electroplating bath.

    Science.gov (United States)

    Vidal, M; Amigo, J M; Bro, R; Ostra, M; Ubide, C; Zuriarrain, J

    2011-05-23

    Desktop flatbed scanners are very well-known devices that can provide digitized information of flat surfaces. They are practically present in most laboratories as a part of the computer support. Several quality levels can be found in the market, but all of them can be considered as tools with a high performance and low cost. The present paper shows how the information obtained with a scanner, from a flat surface, can be used with fine results for exploratory and quantitative purposes through image analysis. It provides cheap analytical measurements for assessment of quality parameters of coated metallic surfaces and monitoring of electrochemical coating bath lives. The samples used were steel sheets nickel-plated in an electrodeposition bath. The quality of the final deposit depends on the bath conditions and, especially, on the concentration of the additives in the bath. Some additives become degraded with the bath life and so is the quality of the plate finish. Analysis of the scanner images can be used to follow the evolution of the metal deposit and the concentration of additives in the bath. Principal component analysis (PCA) is applied to find significant differences in the coating of sheets, to find directions of maximum variability and to identify odd samples. The results found are favorably compared with those obtained by means of specular reflectance (SR), which is here used as a reference technique. Also the concentration of additives SPB and SA-1 along a nickel bath life can be followed using image data handled with algorithms such as partial least squares (PLS) regression and support vector regression (SVR). The quantitative results obtained with these and other algorithms are compared. All this opens new qualitative and quantitative possibilities to flatbed scanners.

  10. Confocal Scanner for Vertical Particle Tracks in the Nuclear Photoemulsion

    CERN Document Server

    Soroko, L M

    2005-01-01

    A confocal scanner for selective observation of the vertical particle tracks in the nuclear photoemulsion is described. The particle track being searched for is imaging at an angle of 45$^\\circ$ with respect to the optical axis of the system. The confocal scanner is provided with a new optical element, an "image hogonalizator", by means of which the extended image of the inclined vertical particle track is rotated over an angle of 90$^\\circ$. The stereoscopic version of the confocal scanner is presented as well. The described systems will be used in the experiments for investigation of the neutrino oscillations in the accelerators experiments.

  11. A general solution for the registration of optical multispectral scanners

    Science.gov (United States)

    Rader, M. L.

    1974-01-01

    The paper documents a general theory for registration (mapping) of data sets gathered by optical scanners such as the ERTS satellite MSS and the Skylab S-192 MSS. This solution is generally applicable to scanners which have rotating optics. Navigation data and ground control points are used in a statistically weighted adjustment based on a mathematical model of the dynamics of the spacecraft and the scanner system. This adjustment is very similar to the well known photogrammetric adjustments used in aerial mapping. Actual tests have been completed on NASA aircraft 24 channel MSS data, and the results are very encouraging.

  12. [Innovation and Future Technologies for PET Scanners].

    Science.gov (United States)

    Yamaya, Taiga

    2015-01-01

    Positron emission tomography (PET) plays important roles in cancer diagnosis, neuroimaging and molecular imaging research; but potential points remain for which big improvements could be made, including spatial resolution, sensitivity and manufacturing costs. Higher spatial resolution is essential to enable earlier diagnosis, and improved sensitivity results in reduced radiation exposure and shortened measurement time. Therefore, research on next generation PET technologies remains a hot topic worldwide. In this paper, innovation and future technologies for the next generation PET scanners, such as time-of-flight measurement and simultaneous PET/MRI measurement, are described. Among them, depth-of-interaction (DOI) measurement in the radiation sensor will be a key technology to get any significant improvement in sensitivity while maintaining high spatial resolution. DOI measurement also has a potential to expand PET application fields because it allows for more flexible detector arrangement. As an example, the world's first, open-type PET geometry "OpenPET", which is expected to lead to PET imaging during treatment, is under development. The DOI detector itself continues to evolve with the help of recently developed semiconductor photodetectors, often referred to as silicon photomultipliers.

  13. Fast and High Accuracy Wire Scanner

    CERN Document Server

    Koujili, M; Koopman, J; Ramos, D; Sapinski, M; De Freitas, J; Ait Amira, Y; Djerdir, A

    2009-01-01

    Scanning of a high intensity particle beam imposes challenging requirements on a Wire Scanner system. It is expected to reach a scanning speed of 20 m.s-1 with a position accuracy of the order of 1 μm. In addition a timing accuracy better than 1 millisecond is needed. The adopted solution consists of a fork holding a wire rotating by a maximum of 200°. Fork, rotor and angular position sensor are mounted on the same axis and located in a chamber connected to the beam vacuum. The requirements imply the design of a system with extremely low vibration, vacuum compatibility, radiation and temperature tolerance. The adopted solution consists of a rotary brushless synchronous motor with the permanent magnet rotor installed inside of the vacuum chamber and the stator installed outside. The accurate position sensor will be mounted on the rotary shaft inside of the vacuum chamber, has to resist a bake-out temperature of 200°C and ionizing radiation up to a dozen of kGy/year. A digital feedback controller allows maxi...

  14. Whole-body 35-GHz security scanner

    Science.gov (United States)

    Appleby, Roger; Anderton, Rupert N.; Price, Sean; Sinclair, Gordon N.; Coward, Peter R.

    2004-08-01

    A 35GHz imager designed for Security Scanning has been previously demonstrated. That imager was based on a folded conical scan technology and was constructed from low cost materials such as expanded polystyrene and printed circuit board. In conjunction with an illumination chamber it was used to collect indoor imagery of people with weapons and contraband hidden under their clothing. That imager had a spot size of 20mm and covered a field of view of 20 x 10 degrees that partially covered the body of an adult from knees to shoulders. A new variant of this imager has been designed and constructed. It has a field of view of 36 x 18 degrees and is capable of covering the whole body of an adult. This was achieved by increasing the number of direct detection receivers from the 32 used in the previous design to 58, and by implementing an improved optical design. The optics consist of a front grid, a polarisation device which converts linear to circular polarisation and a rotating scanner. This new design uses high-density expanded polystyrene as a correcting element on the back of the front grid. This gives an added degree of freedom that allows the optical design to be diffraction limited over a very wide field of view. Obscuration by the receivers and associated components is minimised by integrating the post detection electronics at the receiver array.

  15. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  16. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  17. 21 CFR 892.1300 - Nuclear rectilinear scanner.

    Science.gov (United States)

    2010-04-01

    ...) Identification. A nuclear rectilinear scanner is a device intended to image the distribution of radionuclides in the body by means of a detector (or detectors) whose position moves in two directions with respect...

  18. Whole-body 3D scanner and scan data report

    Science.gov (United States)

    Addleman, Stephen R.

    1997-03-01

    With the first whole-body 3D scanner now available the next adventure confronting the user is what to do with all of the data. While the system was built for anthropologists, it has created interest among users from a wide variety of fields. Users with applications in the fields of anthropology, costume design, garment design, entertainment, VR and gaming have a need for the data in formats unique to their fields. Data from the scanner is being converted to solid models for art and design and NURBS for computer graphics applications. Motion capture has made scan data move and dance. The scanner has created a need for advanced application software just as other scanners have in the past.

  19. Landsat 1-5 Multispectral Scanner V1

    Data.gov (United States)

    National Aeronautics and Space Administration — Abstract: The Landsat Multispectral Scanner (MSS) was a sensor onboard Landsats 1 through 5 and acquired images of the Earth nearly continuously from July 1972 to...

  20. APLIKASI INFO HALAL MENGGUNAKAN BARCODE SCANNER UNTUK SMARTPHONE ANDROID

    National Research Council Canada - National Science Library

    Beki Subeki; M Rahmat Jauhari

    2016-01-01

    ... to obtain the correct information about the halal status of products bought. The use of barcode scanners halal product information using the mobile platform is effective and useful for the public to find out information on a product...

  1. Building a 3D Computed Tomography Scanner From Surplus Parts.

    Science.gov (United States)

    Haidekker, Mark A

    2014-01-01

    Computed tomography (CT) scanners are expensive imaging devices, often out of reach for small research groups. Designing and building a CT scanner from modular components is possible, and this article demonstrates that realization of a CT scanner from components is surprisingly easy. However, the high costs of a modular X-ray source and detector limit the overall cost savings. In this article, the possibility of building a CT scanner with available surplus X-ray parts is discussed, and a practical device is described that incurred costs of less than $16,000. The image quality of this device is comparable with commercial devices. The disadvantage is that design constraints imposed by the available components lead to slow scan speeds and a resolution of 0.5 mm. Despite these limitations, a device such as this is attractive for imaging studies in the biological and biomedical sciences, as well as for advancing CT technology itself.

  2. Fret Replica Inspection Laser Scanner (FRILS)

    Energy Technology Data Exchange (ETDEWEB)

    Kretz, S.; Hanley, K., E-mail: steve.kretz@opg.com, E-mail: kelly.hanley@opg.com [Ontario Power Generation, Inspection Maintenance and Commercial Services, Pickering, Ontario (Canada)

    2008-07-01

    In the stress analysis of flaws and artifacts found in pressure tubes, it is crucial to have detailed knowledge of the flaw geometry. Fuel channel inspections by ultrasonic or eddy current inspection methods alone cannot provide the complete required geometry information. Replicas, which are a negative impression of surface pressure tube indications, are scanned with a laser system which will provide the additional detail required. FRILS was initially developed in 1993 to establish in-house capability of profiling indications on the inside diameter surface of pressure tubes. The need of this profiling was initially a response to the discovery of fuel bundle bearing pad fretting (FBBPF) caused by flow induced fuel bundle vibration. The benefits of the system were soon realized as a tool for profiling debris type indications. Although the primary use of FRILS is to profile FBBBF and Debris Fretting, since its inception the FRILS inspection system has become an instrumental tool in flaw assessment for: Fuel Bundle Bearing Pad Frets (FBBPF); Debris Frets; Scratches; Crevice Corrosion; Oxide Jacking; Areas of surface roughness; and, Weld Profiling. Replicas are collected via acquisition from tooling on both the Channel and Gauging Apparatus for Reactors (CIGAR) and the Advanced Non-Destructive Examination (ANDE) systems. The ANDE system is a high speed data acquisition system which includes both an ultrasonic inspection tool and a replication tool. Although both of these tools were designed to be delivered with the UDM, the platform for these tools was built with flexibility allowing for adoption to other delivery systems. These tools were based on the experience of the CIGAR inspection system. The CIGAR system has also undergone many system upgrades resulting in reduced inspection times. The FRILS system - Fret Replication Inspection Laser Scanner system was developed and has been upgraded to meet the demands of the improved inspection and replication systems. FRILS

  3. Computer vision and laser scanner road environment perception

    OpenAIRE

    García, Fernando; Ponz Vila, Aurelio; Martín Gómez, David; Escalera, Arturo de la; Armingol, José M.

    2014-01-01

    Data fusion procedure is presented to enhance classical Advanced Driver Assistance Systems (ADAS). The novel vehicle safety approach, combines two classical sensors: computer vision and laser scanner. Laser scanner algorithm performs detection of vehicles and pedestrians based on pattern matching algorithms. Computer vision approach is based on Haar-Like features for vehicles and Histogram of Oriented Gradients (HOG) features for pedestrians. The high level fusion procedure uses Kalman Filter...

  4. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W

    2012-01-01

    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  5. Create Your Plate

    Medline Plus

    Full Text Available ... steps to get started: Using your dinner plate, put a line down the middle of the plate. ... vegetables . Now in one of the small sections, put grains and starchy foods. See this list of ...

  6. Create Your Plate

    Medline Plus

    Full Text Available ... Your Plate It's simple and effective for both managing diabetes and losing weight. Creating your plate lets ... 2016 Articles from Diabetes Forecast® magazine: wcie-meal-planning, In this section Food Planning Meals Diabetes Meal ...

  7. Create Your Plate

    Medline Plus

    Full Text Available ... Your Plate Gluten Free Diets Meal Planning for Vegetarian Diets Cook with Heart-Healthy Foods Holiday Meal ... Healthy Diet Create Your Plate Meal Planning for Vegetarian Diets Gluten Free Diets Holiday Meal Planning Cook ...

  8. Food guide plate

    Science.gov (United States)

    ... chips or cookies. VEGETABLES: MAKE HALF OF YOUR PLATE FRUITS AND VEGETABLES Vegetables can be raw, fresh, ... as a snack. FRUITS: MAKE HALF OF YOUR PLATE FRUITS AND VEGETABLES Fruits can be fresh, canned, ...

  9. Growth Plate Fractures

    Science.gov (United States)

    ... the most widely used by doctors is the Salter-Harris system, described below. Type I Fractures These ... incidence of growth plate fractures peaks in adolescence. Salter-Harris classification of growth plate fractures. AAOS does ...

  10. Create Your Plate

    Medline Plus

    Full Text Available ... Planning Meals Diabetes Meal Plans Create Your Plate Gluten Free Diets Meal Planning for Vegetarian Diets Cook ... Create Your Plate Meal Planning for Vegetarian Diets Gluten Free Diets Holiday Meal Planning Cook with Heart- ...

  11. Create Your Plate

    Medline Plus

    Full Text Available ... Planning Meals Diabetes Meal Plans Create Your Plate Gluten Free Diets Meal Planning for Vegetarian Diets Cook ... Create Your Plate Meal Planning for Vegetarian Diets Gluten Free Diets Holiday Meal Planning Cook with Heart- ...

  12. Create Your Plate

    Medline Plus

    Full Text Available ... Your Plate It's simple and effective for both managing diabetes and losing weight. Creating your plate lets you still choose the foods you want, but changes the portion sizes so you are getting larger ...

  13. Create Your Plate

    Medline Plus

    Full Text Available ... Your Plate It's simple and effective for both managing diabetes and losing weight. Creating your plate lets ... Sleeve Custom jerseys for your Tour de Cure team benefits the cause. Ask the Experts: Learn to ...

  14. Accelerated plate tectonics.

    Science.gov (United States)

    Anderson, D L

    1975-03-21

    The concept of a stressed elastic lithospheric plate riding on a viscous asthenosphere is used to calculate the recurrence interval of great earthquakes at convergent plate boundaries, the separation of decoupling and lithospheric earthquakes, and the migration pattern of large earthquakes along an arc. It is proposed that plate motions accelerate after great decoupling earthquakes and that most of the observed plate motions occur during short periods of time, separated by periods of relative quiescence.

  15. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  16. Create Your Plate

    Medline Plus

    Full Text Available ... Reset Plate Share Create Your Plate ! Share: Seven Simple Steps to Create Your Plate It's simple and effective for both managing diabetes and losing ... en.html Have Type 2 Diabetes? Our free program will help you live well. More from diabetes. ...

  17. Obliquity along plate boundaries

    Science.gov (United States)

    Philippon, Mélody; Corti, Giacomo

    2016-12-01

    Most of the plate boundaries are activated obliquely with respect to the direction of far field stresses, as roughly only 8% of the plate boundaries total length shows a very low obliquity (ranging from 0 to 10°, sub-orthogonal to the plate displacement). The obliquity along plate boundaries is controlled by (i) lateral rheological variations within the lithosphere and (ii) consistency with the global plate circuit. Indeed, plate tectonics and magmatism drive rheological changes within the lithosphere and consequently influence strain localization. Geodynamical evolution controls large-scale mantle convection and plate formation, consumption, and re-organization, thus triggering plate kinematics variations, and the adjustment and re-orientation of far field stresses. These geological processes may thus result in plate boundaries that are not perpendicular but oblique to the direction of far field stresses. This paper reviews the global patterns of obliquity along plate boundaries. Using GPlate, we provide a statistical analysis of present-day obliquity along plate boundaries. Within this framework, by comparing natural examples and geological models, we discuss deformation patterns and kinematics recorded along oblique plate boundaries.

  18. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  19. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  20. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)

    赵倩

    2014-01-01

    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  1. A feasibility study of a prototype PET insert device to convert a general-purpose animal PET scanner to higher resolution.

    Science.gov (United States)

    Wu, Heyu; Pal, Debashish; O'Sullivan, Joseph A; Tai, Yuan-Chuan

    2008-01-01

    We developed a prototype system to evaluate the feasibility of using a PET insert device to achieve higher resolution from a general-purpose animal PET scanner. The system consists of a high-resolution PET detector, a computer-controlled rotation stage, and a custom mounting plate. The detector consists of a cerium-doped lutetium oxyorthosilicate array (12 x 12 crystals, 0.8 x 1.66 x 3.75 mm(3) each) directly coupled to a position-sensitive photomultiplier tube (PS-PMT). The detector signals were fed into the scanner electronics to establish coincidences between the 2 systems. The detector was mounted to a rotation stage that is attached to the scanner via the custom mounting plate after removing the transmission source holder. The rotation stage was concentric with the center of the scanner. The angular offset of the insert detector was calibrated via optimizing point-source images. In all imaging experiments, coincidence data were collected from 9 angles to provide 180 degrees sampling. A (22)Na point source was imaged at different offsets from the center to characterize the in-plane resolution of the insert system. A (68)Ge point source was stepped across the axial field of view to measure the sensitivity of the system. A 23.2-g mouse was injected with 38.5 MBq of (18)F-fluoride and imaged at 3 h after injection for 2 h. The transverse image resolution of the PET insert device ranges from 1.1- to 1.4-mm full width at half maximum (FWHM) without correction for the point-source dimension. This corresponds to approximately 33% improvement over the resolution of the original scanner (1.7- to 1.8-mm FWHM) in 2 of the 3 directions. The sensitivity of the device is 0.064% at the center of the field, 46-fold lower than the sensitivity of an existing animal PET scanner. The mouse bone scan had improved image resolution using the PET insert device over that of the existing animal PET scanner alone. We have demonstrated the feasibility of using a high-resolution insert

  2. Angular shear plate

    Science.gov (United States)

    Ruda, Mitchell C [Tucson, AZ; Greynolds, Alan W [Tucson, AZ; Stuhlinger, Tilman W [Tucson, AZ

    2009-07-14

    One or more disc-shaped angular shear plates each include a region thereon having a thickness that varies with a nonlinear function. For the case of two such shear plates, they are positioned in a facing relationship and rotated relative to each other. Light passing through the variable thickness regions in the angular plates is refracted. By properly timing the relative rotation of the plates and by the use of an appropriate polynomial function for the thickness of the shear plate, light passing therethrough can be focused at variable positions.

  3. Improved spatial resolution in PET scanners using sampling techniques

    Science.gov (United States)

    Surti, Suleman; Scheuermann, Ryan; Werner, Matthew E.; Karp, Joel S.

    2009-01-01

    Increased focus towards improved detector spatial resolution in PET has led to the use of smaller crystals in some form of light sharing detector design. In this work we evaluate two sampling techniques that can be applied during calibrations for pixelated detector designs in order to improve the reconstructed spatial resolution. The inter-crystal positioning technique utilizes sub-sampling in the crystal flood map to better sample the Compton scatter events in the detector. The Compton scatter rejection technique, on the other hand, rejects those events that are located further from individual crystal centers in the flood map. We performed Monte Carlo simulations followed by measurements on two whole-body scanners for point source data. The simulations and measurements were performed for scanners using scintillators with Zeff ranging from 46.9 to 63 for LaBr3 and LYSO, respectively. Our results show that near the center of the scanner, inter-crystal positioning technique leads to a gain of about 0.5-mm in reconstructed spatial resolution (FWHM) for both scanner designs. In a small animal LYSO scanner the resolution improves from 1.9-mm to 1.6-mm with the inter-crystal technique. The Compton scatter rejection technique shows higher gains in spatial resolution but at the cost of reduction in scanner sensitivity. The inter-crystal positioning technique represents a modest acquisition software modification for an improvement in spatial resolution, but at a cost of potentially longer data correction and reconstruction times. The Compton scatter rejection technique, while also requiring a modest acquisition software change with no increased data correction and reconstruction times, will be useful in applications where the scanner sensitivity is very high and larger improvements in spatial resolution are desirable. PMID:19779586

  4. Investigation of the objects depending on distance scanned with Laser Scanner

    Science.gov (United States)

    Denli, H. H.; Celik, F.; Kaya, S.; Duran, Z.

    2014-12-01

    Terrestrial laser scanning technology provides its users with many advantages. Fast data collection and high accuracy data acquisition of terrestrial laser scanners extends their use. This method is often preferred in technical architecture studies, drawings of facade relieve, production of 3D models of urban and industrial structures. Tools having different precisions for various purposes and measurement principal are used. The system has three measurement principles, time-of-flight measurement, phase measurement and triangulation-based measurements. These methods and tools have been tested in laboratory conditions, provided with accuracy analyses. Different objects of different sizes are used and the effect of changing the scanning distance, angle, and resolution of the object geometry is examined. The instrument 'Scan Station C10', working with impulse method and having the feature of scanning with 4 different resolutions, respectively low, medium, high and highest scanning options has been employed. A position accuracy of 6 mm, distance accuracy of 4 mm, horizontal and vertical rotation angle of 12" has been used. On determining these accuracies, various measurements have been performed in the range of 1m - 50 m. For performing an accuracy analysis, a calibration plate has been used. Four different geometric shapes, equilateral triangle, square, circle and a plus sign have been placed on the plate. The measurement basis or line is 300 m long. The calibration plate ranging between 0 - 100 m is linearly placed at 10 m intervals, whereas the range of 100 - 300 m is linearly placed at 50 m intervals. Without moving the plate from the testing point, the scanning distance has been kept equal and has been scanned at three different angles. This process was repeated for every designated point. This study has been extrapolated to analyze the effect of different scanning distance, angle and resolution and the change in the structure of the object.

  5. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  6. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  7. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  8. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  9. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  10. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  11. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  12. Characterization of a Large, Low-Cost 3D Scanner

    Directory of Open Access Journals (Sweden)

    Jeremy Straub

    2015-01-01

    Full Text Available Imagery-based 3D scanning can be performed by scanners with multiple form factors, ranging from small and inexpensive scanners requiring manual movement around a stationary object to large freestanding (nearly instantaneous units. Small mobile units are problematic for use in scanning living creatures, which may be unwilling or unable to (or for the very young and animals, unaware of the need to hold a fixed position for an extended period of time. Alternately, very high cost scanners that can capture a complete scan within a few seconds are available, but they are cost prohibitive for some applications. This paper seeks to assess the performance of a large, low-cost 3D scanner, presented in prior work, which is able to concurrently capture imagery from all around an object. It provides the capabilities of the large, freestanding units at a price point akin to the smaller, mobile ones. This allows access to 3D scanning technology (particularly for applications requiring instantaneous imaging at a lower cost. Problematically, prior analysis of the scanner’s performance was extremely limited. This paper characterizes the efficacy of the scanner for scanning both inanimate objects and humans. Given the importance of lighting to visible light scanning systems, the scanner’s performance under multiple lighting configurations is evaluated, characterizing its sensitivity to lighting design.

  13. Effects of sitting versus standing and scanner type on cashiers.

    Science.gov (United States)

    Lehman, K R; Psihogios, J P; Meulenbroek, R G

    2001-06-10

    In the retail supermarket industry where cashiers perform repetitive, light manual material-handling tasks when scanning and handling products, reports of musculoskeletal disorders and discomfort are high. Ergonomics tradeoffs exist between sitting and standing postures, which are further confounded by the checkstand design and point-of-sale technology, such as the scanner. A laboratory experiment study was conducted to understand the effects of working position (sitting versus standing) and scanner type (bi-optic versus single window) on muscle activity, upper limb and spinal posture, and subjective preference of cashiers. Ten cashiers from a Dutch retailer participated in the study. Cashiers exhibited lower muscle activity in the neck and shoulders when standing and using a bi-optic scanner. Shoulder abduction was also less for standing conditions. In addition, all cashiers preferred using the bi-optic scanner with mixed preferences for sitting (n = 6) and standing (n = 4). Static loading of the muscles was relatively high compared with benchmarks, suggesting that during the task of scanning, cashiers may not have adequate recovery time to prevent fatigue. It is recommended that retailers integrate bi-optic scanners into standing checkstands to minimize postural stress, fatigue and discomfort in cashiers.

  14. EGRONOMIC FINGERPRINT SCANNER DESIGN FOR PEOPLE WITH MOTOR NEURON DISEASES

    Directory of Open Access Journals (Sweden)

    Abdulkareem Al-Alwani

    2013-01-01

    Full Text Available Fingerprint devices have evolved with time for authentication and identification purposes. It is used in generic security and social applications where identification and logging is required when entering that premises. In some circumstances the lag time increases due to increase in human entrees such as at immigration points, airports, random security checkups, attendance loggers. The increase in overall time due to individual human delay factors present a major hindrance in smooth security as well as organizational operations. The delay could occur due to non-technical factor such as not placing the fingers firmly in the surface of the device. This is a major cause of concern for senior citizens and people with motor neuron diseases such as Parkinson’s, Huntington’s and Alzheimer’s disease. Therefore, a design is proposed in this research which can help the scanner to acquire fast and precise fingerprint scan of senior citizens and people with motor neuron diseases. This design uses ergonomically designed cover head for the scanner whose working is based on the Poka Yoke principle which assists firm finger placement on the scanner. In this research, 250 fingerprint scans were taken for statistical analysis using a normal fingerprint scanner and our proposed model scanner. Statistical comparison between the two results shows that our proposed model performs much better in terms of time consumption and accuracy.

  15. Moths on the Flatbed Scanner: The Art of Joseph Scheer

    Directory of Open Access Journals (Sweden)

    Stephen L. Buchmann

    2011-12-01

    Full Text Available During the past decade a few artists and even fewer entomologists discovered flatbed scanning technology, using extreme resolution graphical arts scanners for acquiring high magnification digital images of plants, animals and inanimate objects. They are not just for trip receipts anymore. The special attributes of certain scanners, to image thick objects is discussed along with the technical features of the scanners including magnification, color depth and shadow detail. The work of pioneering scanner artist, Joseph Scheer from New York’s Alfred University is highlighted. Representative flatbed-scanned images of moths are illustrated along with techniques to produce them. Collecting and preparing moths, and other objects, for scanning are described. Highlights of the Fulbright sabbatical year of professor Scheer in Arizona and Sonora, Mexico are presented, along with comments on moths in science, folklore, art and pop culture. The use of flatbed scanners is offered as a relatively new method for visualizing small objects while acquiring large files for creating archival inkjet prints for display and sale.

  16. Moths on the Flatbed Scanner: The Art of Joseph Scheer.

    Science.gov (United States)

    Buchmann, Stephen L

    2011-12-14

    During the past decade a few artists and even fewer entomologists discovered flatbed scanning technology, using extreme resolution graphical arts scanners for acquiring high magnification digital images of plants, animals and inanimate objects. They are not just for trip receipts anymore. The special attributes of certain scanners, to image thick objects is discussed along with the technical features of the scanners including magnification, color depth and shadow detail. The work of pioneering scanner artist, Joseph Scheer from New York's Alfred University is highlighted. Representative flatbed-scanned images of moths are illustrated along with techniques to produce them. Collecting and preparing moths, and other objects, for scanning are described. Highlights of the Fulbright sabbatical year of professor Scheer in Arizona and Sonora, Mexico are presented, along with comments on moths in science, folklore, art and pop culture. The use of flatbed scanners is offered as a relatively new method for visualizing small objects while acquiring large files for creating archival inkjet prints for display and sale.

  17. Improved Scanners for Microscopic Hyperspectral Imaging

    Science.gov (United States)

    Mao, Chengye

    2009-01-01

    Improved scanners to be incorporated into hyperspectral microscope-based imaging systems have been invented. Heretofore, in microscopic imaging, including spectral imaging, it has been customary to either move the specimen relative to the optical assembly that includes the microscope or else move the entire assembly relative to the specimen. It becomes extremely difficult to control such scanning when submicron translation increments are required, because the high magnification of the microscope enlarges all movements in the specimen image on the focal plane. To overcome this difficulty, in a system based on this invention, no attempt would be made to move either the specimen or the optical assembly. Instead, an objective lens would be moved within the assembly so as to cause translation of the image at the focal plane: the effect would be equivalent to scanning in the focal plane. The upper part of the figure depicts a generic proposed microscope-based hyperspectral imaging system incorporating the invention. The optical assembly of this system would include an objective lens (normally, a microscope objective lens) and a charge-coupled-device (CCD) camera. The objective lens would be mounted on a servomotor-driven translation stage, which would be capable of moving the lens in precisely controlled increments, relative to the camera, parallel to the focal-plane scan axis. The output of the CCD camera would be digitized and fed to a frame grabber in a computer. The computer would store the frame-grabber output for subsequent viewing and/or processing of images. The computer would contain a position-control interface board, through which it would control the servomotor. There are several versions of the invention. An essential feature common to all versions is that the stationary optical subassembly containing the camera would also contain a spatial window, at the focal plane of the objective lens, that would pass only a selected portion of the image. In one version

  18. Design and performance of HEAD PENN-PET scanner

    Energy Technology Data Exchange (ETDEWEB)

    Freifelder, R.; Karp, J.S. (Univ. of Pennsylvania, Philadelphia, PA (United States). Dept. of Radiology); Geagan, M.; Muehllehner, G. (UGM Medical Systems Inc., Philadelphia, PA (United States))

    1994-08-01

    A new PET scanner for brain imaging (and animals) has been designed with very high sensitivity and spatial resolution. The design is an evolution of the PENN-PET scanner, which uses large position-sensitive NaI(Tl) detectors, with Anger-type positioning logic, and which allows 3-D volume imaging, without septa. The new design is built with a single annular crystal coupled to 180 photomultiplier tubes, and uses local triggering electronics to subdivide the detector into small zones and to determine coincident events within the detector. The axial acceptance angle of [+-] 27 deg, with a field-of-view of 25.6 cm, is larger than any currently operating PET scanner. Performance measurements are presented.

  19. Spectral reflectance estimation using a six-color scanner

    Science.gov (United States)

    Tominaga, Shoji; Kohno, Satoshi; Kakinuma, Hirokazu; Nohara, Fuminori; Horiuchi, Takahiko

    2009-01-01

    A method is proposed for estimating the spectral reflectance function of an object surface by using a six-color scanner. The scanner is regarded as a six-band spectral imaging system, since it captures six color channels in total from two separate scans using two difference lamps. First, we describe the basic characteristics of the imaging systems for a HP color scanner and a multiband camera used for comparison. Second, we describe a computational method for recovering surface-spectral reflectances from the noisy sensor outputs. A LMMSE estimator is presented as an optimal estimator. We discuss the reflectance estimation for non-flat surfaces with shading effect. A solution method is presented for the reliable reflectance estimation. Finally, the performance of the proposed method is examined in detail on experiments using the Macbeth Color Checker and non-flat objects.

  20. Dental impressions using 3D digital scanners: virtual becomes reality.

    Science.gov (United States)

    Birnbaum, Nathan S; Aaronson, Heidi B

    2008-10-01

    The technologies that have made the use of three-dimensional (3D) digital scanners an integral part of many industries for decades have been improved and refined for application to dentistry. Since the introduction of the first dental impressioning digital scanner in the 1980s, development engineers at a number of companies have enhanced the technologies and created in-office scanners that are increasingly user-friendly and able to produce precisely fitting dental restorations. These systems are capable of capturing 3D virtual images of tooth preparations, from which restorations may be fabricated directly (ie, CAD/CAM systems) or fabricated indirectly (ie, dedicated impression scanning systems for the creation of accurate master models). The use of these products is increasing rapidly around the world and presents a paradigm shift in the way in which dental impressions are made. Several of the leading 3D dental digital scanning systems are presented and discussed in this article.

  1. Restoration of Hyperspectral Push-Broom Scanner Data

    DEFF Research Database (Denmark)

    Larsen, Rasmus; Nielsen, Allan Aasbjerg; Conradsen, Knut

    1997-01-01

    Several effects combine to distort the multispectral data that are obtained from push-broom scanners. We develop an algorithm for restoration of such data, illustrated on images from the ROSIS scanner. In push-broom scanners variation between elements in the detector array results in a strong...... striping along flight lines. A non-systematic striping is also present along flight lines. Furthermore, line drop-outs occur, and finally, various types of electronic noise of salt-and-pepper type are also present. We describe techniques for the correction for all these types of effects. Line drop...... back into the original spectral space results in noise corrected variables. The noise components will now have been removed from the entire original data set by working on a smaller set of noise contaminated transformed variables only. The application of the above techniques results in a dramatic...

  2. AE8/AP8 Implementations in AE9/AP9, IRBEM, and SPENVIS

    Science.gov (United States)

    2014-02-18

    period applies to orbit generation only; AE8/AP8 utilizes geomagnetic field models from other epochs as specified in the table below.) SHIELDOSE2 model...Cain, J. C., S. J. Hendricks, R. A. Langel, and W. V. Hudson (1967), A proposed model for the international geomagnetic reference field, 1965, J...trapped particle fluxes with the NASA models AP-8 and AE-8, Radiat. Meas., 26, pp. 947-952. International Association of Geomagnetism and Aeronomy

  3. Calibration of Images with 3D range scanner data

    OpenAIRE

    Adalid López, Víctor Javier

    2009-01-01

    Projecte fet en col.laboració amb EPFL 3D laser range scanners are used in extraction of the 3D data in a scene. Main application areas are architecture, archeology and city planning. Thought the raw scanner data has a gray scale values, the 3D data can be merged with colour camera image values to get textured 3D model of the scene. Also these devices are able to take a reliable copy in 3D form objects, with a high level of accuracy. Therefore, they scanned scenes can be use...

  4. Performance Assessment of Wire-Scanners at CERN

    CERN Document Server

    Baud, G; Emery, J; Gras, JJ; Guerrero, A; Piselli, E

    2013-01-01

    This article describes the current fast wire-scanner devices installed in circular accelerators at CERN with an emphasis on the error studies carried out during the last two runs. At present the wire-scanners have similar acquisition systems but are varied in terms of mechanics. Several measurement campaigns were performed aimed at establishing optimal operational settings and to identify and assess systematic errors. In several cases the results led to direct performance improvements while in others this helped in defining the requirements for new detectors.

  5. Satellite orientation and position for geometric correction of scanner imagery.

    Science.gov (United States)

    Salamonowicz, P.H.

    1986-01-01

    The USGS Mini Image Processing System currently relies on a polynomial method for geometric correction of Landsat multispectral scanner (MSS) data. A large number of ground control points are required because polynomials do not model the sources of error. In order to reduce the number of necessary points, a set of mathematical equations modeling the Landsat satellite motions and MSS scanner has been derived and programmed. A best fit to the equations is obtained by using a least-squares technique that permits computation of the satellite orientation and position parameters based on only a few control points.-from Author

  6. Free-space wavelength-multiplexed optical scanner.

    Science.gov (United States)

    Yaqoob, Z; Rizvi, A A; Riza, N A

    2001-12-10

    A wavelength-multiplexed optical scanning scheme is proposed for deflecting a free-space optical beam by selection of the wavelength of the light incident on a wavelength-dispersive optical element. With fast tunable lasers or optical filters, this scanner features microsecond domain scan setting speeds and large- diameter apertures of several centimeters or more for subdegree angular scans. Analysis performed indicates an optimum scan range for a given diffraction order and grating period. Limitations include beam-spreading effects based on the varying scanner aperture sizes and the instantaneous information bandwidth of the data-carrying laser beam.

  7. Impact of lighting and attire on 3D scanner performance

    Science.gov (United States)

    Ajjimaporn, Pann; Feist, Dakota; Straub, Jeremy; Kerlin, Scott

    2015-05-01

    This paper considers the impact of lighting and attire on the performance of a previously created low-cost 3D scanning system. It considers the effect of adjusting the lighting configuration and of the subject's clothing on the quality of the scans and the number and types of objects that can be scanned. The experimentation performed tested different types (colors and textures) of clothing to assess which produced the best scans and multiple lighting configurations. This paper presents the results from this experimentation and, from this, make generalizations about optimizing visible light scanner performance before concluding with a discussion of scanner efficacy.

  8. Scanner baseliner monitoring and control in high volume manufacturing

    Science.gov (United States)

    Samudrala, Pavan; Chung, Woong Jae; Aung, Nyan; Subramany, Lokesh; Gao, Haiyong; Gomez, Juan-Manuel

    2016-03-01

    We analyze performance of different customized models on baseliner overlay data and demonstrate the reduction in overlay residuals by ~10%. Smart Sampling sets were assessed and compared with the full wafer measurements. We found that performance of the grid can still be maintained by going to one-third of total sampling points, while reducing metrology time by 60%. We also demonstrate the feasibility of achieving time to time matching using scanner fleet manager and thus identify the tool drifts even when the tool monitoring controls are within spec limits. We also explore the scanner feedback constant variation with illumination sources.

  9. Localization of a mobile laser scanner via dimensional reduction

    Science.gov (United States)

    Lehtola, Ville V.; Virtanen, Juho-Pekka; Vaaja, Matti T.; Hyyppä, Hannu; Nüchter, Andreas

    2016-11-01

    We extend the concept of intrinsic localization from a theoretical one-dimensional (1D) solution onto a 2D manifold that is embedded in a 3D space, and then recover the full six degrees of freedom for a mobile laser scanner with a simultaneous localization and mapping algorithm (SLAM). By intrinsic localization, we mean that no reference coordinate system, such as global navigation satellite system (GNSS), nor inertial measurement unit (IMU) are used. Experiments are conducted with a 2D laser scanner mounted on a rolling prototype platform, VILMA. The concept offers potential in being extendable to other wheeled platforms.

  10. A ’Millipede’ scanner model - Energy consumption and performance

    OpenAIRE

    Engelen, Johan B.C.; Khatib, Mohammed G.

    2008-01-01

    This short report (1) describes an energy model for the seek and read/write operations in a mass-balanced Y-scanner for parallel-probe storage by IBM [1] and (2) updates the settings of the MEMS model in DiskSim with recent published figures from this XY-scanner. To speedup system simulations, a straight forward second-order model is used without control loop. Read/write operation is modeled by quasi-static calculations. To approximate seek behavior, ’bang-bang’ control is assumed; the result...

  11. Generalized Fibonacci zone plates

    CERN Document Server

    Ke, Jie; Zhu, Jianqiang

    2015-01-01

    We propose a family of zone plates which are produced by the generalized Fibonacci sequences and their axial focusing properties are analyzed in detail. Compared with traditional Fresnel zone plates, the generalized Fibonacci zone plates present two axial foci with equal intensity. Besides, we propose an approach to adjust the axial locations of the two foci by means of different optical path difference, and further give the deterministic ratio of the two focal distances which attributes to their own generalized Fibonacci sequences. The generalized Fibonacci zone plates may allow for new applications in micro and nanophotonics.

  12. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  13. Electrostatic and Small-Signal Analysis of CMUTs With Circular and Square Anisotropic Plates

    DEFF Research Database (Denmark)

    la Cour, Mette Funding; Christiansen, Thomas Lehrmann; Jensen, Jørgen Arendt

    2015-01-01

    Traditionally, Capacitive Micromachined Ultrasonic Transducers (CMUTs) are modeled using the isotropic plate equation and this leads to deviations between analytical calcu- lations and Finite Element Modeling (FEM). In this paper, the deflection is calculated for both circular and square plates...... using the full anisotropic plate equation. It is shown that the anisotropic calculations match perfectly with FEM while an isotropic ap- proach causes up to 10% deviations in deflection. For circular plates an exact solution can be found and for square plates using the Galerkin method and utilizing...... the symmetry of the silicon crystal, a compact and accurate expression for the deflection can be obtained. The deviation from FEM in center deflection is plates is also applied to the CMUT. The deflection of a square plate was measured on fabricated CMUTs using a white light...

  14. Estimating Single Tree Stem Volume of Pinus sylvestris Using Airborne Laser Scanner and Multispectral Line Scanner Data

    Directory of Open Access Journals (Sweden)

    Barbara Koch

    2011-05-01

    Full Text Available So far, only a few studies have been carried out in central European forests to estimate individual tree stem volume of pine trees from high resolution remote sensing data. In this article information derived from airborne laser scanner and multispectral line scanner data were tested to predict the stem volume of 178 pines (Pinus sylvestris in a study site in the south-west of Germany. First, tree crowns were automatically delineated using both multispectral and laser scanner data. Next, tree height, crown diameter and crown volume were derived for each crown segment. All combinations of the derived tree features were used as explanatory variables in allometric models to predict the stem volume. A model with tree height and crown diameter had the best performance with respect to the prediction accuracy determined by a leave-one-out cross-validation: Root Mean Square Error (RMSE = 24.02% and Bias = 1.36%.

  15. CLEARING MAGNET DESIGN FOR APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Abliz, M.; Grimmer, J.; Jaski, Y.; Westferro, F.; Ramanathan, M.

    2017-06-25

    The Advanced Photon Source is in the process of developing an upgrade (APS-U) of the storage ring. The upgrade will be converting the current double bend achromat (DBA) lattice to a multi-bend achromat (MBA) lattice. In addition, the storage ring will be operated at 6 GeV and 200 mA with regular swap-out injection to keep the stored beam current constant [1]. The swap-out injection will take place with beamline shutters open. For radiation safety to ensure that no electrons can exit the storage ring, a passive method of protecting the beamline and containing the electrons inside the storage ring is proposed. A clearing magnet will be located in all beamline front ends inside the storage ring tunnel. This article will discuss the features and design of the clearing magnet scheme for APS-U.

  16. AP stars with resolved Zeeman split lines

    Science.gov (United States)

    Mathys, G.

    1990-06-01

    High-resolution, high SNR observations of a sample of sharp-lined A stars and of Ap stars showing resolved Zeeman split lines are presented. The Fe II lines 6147.7 A and 6149.2 A unexpectedly appear to be asymmetric in all stars where they are resolved. The blue component of the 6149.2 line, which is a Zeeman doublet, is deeper and narrower than its red component. For line 6147.7, whose Zeeman pattern does not differ much from a quadruplet, the red components are deeper than the blue ones. It is shown that a partial Paschen-Back effect can account for these properties. The potential implications of this finding for studies of magnetic Ap stars are discussed.

  17. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-04-19

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report.

  18. An Updated AP2 Beamline TURTLE Model

    Energy Technology Data Exchange (ETDEWEB)

    Gormley, M.; O' Day, S.

    1991-08-23

    This note describes a TURTLE model of the AP2 beamline. This model was created by D. Johnson and improved by J. Hangst. The authors of this note have made additional improvements which reflect recent element and magnet setting changes. The magnet characteristics measurements and survey data compiled to update the model will be presented. A printout of the actual TURTLE deck may be found in appendix A.

  19. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  20. Using DCAT-AP for research data

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; VACCARI LORENZINO; TSINARAKI CHRYSI

    2016-01-01

    This paper outlines a set cross-domain requirements for the documentation of scientific data, identified during the development of the corporate data catalogue of the European Commission's Joint Research Centre (JRC). In particular, we illustrate how we have extended the DCAT application profile for European data portals (DCAT-AP) to accomodate requirements for scientific datasets, and we discuss a number of issues still to be addressed.

  1. A simulation study of a dual-plate in-room PET system for dose verification in carbon ion therapy

    Science.gov (United States)

    Chen, Ze; Hu, Zheng-Guo; Chen, Jin-Da; Zhang, Xiu-Ling; Guo, Zhong-Yan; Xiao, Guo-Qing; Sun, Zhi-Yu; Huang, Wen-Xue; Wang, Jian-Song

    2014-08-01

    During carbon ion therapy, lots of positron emitters such as 11C, 15O, 10C are generated in irradiated tissues by nuclear reactions, and can be used to track the carbon beam in the tissue by a positron emission tomography (PET) scanner. In this study, an dual-plate in-room PET scanner has been designed and evaluated based on the GATE simulation platform to monitor patient dose in carbon ion therapy. The dual-plate PET is designed to avoid interference with the carbon beamline and with patient positioning. Its performance was compared with that of four-head and full-ring PET scanners. The dual-plate, four-head and full-ring PET scanners consisted of 30, 60, 60 detector modules, respectively, with a 36 cm distance between directly opposite detector modules for dose deposition measurements. Each detector module consisted of a 24×24 array of 2 mm×2 mm×18 mm LYSO pixels coupled to a Hamamatsu H8500 PMT. To estimate the production yield of positron emitters, a 10 cm×15 cm×15 cm cuboid PMMA phantom was irradiated with 172, 200, 250 MeV/u 12C beams. 3D images of the activity distribution measured by the three types of scanner are produced by an iterative reconstruction algorithm. By comparing the longitudinal profile of positron emitters along the carbon beam path, it is indicated that use of the dual-plate PET scanner is feasible for monitoring the dose distribution in carbon ion therapy.

  2. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  3. Blue Willow Story Plates

    Science.gov (United States)

    Fontes, Kris

    2009-01-01

    In the December 1997 issue of "SchoolArts" is a lesson titled "Blue Willow Story Plates" by Susan Striker. In this article, the author shares how she used this lesson with her middle-school students many times over the years. Here, she describes a Blue Willow plate painting project that her students made.

  4. Create Your Plate

    Medline Plus

    Full Text Available ... In Memory In Honor Become a Member En Español Type 1 Type 2 About Us Online Community ... Page Text Size: A A A Listen En Español Create Your Plate Create Your Plate is a ...

  5. Create Your Plate

    Medline Plus

    Full Text Available ... Diabetes Meal Plans Create Your Plate Gluten Free Diets Meal Planning for Vegetarian Diets Cook with Heart-Healthy Foods Holiday Meal Planning ... Planning Meals Diabetes Meal Plans and a Healthy Diet Create Your Plate Meal Planning for Vegetarian Diets ...

  6. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...... or copy number variations in the AIRE gene were associated with AAD and APS II. First, nine SNPs in the AIRE gene were analyzed in 311 patients with AAD and APS II and 521 healthy controls, identifying no associated risk. Second, in a subgroup of 25 of these patients, AIRE sequencing revealed three novel...... polymorphisms. Finally, the AIRE copy number was determined by duplex quantitative PCR in 14 patients with APS I, 161 patients with AAD and APS II and in 39 healthy subjects. In two Scandinavian APS I patients previously reported to be homozygous for common AIRE mutations, we identified large deletions...

  7. Demonstration: A smartphone 3D functional brain scanner

    DEFF Research Database (Denmark)

    Stahlhut, Carsten; Stopczynski, Arkadiusz; Larsen, Jakob Eg

    We demonstrate a fully portable 3D real-time functional brain scanner consisting of a wireless 14-channel ‘Neuroheadset‘ (Emotiv EPOC) and a Nokia N900 smartphone. The novelty of our system is the ability to perform real-time functional brain imaging on a smartphone device, including stimulus del......, tablet computers, and netbooks) that are based on Linux operating systems....

  8. Feature-space transformation improves supervised segmentation across scanners

    DEFF Research Database (Denmark)

    van Opbroek, Annegreet; Achterberg, Hakim C.; de Bruijne, Marleen

    2015-01-01

    Image-segmentation techniques based on supervised classification generally perform well on the condition that training and test samples have the same feature distribution. However, if training and test images are acquired with different scanners or scanning parameters, their feature distributions...

  9. Free-space wavelength-multiplexed optical scanner demonstration.

    Science.gov (United States)

    Yaqoob, Zahid; Riza, Nabeel A

    2002-09-10

    Experimental demonstration of a no-moving-parts free-space wavelength-multiplexed optical scanner (W-MOS) is presented. With fast tunable lasers or optical filters and planar wavelength dispersive elements such as diffraction gratings, this microsecond-speed scanner enables large several-centimeter apertures for subdegree angular scans. The proposed W-MOS design incorporates a unique optical amplifier and variable optical attenuator combination that enables the calibration and modulation of the scanner response, leading to any desired scanned laser beam power shaping. The experimental setup uses a tunable laser centered at 1560 nm and a 600-grooves/mm blazed reflection grating to accomplish an angular scan of 12.92 degrees as the source is tuned over an 80-nm bandwidth. The values for calculated maximum optical beam divergance, required wavelength resolution, beam-pointing accuracy, and measured scanner insertion loss are 1.076 mrad, 0.172 nm, 0.06 mrad, and 4.88 dB, respectively.

  10. Measurement Report for the PS-boosterWire Scanner

    CERN Document Server

    Vollinger, Christine; Kramer, Patrick; CERN. Geneva. ATS Department

    2017-01-01

    This Note discusses the EM-measurements carried out on the prototype of the PS-Booster wire scanner. The aim of these measurements was to identify intrinsic resonances that are to be evaluated for their contribution to the longitudinal beam impedance of the machine.

  11. Sea surface temperature mapping using a thermal infrared scanner

    Digital Repository Service at National Institute of Oceanography (India)

    RameshKumar, M.R.; Pandya, R.M.; Mathur, K.M.; Charyulu, R.J.K.; Rao, L.V.G.

    1 metre water column below the sea surface. A thermal infrared scanner developed by the Space Applications Centre (ISRO), Ahmedabad was operated on board R.V. Gaveshani in April/May 1984 for mapping SST over the eastern Arabian Sea. SST values...

  12. Phosphor Scanner For Imaging X-Ray Diffraction

    Science.gov (United States)

    Carter, Daniel C.; Hecht, Diana L.; Witherow, William K.

    1992-01-01

    Improved optoelectronic scanning apparatus generates digitized image of x-ray image recorded in phosphor. Scanning fiber-optic probe supplies laser light stimulating luminescence in areas of phosphor exposed to x rays. Luminescence passes through probe and fiber to integrating sphere and photomultiplier. Sensitivity and resolution exceed previously available scanners. Intended for use in x-ray crystallography, medical radiography, and molecular biology.

  13. Scanners, optical character readers, Cyrillic alphabet and Russian translations

    Science.gov (United States)

    Johnson, Gordon G.

    1995-01-01

    The writing of code for capture, in a uniform format, of bit maps of words and characters from scanner PICT files is presented. The coding of Dynamic Pattern Matched for the identification of the characters, words and sentences in preparation for translation is discussed.

  14. Benchmarking Advanced Control Algorithms for a Laser Scanner System

    DEFF Research Database (Denmark)

    Stoustrup, Jakob; Ordys, A.W.; Smillie, I.

    1996-01-01

    The paper describes tests performed on the laser scanner system toassess feasibility of modern control techniques in achieving a requiredperformance in the trajectory following problem. The two methods tested areQTR H-infinity and Predictive Control. The results are ilustated ona simulation example....

  15. Analysis list: CASP8AP2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CASP8AP2 Digestive tract + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CAS...P8AP2.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.5.tsv http://dbarchive.bi...osciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/CAS

  16. Evaluation of New Inorganic Scintillators for Application in a Prototype Small Animal PET Scanner

    CERN Document Server

    Kuntner, C

    2003-01-01

    In the study of new pharmaceuticals as well as brain and genetic research, Positron Emission Tomography (PET) is a useful method. It has also recently entered the clinical domain in cardiology and particularly in oncology. Small animals such as mice, are often used to validate sophisticated models of human disease. High spatial resolution PET instrumentation is therefore necessary due to the reduced dimensions of the organs. Inorganic scintillators are employed in most of the diagnostic imaging devices. The ultimate performance of the PET scanner is tightly bound to the scintillation properties of the crystals. In the last years there has been an effort to develop new scintillating materials characterized by high light output, high detection efficiency and fast decay time. The most studied systems are mainly Ce3+-doped crystals such as LSO:Ce, YAP:Ce, LuAP:Ce, and recently also mixed Lux(RE3+)1-xAlO3:Ce crystals. These crystals are very attractive for medical application because of their high density (with th...

  17. A micron resolution optical scanner for characterization of silicon detectors

    Science.gov (United States)

    Shukla, R. A.; Dugad, S. R.; Garde, C. S.; Gopal, A. V.; Gupta, S. K.; Prabhu, S. S.

    2014-02-01

    The emergence of high position resolution (˜10 μm) silicon detectors in recent times have highlighted the urgent need for the development of new automated optical scanners of micron level resolution suited for characterizing microscopic features of these detectors. More specifically, for the newly developed silicon photo-multipliers (SiPM) that are compact, possessing excellent photon detection efficiency with gain comparable to photo-multiplier tube. In a short time, since their invention the SiPMs are already being widely used in several high-energy physics and astrophysics experiments as the photon readout element. The SiPM is a high quantum efficiency, multi-pixel photon counting detector with fast timing and high gain. The presence of a wide variety of photo sensitive silicon detectors with high spatial resolution requires their performance evaluation to be carried out by photon beams of very compact spot size. We have designed a high resolution optical scanner that provides a monochromatic focused beam on a target plane. The transverse size of the beam was measured by the knife-edge method to be 1.7 μm at 1 - σ level. Since the beam size was an order of magnitude smaller than the typical feature size of silicon detectors, this optical scanner can be used for selective excitation of these detectors. The design and operational details of the optical scanner, high precision programmed movement of target plane (0.1 μm) integrated with general purpose data acquisition system developed for recording static and transient response photo sensitive silicon detector are reported in this paper. Entire functionality of scanner is validated by using it for selective excitation of individual pixels in a SiPM and identifying response of active and dead regions within SiPM. Results from these studies are presented in this paper.

  18. In vivo cellular imaging with microscopes enabled by MEMS scanners

    Science.gov (United States)

    Ra, Hyejun

    High-resolution optical imaging plays an important role in medical diagnosis and biomedical research. Confocal microscopy is a widely used imaging method for obtaining cellular and sub-cellular images of biological tissue in reflectance and fluorescence modes. Its characteristic optical sectioning capability also enables three-dimensional (3-D) image reconstruction. However, its use has mostly been limited to excised tissues due to the requirement of high numerical aperture (NA) lenses for cellular resolution. Microscope miniaturization can enable in vivo imaging to make possible early cancer diagnosis and biological studies in the innate environment. In this dissertation, microscope miniaturization for in vivo cellular imaging is presented. The dual-axes confocal (DAC) architecture overcomes limitations of the conventional single-axis confocal (SAC) architecture to allow for miniaturization with high resolution. A microelectromechanical systems (MEMS) scanner is the central imaging component that is key in miniaturization of the DAC architecture. The design, fabrication, and characterization of the two-dimensional (2-D) MEMS scanner are presented. The gimbaled MEMS scanner is fabricated on a double silicon-on-insulator (SOI) wafer and is actuated by self-aligned vertical electrostatic combdrives. The imaging performance of the MEMS scanner in a DAC configuration is shown in a breadboard microscope setup, where reflectance and fluorescence imaging is demonstrated. Then, the MEMS scanner is integrated into a miniature DAC microscope. The whole imaging system is integrated into a portable unit for research in small animal models of human biology and disease. In vivo 3-D imaging is demonstrated on mouse skin models showing gene transfer and siRNA silencing. The siRNA silencing process is sequentially imaged in one mouse over time.

  19. A micron resolution optical scanner for characterization of silicon detectors.

    Science.gov (United States)

    Shukla, R A; Dugad, S R; Garde, C S; Gopal, A V; Gupta, S K; Prabhu, S S

    2014-02-01

    The emergence of high position resolution (∼10 μm) silicon detectors in recent times have highlighted the urgent need for the development of new automated optical scanners of micron level resolution suited for characterizing microscopic features of these detectors. More specifically, for the newly developed silicon photo-multipliers (SiPM) that are compact, possessing excellent photon detection efficiency with gain comparable to photo-multiplier tube. In a short time, since their invention the SiPMs are already being widely used in several high-energy physics and astrophysics experiments as the photon readout element. The SiPM is a high quantum efficiency, multi-pixel photon counting detector with fast timing and high gain. The presence of a wide variety of photo sensitive silicon detectors with high spatial resolution requires their performance evaluation to be carried out by photon beams of very compact spot size. We have designed a high resolution optical scanner that provides a monochromatic focused beam on a target plane. The transverse size of the beam was measured by the knife-edge method to be 1.7 μm at 1 - σ level. Since the beam size was an order of magnitude smaller than the typical feature size of silicon detectors, this optical scanner can be used for selective excitation of these detectors. The design and operational details of the optical scanner, high precision programmed movement of target plane (0.1 μm) integrated with general purpose data acquisition system developed for recording static and transient response photo sensitive silicon detector are reported in this paper. Entire functionality of scanner is validated by using it for selective excitation of individual pixels in a SiPM and identifying response of active and dead regions within SiPM. Results from these studies are presented in this paper.

  20. NMR of geophysical drill cores with a mobile Halbach scanner

    Energy Technology Data Exchange (ETDEWEB)

    Talnishnikh, E.

    2007-08-21

    This thesis is devoted to a mobile NMR with an improved Halbach scanner. This is a lightweight tube-shaped magnet with sensitive volume larger and a homogeneity of the magnetic field higher than the previous prototype version. The improved Halbach scanner is used for analysis of water-saturated drill cores and plugs with diameters up to 60 mm. To provide the analysis, the standard 1D technique with the CPMG sequence as well as 2D correlation experiments were successfully applied and adapted to study properties of fluid-saturated sediments. Afterwards the Halbach scanner was calibrated to fast non-destructive measurements of porosity, relaxation time distributions, and estimation of permeability. These properties can be calculated directly from the NMR data using the developed methodology. Any independent measurements of these properties with other methods are not needed. One of the main results of this work is the development of a new NMR on-line core scanner for measurements of porosity in long cylindrical and semi cylindrical drill cores. Also dedicated software was written to operate the NMR on-line core scanner. The physical background of this work is the study of the diffusion influence on transverse relaxation. The diffusion effect in the presence of internal gradients in porous media was probed by 1D and 2D experiments. The transverse relaxation time distributions obtained from 1D and from 2D experiments are comparable but different in fine details. Two new methodologies were developed based on the results of this study. First is the methodology quantifying the influence of diffusion in the internal gradients of water-saturated sediments on transverse relaxation from 2D correlation experiments. The second one is the correction of the permeability estimation from the NMR data taking in account the influence of the diffusion. Furthermore, PFG NMR technique was used to study restricted diffusion in the same kind of samples. Preliminary results are reported

  1. Teaching Materials and Strategies for the AP Music Theory Exam

    Science.gov (United States)

    Lively, Michael T.

    2017-01-01

    Each year, many students take the Advanced Placement (AP) Music Theory Exam, and the majority of these students enroll in specialized AP music theory classes as part of the preparation process. For the teachers of these AP music theory classes, a number of challenges are presented by the difficulty and complexity of the exam subject material as…

  2. Raising the Barcode Scanner: Technology and Productivity in the Retail Sector

    OpenAIRE

    Emek Basker

    2011-01-01

    Barcodes and barcode scanners transformed the grocery industry in the 1970s. I use store-level data from the 1972, 1977, and 1982 Census of Retail Trade, matched to data on store scanner installations, to estimate scanners' effect on labor productivity. I find that early scanners increased a store's labor productivity, on average, by approximately 4.5 percent in the first few years. The effect was larger in stores carrying more packaged products, consistent with the presence of network extern...

  3. BAO Plate Archive Project: Digitization, Electronic Database and Research Programmes

    Science.gov (United States)

    Mickaelian, A. M.; Abrahamyan, H. V.; Andreasyan, H. R.; Azatyan, N. M.; Farmanyan, S. V.; Gigoyan, K. S.; Gyulzadyan, M. V.; Khachatryan, K. G.; Knyazyan, A. V.; Kostandyan, G. R.; Mikayelyan, G. A.; Nikoghosyan, E. H.; Paronyan, G. M.; Vardanyan, A. V.

    2016-06-01

    The most important part of the astronomical observational heritage are astronomical plate archives created on the basis of numerous observations at many observatories. Byurakan Astrophysical Observatory (BAO) plate archive consists of 37,000 photographic plates and films, obtained at 2.6m telescope, 1m and 0.5m Schmidt type and other smaller telescopes during 1947-1991. In 2002-2005, the famous Markarian Survey (also called First Byurakan Survey, FBS) 1874 plates were digitized and the Digitized FBS (DFBS) was created. New science projects have been conducted based on these low-dispersion spectroscopic material. A large project on the whole BAO Plate Archive digitization, creation of electronic database and its scientific usage was started in 2015. A Science Program Board is created to evaluate the observing material, to investigate new possibilities and to propose new projects based on the combined usage of these observations together with other world databases. The Executing Team consists of 11 astronomers and 2 computer scientists and will use 2 EPSON Perfection V750 Pro scanners for the digitization, as well as Armenian Virtual Observatory (ArVO) database will be used to accommodate all new data. The project will run during 3 years in 2015-2017 and the final result will be an electronic database and online interactive sky map to be used for further research projects, mainly including high proper motion stars, variable objects and Solar System bodies.

  4. Pixelated neutron image plates

    Science.gov (United States)

    Schlapp, M.; Conrad, H.; von Seggern, H.

    2004-09-01

    Neutron image plates (NIPs) have found widespread application as neutron detectors for single-crystal and powder diffraction, small-angle scattering and tomography. After neutron exposure, the image plate can be read out by scanning with a laser. Commercially available NIPs consist of a powder mixture of BaFBr : Eu2+ and Gd2O3 dispersed in a polymer matrix and supported by a flexible polymer sheet. Since BaFBr : Eu2+ is an excellent x-ray storage phosphor, these NIPs are particularly sensitive to ggr-radiation, which is always present as a background radiation in neutron experiments. In this work we present results on NIPs consisting of KCl : Eu2+ and LiF that were fabricated into ceramic image plates in which the alkali halides act as a self-supporting matrix without the necessity for using a polymeric binder. An advantage of this type of NIP is the significantly reduced ggr-sensitivity. However, the much lower neutron absorption cross section of LiF compared with Gd2O3 demands a thicker image plate for obtaining comparable neutron absorption. The greater thickness of the NIP inevitably leads to a loss in spatial resolution of the image plate. However, this reduction in resolution can be restricted by a novel image plate concept in which a ceramic structure with square cells (referred to as a 'honeycomb') is embedded in the NIP, resulting in a pixelated image plate. In such a NIP the read-out light is confined to the particular illuminated pixel, decoupling the spatial resolution from the optical properties of the image plate material and morphology. In this work, a comparison of experimentally determined and simulated spatial resolutions of pixelated and unstructured image plates for a fixed read-out laser intensity is presented, as well as simulations of the properties of these NIPs at higher laser powers.

  5. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  6. Plate removal following orthognathic surgery.

    Science.gov (United States)

    Little, Mhairi; Langford, Richard Julian; Bhanji, Adam; Farr, David

    2015-11-01

    The objectives of this study are to determine the removal rates of orthognathic plates used during orthognathic surgery at James Cook University Hospital and describe the reasons for plate removal. 202 consecutive orthognathic cases were identified between July 2004 and July 2012. Demographics and procedure details were collected for these patients. Patients from this group who returned to theatre for plate removal between July 2004 and November 2012 were identified and their notes were analysed for data including reason for plate removal, age, smoking status, sex and time to plate removal. 3.2% of plates were removed with proportionally more plates removed from the mandible than the maxilla. 10.4% of patients required removal of one or more plate. Most plates were removed within the first post-operative year. The commonest reasons for plate removal were plate exposure and infection. The plate removal rates in our study are comparable to those seen in the literature.

  7. Standardizing CT lung density measure across scanner manufacturers.

    Science.gov (United States)

    Chen-Mayer, Huaiyu Heather; Fuld, Matthew K; Hoppel, Bernice; Judy, Philip F; Sieren, Jered P; Guo, Junfeng; Lynch, David A; Possolo, Antonio; Fain, Sean B

    2017-03-01

    Computed Tomography (CT) imaging of the lung, reported in Hounsfield Units (HU), can be parameterized as a quantitative image biomarker for the diagnosis and monitoring of lung density changes due to emphysema, a type of chronic obstructive pulmonary disease (COPD). CT lung density metrics are global measurements based on lung CT number histograms, and are typically a quantity specifying either the percentage of voxels with CT numbers below a threshold, or a single CT number below which a fixed relative lung volume, nth percentile, falls. To reduce variability in the density metrics specified by CT attenuation, the Quantitative Imaging Biomarkers Alliance (QIBA) Lung Density Committee has organized efforts to conduct phantom studies in a variety of scanner models to establish a baseline for assessing the variations in patient studies that can be attributed to scanner calibration and measurement uncertainty. Data were obtained from a phantom study on CT scanners from four manufacturers with several protocols at various tube potential voltage (kVp) and exposure settings. Free from biological variation, these phantom studies provide an assessment of the accuracy and precision of the density metrics across platforms solely due to machine calibration and uncertainty of the reference materials. The phantom used in this study has three foam density references in the lung density region, which, after calibration against a suite of Standard Reference Materials (SRM) foams with certified physical density, establishes a HU-electron density relationship for each machine-protocol. We devised a 5-step calibration procedure combined with a simplified physical model that enabled the standardization of the CT numbers reported across a total of 22 scanner-protocol settings to a single energy (chosen at 80 keV). A standard deviation was calculated for overall CT numbers for each density, as well as by scanner and other variables, as a measure of the variability, before and after the

  8. Anisotropic elastic plates

    CERN Document Server

    Hwu, Chyanbin

    2010-01-01

    As structural elements, anisotropic elastic plates find wide applications in modern technology. The plates here are considered to be subjected to not only in plane load but also transverse load. In other words, both plane and plate bending problems as well as the stretching-bending coupling problems are all explained in this book. In addition to the introduction of the theory of anisotropic elasticity, several important subjects have are discussed in this book such as interfaces, cracks, holes, inclusions, contact problems, piezoelectric materials, thermoelastic problems and boundary element a

  9. Plating in Top Agar

    OpenAIRE

    sprotocols

    2014-01-01

    1. Warm plates to room temperature before use. Cold plates causes the top agar to solidify irregularly. DO not warm plates to 37° as the top agar will take forever to solidify. - Prepare top agar as the appropriate liquid medium with 0.7% agar. Keeping 100 mL bottles is convenient. For phages, use λ top agar, which is less rich and yields bigger plaques. - Melt top agar in the microwave completely. Allow the agar to boil after liquification; incompletely melted agar looks liquid, but is...

  10. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi

    1996-09-01

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  11. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  12. A Cost Effective Multi-Spectral Scanner for Natural Gas Detection

    Energy Technology Data Exchange (ETDEWEB)

    Yudaya Sivathanu; Jongmook Lim; Vinoo Narayanan; Seonghyeon Park

    2005-12-07

    The objective of this project is to design, fabricate and demonstrate a cost effective, multi-spectral scanner for natural gas leak detection in transmission and distribution pipelines. During the first year of the project, a laboratory version of the multi-spectral scanner was designed, fabricated, and tested at EnUrga Inc. The multi-spectral scanner was also evaluated using a blind Department of Energy study at the Rocky Mountain Oilfield Testing Center. The performance of the scanner was inconsistent during the blind study. However, most of the leaks were outside the view of the multi-spectral scanner that was developed during the first year of the project. Therefore, a definite evaluation of the capability of the scanner was not obtained. Despite the results, sufficient number of plumes was detected fully confirming the feasibility of the multi-spectral scanner. During the second year, the optical design of the scanner was changed to improve the sensitivity of the system. Laboratory tests show that the system can reliably detect small leaks (20 SCFH) at 30 to 50 feet. A prototype scanner was built and evaluated during the second year of the project. Only laboratory evaluations were completed during the second year. The laboratory evaluations show the feasibility of using the scanner to determine natural gas pipeline leaks. Further field evaluations and optimization of the scanner are required before commercialization of the scanner can be initiated.

  13. Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases

    Directory of Open Access Journals (Sweden)

    Safrany Stephen T

    2002-07-01

    Full Text Available Abstract Background The human genome contains at least 18 genes for Nudix hydrolase enzymes. Many have similar functions to one another. In order to understand their roles in cell physiology, these proteins must be characterised. Results We have characterised two novel human gene products, hAps1, encoded by the NUDT11 gene, and hAps2, encoded by the NUDT10 gene. These cytoplasmic proteins are members of the DIPP subfamily of Nudix hydrolases, and differ from each other by a single amino acid. Both metabolise diadenosine-polyphosphates and, weakly, diphosphoinositol polyphosphates. An apparent polymorphism of hAps1 has also been identified, which leads to the point mutation S39N. This has also been characterised. The favoured nucleotides were diadenosine 5',5"'-pentaphosphate (kcat/Km = 11, 8 and 16 × 103M-1s-1 respectively for hAps1, hAps1-39N and hAps2 and diadenosine 5',5"'-hexaphosphate (kcat/Km = 13, 14 and 11 × 103M-1s-1 respectively for hAps1, hAps1-39N and hAps2. Both hAps1 and hAps2 had pH optima of 8.5 and an absolute requirement for divalent cations, with manganese (II being favoured. Magnesium was not able to activate the enzymes. Therefore, these enzymes could be acutely regulated by manganese fluxes within the cell. Conclusions Recent gene duplication has generated the two Nudix genes, NUDT11 and NUDT10. We have characterised their gene products as the closely related Nudix hydrolases, hAps1 and hAps2. These two gene products complement the activity of previously described members of the DIPP family, and reinforce the concept that Ap5A and Ap6A act as intracellular messengers.

  14. Create Your Plate

    Medline Plus

    Full Text Available ... blood glucose levels and lose weight. With this method, you fill your plate with more non-starchy ... but changes the portion sizes so you are getting larger portions of non-starchy vegetables and a ...

  15. Create Your Plate

    Medline Plus

    Full Text Available ... blood glucose levels and lose weight. With this method, you fill your plate with more non-starchy ... 4/Box) Taking the guesswork out of portion control has never been easier. It can be a ...

  16. Tectonic Plate Movement.

    Science.gov (United States)

    Landalf, Helen

    1998-01-01

    Presents an activity that employs movement to enable students to understand concepts related to plate tectonics. Argues that movement brings topics to life in a concrete way and helps children retain knowledge. (DDR)

  17. MyPlate

    Science.gov (United States)

    ... our stage of life, situations, preferences, access to food, culture, traditions, and the personal decisions we make over time. All your food and beverage choices count. MyPlate offers ideas and ...

  18. Create Your Plate

    Medline Plus

    Full Text Available ... blood glucose levels and lose weight. With this method, you fill your plate with more non-starchy ... you have an easy portion control solution that works. Last Reviewed: October 8, 2015 Last Edited: September ...

  19. Designing Assemblies Of Plates

    Science.gov (United States)

    Williams, F. W.; Kennedy, D.; Butler, R.; Aston, G.; Anderson, M. S.

    1992-01-01

    VICONOPT calculates vibrations and instabilities of assemblies of prismatic plates. Designed for efficient, accurate analysis of buckling and vibration, and for optimum design of panels of composite materials. Written in FORTRAN 77.

  20. Create Your Plate

    Medline Plus

    Full Text Available ... Your Plate Gluten Free Diets Meal Planning for Vegetarian Diets Cook with Heart-Healthy Foods Holiday Meal Planning What Can I Eat? Making Healthy Food Choices Diabetes Superfoods Non-starchy Vegetables Grains and Starchy Vegetables ...

  1. Create Your Plate

    Medline Plus

    Full Text Available ... Recipes Association Cookbook Recipes Planning Meals Diabetes Meal Plans Create Your Plate Gluten Free Diets Meal Planning ... serving of dairy or both as your meal plan allows. Choose healthy fats in small amounts. For ...

  2. Create Your Plate

    Medline Plus

    Full Text Available ... 1 Diabetes Get Started Safely Get And Stay Fit Types of Activity Weight Loss Assess Your Lifestyle ... manage portion control wherever you are. Now, our best-selling, sectioned to-go plate with easy-sealing ...

  3. Create Your Plate

    Medline Plus

    Full Text Available ... Plate is a simple and effective way to manage your blood glucose levels and lose weight. With ... been easier. It can be a challenge to manage portion control wherever you are. Now, our best- ...

  4. Tectonic Plate Movement.

    Science.gov (United States)

    Landalf, Helen

    1998-01-01

    Presents an activity that employs movement to enable students to understand concepts related to plate tectonics. Argues that movement brings topics to life in a concrete way and helps children retain knowledge. (DDR)

  5. Create Your Plate

    Medline Plus

    Full Text Available ... Carbohydrates Carbohydrate Counting Make Your Carbs Count Glycemic ... to manage portion control wherever you are. Now, our best-selling, sectioned to-go plate with easy-sealing ...

  6. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S

    2007-01-01

    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  7. The APS control system network upgrade.

    Energy Technology Data Exchange (ETDEWEB)

    Sidorowicz, K. v.; Leibfritz, D.; McDowell, W. P.

    1999-10-22

    When it was installed,the Advanced Photon Source (APS) control system network was at the state-of-the-art. Different aspects of the system have been reported at previous meetings [1,2]. As loads on the controls network have increased due to newer and faster workstations and front-end computers, we have found performance of the system declining and have implemented an upgraded network. There have been dramatic advances in networking hardware in the last several years. The upgraded APS controls network replaces the original FDDI backbone and shared Ethernet hubs with redundant gigabit uplinks and fully switched 10/100 Ethernet switches with backplane fabrics in excess of 20 Gbits/s (Gbps). The central collapsed backbone FDDI concentrator has been replaced with a Gigabit Ethernet switch with greater than 30 Gbps backplane fabric. Full redundancy of the system has been maintained. This paper will discuss this upgrade and include performance data and performance comparisons with the original network.

  8. The Electronic ApJ in Context

    Science.gov (United States)

    Biemesderfer, C. D.

    1995-12-01

    The on-line edition of the Astrophysical Journal provides the first opportunity for astronomical researchers to interact with the literature in a network context. Other electronic journals will follow. Astronomers will continue to develop ways to take advantage of information on the network, and these will be most effective when ApJ articles, observations from data centers, proposals for telescope time, communications with collaborators, and so on, are meshed. Astronomical literature, as a resource on the Internet, is not unique from the viewpoint of function or management, and astronomers are not unique as scholars in their desire to use the Internet as a tool to advance their work. We need to ensure as a community that all our resources for research --- journals and data --- fit in a global context on an Internet being used by everyone. In other words, we have to be sure that the ApJ fits into all the digital libraries of the future, including the ones we don't build. This paper will present a scenario in which many varied forms of information, astronomical and otherwise, can be catalogued and distributed so that they can be discovered and used by the research community.

  9. Origami - Folded Plate Structures

    OpenAIRE

    Buri, Hans Ulrich

    2010-01-01

    This research investigates new methods of designing folded plate structures that can be built with cross-laminated timber panels. Folded plate structures are attractive to both architects and engineers for their structural, spatial, and plastic qualities. Thin surfaces can be stiffened by a series of folds, and thus not only cover space, but also act as load bearing elements. The variation of light and shadow along the folded faces emphasizes the plas...

  10. Fractal multifiber microchannel plates

    Science.gov (United States)

    Cook, Lee M.; Feller, W. B.; Kenter, Almus T.; Chappell, Jon H.

    1992-01-01

    The construction and performance of microchannel plates (MCPs) made using fractal tiling mehtods are reviewed. MCPs with 40 mm active areas having near-perfect channel ordering were produced. These plates demonstrated electrical performance characteristics equivalent to conventionally constructed MCPs. These apparently are the first MCPs which have a sufficiently high degree of order to permit single channel addressability. Potential applications for these devices and the prospects for further development are discussed.

  11. Object 3D surface reconstruction approach using portable laser scanner

    Science.gov (United States)

    Xu, Ning; Zhang, Wei; Zhu, Liye; Li, Changqing; Wang, Shifeng

    2017-06-01

    The environment perception plays the key role for a robot system. The 3D surface of the objects can provide essential information for the robot to recognize objects. This paper present an approach to reconstruct objects' 3D surfaces using a portable laser scanner we designed which consists of a single-layer laser scanner, an encoder, a motor, power supply and mechanical components. The captured point cloud data is processed to remove the discrete points, denoise filtering, stitching and registration. Then the triangular mesh generation of point cloud is accomplished by using Gaussian bilateral filtering, ICP real-time registration and greedy triangle projection algorithm. The experiment result shows the feasibility of the device designed and the algorithm proposed.

  12. Alignment and resolution studies of a MARS scanner

    CERN Document Server

    Butler, A P; Bell, S T; Chelkov, G; Demichev, M; Gongadze, A; Kotov, S; Kozhevnikov, D; Kruchonak, U; Potrap, I; Smolyanskiy, P; Zhemchugov, A

    2015-01-01

    The MARS scanner is designed for the x-ray spectroscopic study of samples with the aid of computer tomography methods. Computer tomography allows the reconstruction of slices of an investigated sample using a set of shadow projections obtained for different angles. Projections in the MARS scanner are produced using a cone x-ray beam geometry. Correct reconstruction in this scheme requires precise knowledge of several geometrical parameters of a tomograph, such as displacement of a rotation axis, x-ray source position with respect to a camera, and camera inclinations. Use of inaccurate parameters leads to a poor sample reconstruction. Non-ideal positioning of camera, x-ray source and cylindrical rotating frame (gantry) itself on which these parts are located, leads to the need for tomograph alignment. In this note we describe the alignment procedure that was used to get different geometrical corrections for the reconstruction. Also, several different estimations of the final spatial resolution for reconstructe...

  13. Lensless image scanner using multilayered aperture array for noncontact imaging

    Science.gov (United States)

    Kawano, Hiroyuki

    2016-10-01

    We propose a new imaging system of a simple structure that uses a set of layered aperture arrays above a linear image sensor instead of an imaging lens. The image scanner transfers the image information by detecting the scattering rays from the object directly without any collecting power, as if it were an optical stamp. Since the aperture arrays shield the stray rays propagating obliquely, the image information can be read with high resolution even if the object floats within a few millimeters. The aperture arrays with staggered alignment in two lines widen the space with the adjacent pixel without decimating information. We manufactured a prototype model of 300-dpi resolution, whose height is as little as 5 mm. The experimental result shows that ghost images can be restricted sufficiently, and our scanner can clearly read an object within a space of <3.5 mm, meaning that it has a large depth of field of 3.5 mm.

  14. Robust Object Segmentation Using a Multi-Layer Laser Scanner

    Directory of Open Access Journals (Sweden)

    Beomseong Kim

    2014-10-01

    Full Text Available The major problem in an advanced driver assistance system (ADAS is the proper use of sensor measurements and recognition of the surrounding environment. To this end, there are several types of sensors to consider, one of which is the laser scanner. In this paper, we propose a method to segment the measurement of the surrounding environment as obtained by a multi-layer laser scanner. In the segmentation, a full set of measurements is decomposed into several segments, each representing a single object. Sometimes a ghost is detected due to the ground or fog, and the ghost has to be eliminated to ensure the stability of the system. The proposed method is implemented on a real vehicle, and its performance is tested in a real-world environment. The experiments show that the proposed method demonstrates good performance in many real-life situations.

  15. Robust object segmentation using a multi-layer laser scanner.

    Science.gov (United States)

    Kim, Beomseong; Choi, Baehoon; Yoo, Minkyun; Kim, Hyunju; Kim, Euntai

    2014-10-29

    The major problem in an advanced driver assistance system (ADAS) is the proper use of sensor measurements and recognition of the surrounding environment. To this end, there are several types of sensors to consider, one of which is the laser scanner. In this paper, we propose a method to segment the measurement of the surrounding environment as obtained by a multi-layer laser scanner. In the segmentation, a full set of measurements is decomposed into several segments, each representing a single object. Sometimes a ghost is detected due to the ground or fog, and the ghost has to be eliminated to ensure the stability of the system. The proposed method is implemented on a real vehicle, and its performance is tested in a real-world environment. The experiments show that the proposed method demonstrates good performance in many real-life situations.

  16. Photoacoustic imaging using an 8-beam Fabry-Perot scanner

    Science.gov (United States)

    Huynh, Nam; Ogunlade, Olumide; Zhang, Edward; Cox, Ben; Beard, Paul

    2016-03-01

    The planar Fabry Perot (FP) photoacoustic scanner has been shown to provide exquisite high resolution 3D images of soft tissue structures in vivo to depths up to approximately 10mm. However a significant limitation of current embodiments of the concept is low image acquisition speed. To increase acquisition speed, a novel multi-beam scanner architecture has been developed. This enables a line of equally spaced 8 interrogation beams to be scanned simultaneously across the FP sensor and the photoacoustic signals detected in parallel. In addition, an excitation laser operating at 200Hz was used. The combination of parallelising the detection and the high pulse repetition frequency (PRF) of the excitation laser has enabled dramatic reductions in image acquisition time to be achieved. A 3D image can now be acquired in 10 seconds and 2D images at video rates are now possible.

  17. Acoustic noise reduction in a 4 T MRI scanner.

    Science.gov (United States)

    Mechefske, Chris K; Geris, Ryan; Gati, Joseph S; Rutt, Brian K

    2002-01-01

    High-field, high-speed magnetic resonance imaging (MRI) can generate high levels of noise. There is ongoing concern in the medical and imaging research communities regarding the detrimental effects of high acoustic levels on auditory function, patient anxiety, verbal communication between patients and health care workers and ultimately MR image quality. In order to effectively suppress the noise levels inside MRI scanners, the sound field needs to be accurately measured and characterized. This paper presents the results of measurements of the sound radiation from a gradient coil cylinder within a 4 T MRI scanner under a variety of conditions. These measurement results show: (1) that noise levels can be significantly reduced through the use of an appropriately designed passive acoustic liner; and (2) the true noise levels that are experienced by patients during echo planar imaging.

  18. Wire Scanner Beam Profile Measurements: LANSCE Facility Beam Development

    Energy Technology Data Exchange (ETDEWEB)

    Gilpatrick, John D. [Los Alamos National Laboratory; Batygin, Yuri K. [Los Alamos National Laboratory; Gonzales, Fermin [Los Alamos National Laboratory; Gruchalla, Michael E. [Los Alamos National Laboratory; Kutac, Vincent G. [Los Alamos National Laboratory; Martinez, Derwin [Los Alamos National Laboratory; Sedillo, James Daniel [Los Alamos National Laboratory; Pillai, Chandra [Los Alamos National Laboratory; Rodriguez Esparza, Sergio [Los Alamos National Laboratory; Smith, Brian G. [Los Alamos National Laboratory

    2012-05-15

    The Los Alamos Neutron Science Center (LANSCE) is replacing Wire Scanner (WS) beam profile measurement systems. Three beam development tests have taken place to test the new wire scanners under beam conditions. These beam development tests have integrated the WS actuator, cable plant, electronics processors and associated software and have used H{sup -} beams of different beam energy and current conditions. In addition, the WS measurement-system beam tests verified actuator control systems for minimum profile bin repeatability and speed, checked for actuator backlash and positional stability, tested the replacement of simple broadband potentiometers with narrow band resolvers, and tested resolver use with National Instruments Compact Reconfigurable Input and Output (cRIO) Virtual Instrumentation. These beam tests also have verified how trans-impedance amplifiers react with various types of beam line background noise and how noise currents were not generated. This paper will describe these beam development tests and show some resulting data.

  19. AP1000进度管理研究%The study on AP1000 Schedule management

    Institute of Scientific and Technical Information of China (English)

    李阳; 王飞鸣

    2015-01-01

    核电建设进度管理非常重要,本文针对核电站进度管理的内容、体系、管理方式等进行介绍,并结合AP1000核电技术的特点——模块化,分析其对进度管理的影响和目前存在的问题。并结合影响和问题提出了在后续AP1000建设进度管理中的几项建议。%Nuclear power plant construction progress management is very important. This paper addresses important topics including the content, system and manage methods of nuclear power plants construction. Combining the characteristics of AP1000 nuclear power technology-modular, the paper analyzed its impact on progress management and the existing problems. Depending on the impacts and problems, the paper also raised several suggestions in AP1000 modular construction.

  20. Trichomonas vaginalis: the adhesins AP51 and AP65 bind heme and hemoglobin.

    Science.gov (United States)

    Ardalan, Shahed; Lee, B Craig; Garber, Gary E

    2009-04-01

    Trichomonas vaginalis is the cause of human trichomoniasis, the most common non-viral sexually transmitted disease worldwide. Although acquisition of iron by binding to host hemoglobin through distinct receptor(s) has been described, no specific heme- or hemoglobin-binding site has been reported in this parasite. To determine the presence of hemoglobin-binding protein(s), membrane proteins were subjected to hemoglobin-affinity chromatography. Eluted proteins were analysed by SDS-PAGE. Two protein bands of 48 and 63 kDa were detected. Competition assay with an excess amount of hemoglobin or hemin in hemoglobin-affinity chromatography could block the 63- and 48-kDa bands, respectively. Further analysis by mass spectrometry indicated that the 48- and 63-kDa proteins had identity with two T. vaginalis adhesins: AP51 and AP65, respectively. This study confirms the existence of multifunctional proteins in T. vaginalis, and suggested that AP51 and AP65, besides serving as adhesion molecules, could also act as heme- and hemoglobin-binding proteins.

  1. Vibration and Buckling of Web Plate of the Plate Girder

    OpenAIRE

    高橋, 和雄; 呉, 明強; 中澤, 聡志; 筑紫, 宏之

    1998-01-01

    The vibration and buckling of the web of the plate girder are studied in this paper. The small deflection theory of the thin plate is used. The finite strip method is employed to solve vibration and buckling of the plate girder. Natural frequenies of buckling properties are shown for various plate girder bridges.

  2. Experimental characterization of the Clear-PEM scanner spectrometric performance

    Science.gov (United States)

    Bugalho, R.; Carriço, B.; Ferreira, C. S.; Frade, M.; Ferreira, M.; Moura, R.; Ortigão, C.; Pinheiro, J. F.; Rodrigues, P.; Rolo, I.; Silva, J. C.; Trindade, A.; Varela, J.

    2009-10-01

    In the framework of the Clear-PEM project for the construction of a high-resolution and high-specificity scanner for breast cancer imaging, a Positron Emission Mammography tomograph has been developed and installed at the Instituto Português de Oncologia do Porto hospital. The Clear-PEM scanner is mainly composed by two planar detector heads attached to a robotic arm, trigger/data acquisition electronics system and computing servers. The detector heads hold crystal matrices built from 2 × 2 × 20 mm3 LYSO:Ce crystals readout by Hamamatsu S8550 APD arrays. The APDs are optically coupled to both ends of the 6144 crystals in order to extract the DOI information for each detected event. Each one of 12288 APD's pixels is read and controlled by Application Specific Integrated Circuits water-cooled by an external cooling unit. The Clear-PEM frontend boards innovative design results in a unprecedented integration of the crystal matrices, APDs and ASICs, making Clear-PEM the PET scanner with the highest number of APD pixels ever integrated so far. In this paper, the scanner's main technical characteristics, calibration strategies and the first spectrometric performance evaluation in a clinical environment are presented. The first commissioning results show 99.7% active channels, which, after calibration, have inter-pixel and absolute gain distributions with dispersions of, respectively, 12.2% and 15.3%, demonstrating that despite the large number of channels, the system is uniform. The mean energy resolution at 511 keV is of 15.9%, with a 8.8% dispersion, and the mean CDOI-1 is 5.9%/mm, with a 7.8% dispersion. The coincidence time resolution, at 511 keV, for a energy window between 400 and 600 keV, is 5.2 ns FWHM.

  3. Scanner tags, comic book piracy and participatory culture

    OpenAIRE

    Delwiche, Aaron

    2014-01-01

    To learn more about the motivations of individuals who scan and distribute comic books, this study reports findings from a content analysis of 389 scanner tags extracted from comic books posted on the torrent network Pirate Bay. Coded according to four categories linked to the literature on comic fandom and participatory culture, tags were analyzed in terms of recognition, aesthetic style, textual signifiers, and visual signifiers. Though comic book pirates seek recognition from their peers, ...

  4. Dynamic 3D computed tomography scanner for vascular imaging

    Science.gov (United States)

    Lee, Mark K.; Holdsworth, David W.; Fenster, Aaron

    2000-04-01

    A 3D dynamic computed-tomography (CT) scanner was developed for imaging objects undergoing periodic motion. The scanner system has high spatial and sufficient temporal resolution to produce quantitative tomographic/volume images of objects such as excised arterial samples perfused under physiological pressure conditions and enables the measurements of the local dynamic elastic modulus (Edyn) of the arteries in the axial and longitudinal directions. The system was comprised of a high resolution modified x-ray image intensifier (XRII) based computed tomographic system and a computer-controlled cardiac flow simulator. A standard NTSC CCD camera with a macro lens was coupled to the electro-optically zoomed XRII to acquire dynamic volumetric images. Through prospective cardiac gating and computer synchronized control, a time-resolved sequence of 20 mm thick high resolution volume images of porcine aortic specimens during one simulated cardiac cycle were obtained. Performance evaluation of the scanners illustrated that tomographic images can be obtained with resolution as high as 3.2 mm-1 with only a 9% decrease in the resolution for objects moving at velocities of 1 cm/s in 2D mode and static spatial resolution of 3.55 mm-1 with only a 14% decrease in the resolution in 3D mode for objects moving at a velocity of 10 cm/s. Application of the system for imaging of intact excised arterial specimens under simulated physiological flow/pressure conditions enabled measurements of the Edyn of the arteries with a precision of +/- kPa for the 3D scanner. Evaluation of the Edyn in the axial and longitudinal direction produced values of 428 +/- 35 kPa and 728 +/- 71 kPa, demonstrating the isotropic and homogeneous viscoelastic nature of the vascular specimens. These values obtained from the Dynamic CT systems were not statistically different (p less than 0.05) from the values obtained by standard uniaxial tensile testing and volumetric measurements.

  5. Whole brain CT perfusion on a 320-slice CT scanner

    Directory of Open Access Journals (Sweden)

    Jai Jai Shiva Shankar

    2011-01-01

    Full Text Available Computed tomography perfusion (CTP has been criticized for limited brain coverage. This may result in inadequate coverage of the lesion, inadequate arterial input function, or omission of the lesion within the target perfusion volume. The availability of 320-slice CT scanners offers whole brain coverage. This minimizes the chances of misregistration of lesions regardless of location, and makes the selection of the arterial input function easy. We present different clinical scenarios in which whole brain CTP is especially useful.

  6. Software platform for simulation of a prototype proton CT scanner.

    Science.gov (United States)

    Giacometti, Valentina; Bashkirov, Vladimir A; Piersimoni, Pierluigi; Guatelli, Susanna; Plautz, Tia E; Sadrozinski, Hartmut F-W; Johnson, Robert P; Zatserklyaniy, Andriy; Tessonnier, Thomas; Parodi, Katia; Rosenfeld, Anatoly B; Schulte, Reinhard W

    2017-03-01

    Proton computed tomography (pCT) is a promising imaging technique to substitute or at least complement x-ray CT for more accurate proton therapy treatment planning as it allows calculating directly proton relative stopping power from proton energy loss measurements. A proton CT scanner with a silicon-based particle tracking system and a five-stage scintillating energy detector has been completed. In parallel a modular software platform was developed to characterize the performance of the proposed pCT. The modular pCT software platform consists of (1) a Geant4-based simulation modeling the Loma Linda proton therapy beam line and the prototype proton CT scanner, (2) water equivalent path length (WEPL) calibration of the scintillating energy detector, and (3) image reconstruction algorithm for the reconstruction of the relative stopping power (RSP) of the scanned object. In this work, each component of the modular pCT software platform is described and validated with respect to experimental data and benchmarked against theoretical predictions. In particular, the RSP reconstruction was validated with both experimental scans, water column measurements, and theoretical calculations. The results show that the pCT software platform accurately reproduces the performance of the existing prototype pCT scanner with a RSP agreement between experimental and simulated values to better than 1.5%. The validated platform is a versatile tool for clinical proton CT performance and application studies in a virtual setting. The platform is flexible and can be modified to simulate not yet existing versions of pCT scanners and higher proton energies than those currently clinically available. © 2017 American Association of Physicists in Medicine.

  7. Building a 3D scanner system based on monocular vision.

    Science.gov (United States)

    Zhang, Zhiyi; Yuan, Lin

    2012-04-10

    This paper proposes a three-dimensional scanner system, which is built by using an ingenious geometric construction method based on monocular vision. The system is simple, low cost, and easy to use, and the measurement results are very precise. To build it, one web camera, one handheld linear laser, and one background calibration board are required. The experimental results show that the system is robust and effective, and the scanning precision can be satisfied for normal users.

  8. Experimental characterization of the Clear-PEM scanner spectrometric performance

    Energy Technology Data Exchange (ETDEWEB)

    Bugalho, R; Carrico, B; Ferreira, C S; Frade, M; Ferreira, M; Moura, R; Ortigao, C; Pinheiro, J F; Rodrigues, P; Rolo, I; Silva, J C; Trindade, A; Varela, J [Laboratorio de Instrumentacao e Fisica Experimental de Particulas (LIP), Av. Elias Garcia 14-1, 1000-149 Lisboa (Portugal)], E-mail: frade@lip.pt

    2009-10-15

    In the framework of the Clear-PEM project for the construction of a high-resolution and high-specificity scanner for breast cancer imaging, a Positron Emission Mammography tomograph has been developed and installed at the Instituto Portugues de Oncologia do Porto hospital. The Clear-PEM scanner is mainly composed by two planar detector heads attached to a robotic arm, trigger/data acquisition electronics system and computing servers. The detector heads hold crystal matrices built from 2 x 2 x 20 mm{sup 3} LYSO:Ce crystals readout by Hamamatsu S8550 APD arrays. The APDs are optically coupled to both ends of the 6144 crystals in order to extract the DOI information for each detected event. Each one of 12288 APD's pixels is read and controlled by Application Specific Integrated Circuits water-cooled by an external cooling unit. The Clear-PEM frontend boards innovative design results in a unprecedented integration of the crystal matrices, APDs and ASICs, making Clear-PEM the PET scanner with the highest number of APD pixels ever integrated so far. In this paper, the scanner's main technical characteristics, calibration strategies and the first spectrometric performance evaluation in a clinical environment are presented. The first commissioning results show 99.7% active channels, which, after calibration, have inter-pixel and absolute gain distributions with dispersions of, respectively, 12.2% and 15.3%, demonstrating that despite the large number of channels, the system is uniform. The mean energy resolution at 511 keV is of 15.9%, with a 8.8% dispersion, and the mean C{sub DOI}{sup -1} is 5.9%/mm, with a 7.8% dispersion. The coincidence time resolution, at 511 keV, for a energy window between 400 and 600 keV, is 5.2 ns FWHM.

  9. A simulation study of a dual-plate in-room PET system for dose verification in carbon ion therapy

    CERN Document Server

    Chen, Ze; Xiao, Guo-Qing; Chen, Jin-Da; Zhang, Xiu-Ling; Guo, Zhong-Yan; Sun, Zhi-Yu; Huang, Wen-Xue; Wang, Jian-Song

    2013-01-01

    Carbon ion therapy have the ability to overcome the limitation of convertional radiotherapy due to its most energy deposition in selective depth, usually called Bragg peak, which results in increased biological effectiness. During carbon ion therapy, lots positron emitters such as $^{11}$C, $^{15}$O, $^{10}$C are generated in irradiated tissues by nuclear reactions. Immediately after patient irradiation, PET scanners can be used to measure the spatial distribution of positron emitters, which can track the carbon beam to the tissue. In this study, we designed and evaluated an dual-plate in-room PET scanner to monitor patient dose in carbon ion therapy, which is based on GATE simulation platform. A dual-plate PET is designed to avoid interference with the carbon beam line and with patient positioning. Its performance was compared with that of four-head and full-ring PET scanners. The dual-plate, four-head and full-ring PET scanners consisted of 30, 60, 60 detector modules, respectively, with a 36 cm distance be...

  10. Visual stimulus presentation using fiber optics in the MRI scanner.

    Science.gov (United States)

    Huang, Ruey-Song; Sereno, Martin I

    2008-03-30

    Imaging the neural basis of visuomotor actions using fMRI is a topic of increasing interest in the field of cognitive neuroscience. One challenge is to present realistic three-dimensional (3-D) stimuli in the subject's peripersonal space inside the MRI scanner. The stimulus generating apparatus must be compatible with strong magnetic fields and must not interfere with image acquisition. Virtual 3-D stimuli can be generated with a stereo image pair projected onto screens or via binocular goggles. Here, we describe designs and implementations for automatically presenting physical 3-D stimuli (point-light targets) in peripersonal and near-face space using fiber optics in the MRI scanner. The feasibility of fiber-optic based displays was demonstrated in two experiments. The first presented a point-light array along a slanted surface near the body, and the second presented multiple point-light targets around the face. Stimuli were presented using phase-encoded paradigms in both experiments. The results suggest that fiber-optic based displays can be a complementary approach for visual stimulus presentation in the MRI scanner.

  11. Using Laser Scanners to Augment the Systematic Error Pointing Model

    Science.gov (United States)

    Wernicke, D. R.

    2016-08-01

    The antennas of the Deep Space Network (DSN) rely on precise pointing algorithms to communicate with spacecraft that are billions of miles away. Although the existing systematic error pointing model is effective at reducing blind pointing errors due to static misalignments, several of its terms have a strong dependence on seasonal and even daily thermal variation and are thus not easily modeled. Changes in the thermal state of the structure create a separation from the model and introduce a varying pointing offset. Compensating for this varying offset is possible by augmenting the pointing model with laser scanners. In this approach, laser scanners mounted to the alidade measure structural displacements while a series of transformations generate correction angles. Two sets of experiments were conducted in August 2015 using commercially available laser scanners. When compared with historical monopulse corrections under similar conditions, the computed corrections are within 3 mdeg of the mean. However, although the results show promise, several key challenges relating to the sensitivity of the optical equipment to sunlight render an implementation of this approach impractical. Other measurement devices such as inclinometers may be implementable at a significantly lower cost.

  12. Determining the surface roughness coefficient by 3D Scanner

    Directory of Open Access Journals (Sweden)

    Karmen Fifer Bizjak

    2010-12-01

    Full Text Available Currently, several test methods can be used in the laboratory to determine the roughness of rock joint surfaces.However, true roughness can be distorted and underestimated by the differences in the sampling interval of themeasurement methods. Thus, these measurement methods produce a dead zone and distorted roughness profiles.In this paper a new rock joint surface roughness measurement method is presented, with the use of a camera-typethree-dimensional (3D scanner as an alternative to current methods. For this study, the surfaces of ten samples oftuff were digitized by means of a 3D scanner, and the results were compared with the corresponding Rock JointCoefficient (JRC values. Up until now such 3D scanner have been mostly used in the automotive industry, whereastheir use for comparison with obtained JRC coefficient values in rock mechanics is presented here for the first time.The proposed new method is a faster, more precise and more accurate than other existing test methods, and is apromising technique for use in this area of study in the future.

  13. Development of a high resolution module for PET scanners

    Science.gov (United States)

    Stringhini, G.; Pizzichemi, M.; Ghezzi, A.; Stojkovic, A.; Tavernier, S.; Niknejad, T.; Varela, J.; Paganoni, M.; Auffray, E.

    2017-02-01

    Positron Emission Tomography (PET) scanners require high performances in term of spatial resolution and sensitivity to allow early detection of cancer masses. In small animal and organ dedicated PET scanners the Depth of Interaction (DOI) information has to be obtained to avoid parallax errors and to reconstruct high resolution images. In the whole body PET, the DOI information can be useful to correct for the time jitter of the optical photons along the main axis of the scintillator, improving the time performances. In this work we present the development of PET module designed to reach high performance as compared to the current scanners while keeping the complexity of the system reasonably low. The module presented is based on a 64 LYSO (Lutetium-yttrium oxyorthosilicate) crystals matrix and on a 4×4 MPPC (Multi Pixels Photon Counter) array as detector in a 4 to 1 coupling between the crystals and the detector and a single side readout. The lateral surfaces of the crystals are optically treated to be unpolished. The DOI and the energy resolution of the PET module are presented and a fast method to obtain the DOI calibration is discussed.

  14. Advanced optical 3D scanners using DMD technology

    Science.gov (United States)

    Muenstermann, P.; Godding, R.; Hermstein, M.

    2017-02-01

    Optical 3D measurement techniques are state-of-the-art for highly precise, non-contact surface scanners - not only in industrial development, but also in near-production and even in-line configurations. The need for automated systems with very high accuracy and clear implementation of national precision standards is growing extremely due to expanding international quality guidelines, increasing production transparency and new concepts related to the demands of the fourth industrial revolution. The presentation gives an overview about the present technical concepts for optical 3D scanners and their benefit for customers and various different applications - not only in quality control, but also in design centers or in medical applications. The advantages of DMD-based systems will be discussed and compared to other approaches. Looking at today's 3D scanner market, there is a confusing amount of solutions varying from lowprice solutions to high end systems. Many of them are linked to a very special target group or to special applications. The article will clarify the differences of the approaches and will discuss some key features which are necessary to render optical measurement systems suitable for industrial environments. The paper will be completed by examples for DMDbased systems, e. g. RGB true-color systems with very high accuracy like the StereoScan neo of AICON 3D Systems. Typical applications and the benefits for customers using such systems are described.

  15. An endoscopic 3D scanner based on structured light.

    Science.gov (United States)

    Schmalz, Christoph; Forster, Frank; Schick, Anton; Angelopoulou, Elli

    2012-07-01

    We present a new endoscopic 3D scanning system based on Single Shot Structured Light. The proposed design makes it possible to build an extremely small scanner. The sensor head contains a catadioptric camera and a pattern projection unit. The paper describes the working principle and calibration procedure of the sensor. The prototype sensor head has a diameter of only 3.6mm and a length of 14mm. It is mounted on a flexible shaft. The scanner is designed for tubular cavities and has a cylindrical working volume of about 30mm length and 30mm diameter. It acquires 3D video at 30 frames per second and typically generates approximately 5000 3D points per frame. By design, the resolution varies over the working volume, but is generally better than 200μm. A prototype scanner has been built and is evaluated in experiments with phantoms and biological samples. The recorded average error on a known test object was 92μm.

  16. Parallel plate model for trabecular bone exhibits volume fraction-dependant bias

    DEFF Research Database (Denmark)

    Day, J; Ding, Ming; Odgaard, A;

    2000-01-01

    Unbiased stereological methods were used in conjunction with microcomputed tomographic (micro-CT) scans of human and animal bone to investigate errors created when the parallel plate model was used to calculate morphometric parameters. Bone samples were obtained from the human proximal tibia......, canine distal femur, rat tail, and pig spine and scanned in a micro-CT scanner. Trabecular thickness, trabecular spacing, and trabecular number were calculated using the parallel plate model. Direct thickness, and spacing and connectivity density were calculated using unbiased three-dimensional methods...

  17. Efficient system modeling for a small animal PET scanner with tapered DOI detectors.

    Science.gov (United States)

    Zhang, Mengxi; Zhou, Jian; Yang, Yongfeng; Rodríguez-Villafuerte, Mercedes; Qi, Jinyi

    2016-01-21

    A prototype small animal positron emission tomography (PET) scanner for mouse brain imaging has been developed at UC Davis. The new scanner uses tapered detector arrays with depth of interaction (DOI) measurement. In this paper, we present an efficient system model for the tapered PET scanner using matrix factorization and a virtual scanner geometry. The factored system matrix mainly consists of two components: a sinogram blurring matrix and a geometrical matrix. The geometric matrix is based on a virtual scanner geometry. The sinogram blurring matrix is estimated by matrix factorization. We investigate the performance of different virtual scanner geometries. Both simulation study and real data experiments are performed in the fully 3D mode to study the image quality under different system models. The results indicate that the proposed matrix factorization can maintain image quality while substantially reduce the image reconstruction time and system matrix storage cost. The proposed method can be also applied to other PET scanners with DOI measurement.

  18. Performance of an improved first generation optical CT scanner for 3D dosimetry.

    Science.gov (United States)

    Qian, Xin; Adamovics, John; Wuu, Cheng-Shie

    2013-12-21

    Performance analysis of a modified 3D dosimetry optical scanner based on the first generation optical CT scanner OCTOPUS is presented. The system consists of PRESAGE dosimeters, the modified 3D scanner, and a new developed in-house user control panel written in Labview program which provides more flexibility to optimize mechanical control and data acquisition technique. The total scanning time has been significantly reduced from initial 8 h to ∼2 h by using the modified scanner. The functional performance of the modified scanner has been evaluated in terms of the mechanical integrity uncertainty of the data acquisition process. Optical density distribution comparison between the modified scanner, OCTOPUS and the treatment plan system has been studied. It has been demonstrated that the agreement between the modified scanner and treatment plans is comparable with that between the OCTOPUS and treatment plans.

  19. Bending and stretching of plates

    CERN Document Server

    Mansfield, E H; Hemp, W S

    1964-01-01

    The Bending and Stretching of Plates deals with elastic plate theory, particularly on small- and large-deflexion theory. Small-deflexion theory concerns derivation of basic equations, rectangular plates, plates of various shapes, plates whose boundaries are amenable to conformal transformation, plates with variable rigidity, and approximate methods. Large-deflexion theory includes general equations and some exact solutions, approximate methods in large-deflexion theory, asymptotic large-deflexion theories for very thin plates. Asymptotic theories covers membrane theory, tension field theory, a

  20. Proximal femoral canal shape is more accurately assessed on AP hip radiographs than AP pelvis radiographs in primary hip osteoarthritis.

    Science.gov (United States)

    Merle, Christian; Waldstein, Wenzel; Gregory, Jennifer S; Goodyear, Simon R; Aspden, Richard M; Aldinger, Peter R; Murray, David W; Gill, Harinderjit S

    2013-01-01

    The objectives of the present study were to determine whether differences in the radiographic appearance of the of the proximal femoral canal exist on corresponding AP pelvis and AP hip radiographs, and whether radiographic assessment of canal shape is accurate with reference to computed tomography (CT). In a retrospective study, corresponding radiographs and CT scans of 100 consecutive patients with primary hip OA were evaluated. Active shape modelling (ASM) was performed to assess the variation in proximal femoral canal shape and to identify differences between AP hip and AP pelvis views. Differences in the medial cortical flare between radiographs and CT were quantified using least squares curve fitting. ASM identified significant differences in the assessment of canal shape on corresponding AP hip and AP pelvis views. Curve fitting demonstrated a good agreement between AP hip radiographs and CT. Agreement between AP pelvis radiographs and CT was less good. In contrast to AP pelvis radiographs, AP hip radiographs allow a more accurate and reliable assessment of proximal femoral canal shape in the frontal plane in primary hip OA. Our findings may improve stem fit in total hip arthroplasty without the routine use of CT.

  1. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models.

    Science.gov (United States)

    Badavi, Francis F; Walker, Steven A; Santos Koos, Lindsey M

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  2. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models

    Science.gov (United States)

    Badavi, Francis F.; Walker, Steven A.; Santos Koos, Lindsey M.

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  3. The Cryptosporidium parvum ApiAP2 gene family: insights into the evolution of apicomplexan AP2 regulatory systems.

    Science.gov (United States)

    Oberstaller, Jenna; Pumpalova, Yoanna; Schieler, Ariel; Llinás, Manuel; Kissinger, Jessica C

    2014-07-01

    We provide the first comprehensive analysis of any transcription factor family in Cryptosporidium, a basal-branching apicomplexan that is the second leading cause of infant diarrhea globally. AP2 domain-containing proteins have evolved to be the major regulatory family in the phylum to the exclusion of canonical regulators. We show that apicomplexan and perkinsid AP2 domains cluster distinctly from other chromalveolate AP2s. Protein-binding specificity assays of C. parvum AP2 domains combined with motif conservation upstream of co-regulated gene clusters allowed the construction of putative AP2 regulons across the in vitro life cycle. Orthologous Apicomplexan AP2 (ApiAP2) expression has been rearranged relative to the malaria parasite P. falciparum, suggesting ApiAP2 network rewiring during evolution. C. hominis orthologs of putative C. parvum ApiAP2 proteins and target genes show greater than average variation. C. parvum AP2 domains display reduced binding diversity relative to P. falciparum, with multiple domains binding the 5'-TGCAT-3', 5'-CACACA-3' and G-box motifs (5'-G[T/C]GGGG-3'). Many overrepresented motifs in C. parvum upstream regions are not AP2 binding motifs. We propose that C. parvum is less reliant on ApiAP2 regulators in part because it utilizes E2F/DP1 transcription factors. C. parvum may provide clues to the ancestral state of apicomplexan transcriptional regulation, pre-AP2 domination. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  4. Anterior cervical plating

    Directory of Open Access Journals (Sweden)

    Gonugunta V

    2005-01-01

    Full Text Available Although anterior cervical instrumentation was initially used in cervical trauma, because of obvious benefits, indications for its use have been expanded over time to degenerative cases as well as tumor and infection of the cervical spine. Along with a threefold increase in incidence of cervical fusion surgery, implant designs have evolved over the last three decades. Observation of graft subsidence and phenomenon of stress shielding led to the development of the new generation dynamic anterior cervical plating systems. Anterior cervical plating does not conclusively improve clinical outcome of the patients, but certainly enhances the efficacy of autograft and allograft fusion and lessens the rate of pseudoarthrosis and kyphosis after multilevel discectomy and fusions. A review of biomechanics, surgical technique, indications, complications and results of various anterior cervical plating systems is presented here to enable clinicians to select the appropriate construct design.

  5. Market analysis of APS/SCM applications and technologies

    OpenAIRE

    Prášil, Zdeněk

    2009-01-01

    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  6. ONLINE MINIMIZATION OF VERTICAL BEAM SIZES AT APS

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yipeng

    2017-06-25

    In this paper, online minimization of vertical beam sizes along the APS (Advanced Photon Source) storage ring is presented. A genetic algorithm (GA) was developed and employed for the online optimization in the APS storage ring. A total of 59 families of skew quadrupole magnets were employed as knobs to adjust the coupling and the vertical dispersion in the APS storage ring. Starting from initially zero current skew quadrupoles, small vertical beam sizes along the APS storage ring were achieved in a short optimization time of one hour. The optimization results from this method are briefly compared with the one from LOCO (Linear Optics from Closed Orbits) response matrix correction.

  7. License plate detection algorithm

    Science.gov (United States)

    Broitman, Michael; Klopovsky, Yuri; Silinskis, Normunds

    2013-12-01

    A novel algorithm for vehicle license plates localization is proposed. The algorithm is based on pixel intensity transition gradient analysis. Near to 2500 natural-scene gray-level vehicle images of different backgrounds and ambient illumination was tested. The best set of algorithm's parameters produces detection rate up to 0.94. Taking into account abnormal camera location during our tests and therefore geometrical distortion and troubles from trees this result could be considered as passable. Correlation between source data, such as license Plate dimensions and texture, cameras location and others, and parameters of algorithm were also defined.

  8. The effectiveness of a pre-procedural mouthrinse in reducing bacteria on radiographic phosphor plates

    Energy Technology Data Exchange (ETDEWEB)

    Hunter, Allison; Kalathingal, Sajitha; Shrout, Michael; Plummer, Kevin; Looney, Stephen [Georgia Regents University, College of Dental Medicine, Augusta (United States)

    2014-06-15

    This study assessed the effectiveness of three antimicrobial mouthrinses in reducing microbial growth on photostimulable phosphor (PSP) plates. Prior to performing a full-mouth radiographic survey (FMX), subjects were asked to rinse with one of the three test rinses (Listerine, Decapinol, or chlorhexidine oral rinse 0.12%) or to refrain from rinsing. Four PSP plates were sampled from each FMX through collection into sterile containers upon exiting the scanner. Flame-sterilized forceps were used to transfer the PSP plates onto blood agar plates (5% sheep blood agar). The blood agar plates were incubated at 37 degree C for up to 72 h. An environmental control blood agar plate was incubated with each batch. Additionally, for control, 25 gas-sterilized PSP plates were plated onto blood agar and analyzed. The mean number of bacterial colonies per plate was the lowest in the chlorhexidine group, followed by the Decapinol, Listerine, and the no rinse negative control groups. Only the chlorhexidine and Listerine groups were significantly different (p=0.005). No growth was observed for the 25 gas-sterilized control plates or the environmental control blood agar plates. The mean number of bacterial colonies was the lowest in the chlorhexidine group, followed by the Decapinol, Listerine, and the no rinse groups. Nonetheless, a statistically significant difference was found only in the case of Listerine. Additional research is needed to test whether a higher concentration (0.2%) or longer exposure period (two consecutive 30 s rinse periods) would be helpful in reducing PSP plate contamination further with chlorhexidine.

  9. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  10. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)

    李家杰

    2012-01-01

      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  11. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  12. Casimir force between metal plate and dielectric plate

    Institute of Scientific and Technical Information of China (English)

    刘中柱; 邵成刚; 罗俊

    1999-01-01

    The Casimir effect between metal plate and dielectric plate is discussed with 1+1-dimensional potential model without using cut-off method. Calculation shows that the Casimir force between metal plate and dielectric plate is determined not only by the potential V0, the dielectric thickness and the distance α between the metal plate and dielectric plate, but also by the dimension of the vessel. When α is far less than the dimension of the vessel, the Casimir force Fc∝α(-1); conversely Fc∝α-2. This result is significant for Casimir force experiment.

  13. Nuclear reactor alignment plate configuration

    Energy Technology Data Exchange (ETDEWEB)

    Altman, David A; Forsyth, David R; Smith, Richard E; Singleton, Norman R

    2014-01-28

    An alignment plate that is attached to a core barrel of a pressurized water reactor and fits within slots within a top plate of a lower core shroud and upper core plate to maintain lateral alignment of the reactor internals. The alignment plate is connected to the core barrel through two vertically-spaced dowel pins that extend from the outside surface of the core barrel through a reinforcement pad and into corresponding holes in the alignment plate. Additionally, threaded fasteners are inserted around the perimeter of the reinforcement pad and into the alignment plate to further secure the alignment plate to the core barrel. A fillet weld also is deposited around the perimeter of the reinforcement pad. To accomodate thermal growth between the alignment plate and the core barrel, a gap is left above, below and at both sides of one of the dowel pins in the alignment plate holes through with the dowel pins pass.

  14. Comparison of three-dimensional scanner systems for craniomaxillofacial imaging.

    Science.gov (United States)

    Knoops, Paul G M; Beaumont, Caroline A A; Borghi, Alessandro; Rodriguez-Florez, Naiara; Breakey, Richard W F; Rodgers, William; Angullia, Freida; Jeelani, N U Owase; Schievano, Silvia; Dunaway, David J

    2017-04-01

    Two-dimensional photographs are the standard for assessing craniofacial surgery clinical outcomes despite lacking three-dimensional (3D) depth and shape. Therefore, 3D scanners have been gaining popularity in various fields of plastic and reconstructive surgery, including craniomaxillofacial surgery. Head shapes of eight adult volunteers were acquired using four 3D scanners: 1.5T Avanto MRI, Siemens; 3dMDface System, 3dMD Inc.; M4D Scan, Rodin4D; and Structure Sensor, Occipital Inc. Accuracy was evaluated as percentage of data within a range of 2 mm from the 3DMDface System reconstruction, by surface-to-surface root mean square (RMS) distances, and with facial distance maps. Precision was determined by RMS. Relative to the 3dMDface System, accuracy was the highest for M4D Scan (90% within 2 mm; RMS of 0.71 mm ± 0.28 mm), followed by Avanto MRI (86%; 1.11 mm ± 0.33 mm) and Structure Sensor (80%; 1.33 mm ± 0.46). M4D Scan and Structure Sensor precision were 0.50 ± 0.04 mm and 0.51 ± 0.03 mm, respectively. Clinical and technical requirements govern scanner choice; however, 3dMDface System and M4D Scan provide high-quality results. It is foreseeable that compact, handheld systems will become more popular in the near future.

  15. Create Your Plate

    Medline Plus

    Full Text Available ... 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More Sites Search ≡ Are ... Fitness Home Food MyFoodAdvisor Recipes Association Cookbook Recipes Planning Meals Diabetes Meal Plans Create Your Plate Gluten ...

  16. Create Your Plate

    Medline Plus

    Full Text Available ... Create Your Plate is a simple and effective way to manage your blood glucose levels and lose weight. With ... year of delicious meals to help prevent and manage diabetes. Healthy Recipes: ... to your day with this guide. Ways to Give: Wear Your Cause on Your Sleeve - ...

  17. The Plate Tectonics Project

    Science.gov (United States)

    Hein, Annamae J.

    2011-01-01

    The Plate Tectonics Project is a multiday, inquiry-based unit that facilitates students as self-motivated learners. Reliable Web sites are offered to assist with lessons, and a summative rubric is used to facilitate the holistic nature of the project. After each topic (parts of the Earth, continental drift, etc.) is covered, the students will…

  18. Create Your Plate

    Medline Plus

    Full Text Available ... tax-deductible gift today can fund critical diabetes research and support vital diabetes education services that improve the ... way to manage your blood glucose levels and lose weight. With this method, you fill your plate with more non-starchy ...

  19. Create Your Plate

    Medline Plus

    Full Text Available ... 1 Type 2 About Us Online Community Meal Planning Sign In Search: Search More Sites Search ≡ Are ... Fitness Home Food MyFoodAdvisor Recipes Association Cookbook Recipes Planning Meals Diabetes Meal Plans Create Your Plate Gluten ...

  20. Create Your Plate

    Medline Plus

    Full Text Available ... tax-deductible gift today can fund critical diabetes research and support vital diabetes education services that improve the ... way to manage your blood glucose levels and lose weight. With this method, you fill your plate with more non-starchy ...

  1. Create Your Plate

    Medline Plus

    Full Text Available ... unsweetened tea or coffee. Featured Product Precise Portions® Go Healthy Travel Pack (4/Box) Taking the guesswork ... you are. Now, our best-selling, sectioned to-go plate with easy-sealing lid is offered in ...

  2. Create Your Plate

    Medline Plus

    Full Text Available ... manage portion control wherever you are. Now, our best-selling, sectioned to-go plate with easy-sealing lid is offered in a 4-pack. Whether ... Research & Practice We Are Research Leaders We Support Your Doctor ...

  3. INL HIP Plate Fabrication

    Energy Technology Data Exchange (ETDEWEB)

    B. H. Park; C. R. Clark; J. F. Jue

    2010-02-01

    This document outlines the process used to bond monolithic fuel plates by Hot Isostatic Pressing (HIP). This method was developed at Idaho National Laboratory (INL) for the Reduced Enrichment for Research and Test Reactors (RERTR) program. These foils have been used in a number of irradiation experiments in support of the United States Global Threat Reduction Initiative (GTRI) program.

  4. The Plate Tectonics Project

    Science.gov (United States)

    Hein, Annamae J.

    2011-01-01

    The Plate Tectonics Project is a multiday, inquiry-based unit that facilitates students as self-motivated learners. Reliable Web sites are offered to assist with lessons, and a summative rubric is used to facilitate the holistic nature of the project. After each topic (parts of the Earth, continental drift, etc.) is covered, the students will…

  5. Create Your Plate

    Medline Plus

    Full Text Available ... Planning Meals > Create Your Plate Share: Print Page Text Size: A A A Listen En Español Create ... somewhere in between, you have an easy portion control solution that works. Last Reviewed: October 8, 2015 Last Edited: ... Cost of Diabetes Advocate Toolkit Call to Congress Research & ...

  6. Comparative evaluation of ultrasound scanner accuracy in distance measurement

    Science.gov (United States)

    Branca, F. P.; Sciuto, S. A.; Scorza, A.

    2012-10-01

    The aim of the present study is to develop and compare two different automatic methods for accuracy evaluation in ultrasound phantom measurements on B-mode images: both of them give as a result the relative error e between measured distances, performed by 14 brand new ultrasound medical scanners, and nominal distances, among nylon wires embedded in a reference test object. The first method is based on a least squares estimation, while the second one applies the mean value of the same distance evaluated at different locations in ultrasound image (same distance method). Results for both of them are proposed and explained.

  7. Compact implementation of dynamic receive apodization in ultrasound scanners

    DEFF Research Database (Denmark)

    Tomov, Borislav Gueorguiev; Jensen, Jørgen Arendt

    2004-01-01

    The image quality in medical ultrasound scanners is determined by several factors, one of which is the ability of the receive beamformer to change the aperture weighting function with depth and beam angle. In digital beamformers, precise dynamic apodization can be achieved by representing...... the function by numeric sequences. For a 15 cm scan depth and 100 lines per image, a 64-channel, 40 MHz ultrasound beamformer may need almost 50 million coefficients. A more coarse representation of the aperture relieves the memory requirements but does not enable compact and precise beamforming. Previously...

  8. Applicability of optical scanner method for fine root dynamics

    Science.gov (United States)

    Kume, Tomonori; Ohashi, Mizue; Makita, Naoki; Khoon Kho, Lip; Katayama, Ayumi; Matsumoto, Kazuho; Ikeno, Hidetoshi

    2016-04-01

    Fine root dynamics is one of the important components in forest carbon cycling, as ~60 % of tree photosynthetic production can be allocated to root growth and metabolic activities. Various techniques have been developed for monitoring fine root biomass, production, mortality in order to understand carbon pools and fluxes resulting from fine roots dynamics. The minirhizotron method is now a widely used technique, in which a transparent tube is inserted into the soil and researchers count an increase and decrease of roots along the tube using images taken by a minirhizotron camera or minirhizotron video camera inside the tube. This method allows us to observe root behavior directly without destruction, but has several weaknesses; e.g., the difficulty of scaling up the results to stand level because of the small observation windows. Also, most of the image analysis are performed manually, which may yield insufficient quantitative and objective data. Recently, scanner method has been proposed, which can produce much bigger-size images (A4-size) with lower cost than those of the minirhizotron methods. However, laborious and time-consuming image analysis still limits the applicability of this method. In this study, therefore, we aimed to develop a new protocol for scanner image analysis to extract root behavior in soil. We evaluated applicability of this method in two ways; 1) the impact of different observers including root-study professionals, semi- and non-professionals on the detected results of root dynamics such as abundance, growth, and decomposition, and 2) the impact of window size on the results using a random sampling basis exercise. We applied our new protocol to analyze temporal changes of root behavior from sequential scanner images derived from a Bornean tropical forests. The results detected by the six observers showed considerable concordance in temporal changes in the abundance and the growth of fine roots but less in the decomposition. We also examined

  9. Optical monitoring of scoliosis by 3D medical laser scanner

    Science.gov (United States)

    Rodríguez-Quiñonez, Julio C.; Sergiyenko, Oleg Yu.; Preciado, Luis C. Basaca; Tyrsa, Vera V.; Gurko, Alexander G.; Podrygalo, Mikhail A.; Lopez, Moises Rivas; Balbuena, Daniel Hernandez

    2014-03-01

    Three dimensional recording of the human body surface or anatomical areas have gained importance in many medical applications. In this paper, our 3D Medical Laser Scanner is presented. It is based on the novel principle of dynamic triangulation. We analyze the method of operation, medical applications, orthopedically diseases as Scoliosis and the most common types of skin to employ the system the most proper way. It is analyzed a group of medical problems related to the application of optical scanning in optimal way. Finally, experiments are conducted to verify the performance of the proposed system and its method uncertainty.

  10. Investigation of a near-infrared-ray computed tomography scanner

    Science.gov (United States)

    Sato, Eiichi; Oda, Yasuyuki; Satoi, Yuichi; Yamaguchi, Satoshi; Ishii, Tomotaka; Hagiwara, Osahiko; Matsukiyo, Hiroshi; Watanabe, Manabu; Kusachi, Shinya

    2016-10-01

    In the near-infrared-ray computed tomography (NIR-CT) scanner, NIR rays are produced from a light-emitting diode (LED) and detected using an NIR phototransistor (PT). The wavelengths of the LED peak intensity and the PT high sensitivity in the data table are both 940 nm. The photocurrents flowing through the PTR are converted into voltages using an emitter-follower circuit, and the output voltages are sent to a personal computer through an analog-digital converter. The NIR projection curves for tomography are obtained by repeated linear scans and rotations of the object, and the scanning is conducted in both directions of its movement.

  11. Performance evaluation of an Inveon PET preclinical scanner

    Science.gov (United States)

    Constantinescu, Cristian C.; Mukherjee, Jogeshwar

    2009-05-01

    We evaluated the performance of an Inveon preclinical PET scanner (Siemens Medical Solutions), the latest MicroPET system. Spatial resolution was measured with a glass capillary tube (0.26 mm inside diameter, 0.29 mm wall thickness) filled with 18F solution. Transaxial and axial resolutions were measured with the source placed parallel and perpendicular to the axis of the scanner. The sensitivity of the scanner was measured with a 22Na point source, placed on the animal bed and positioned at different offsets from the center of the field of view (FOV), as well as at different energy and coincidence windows. The noise equivalent count rates (NECR) and the system scatter fraction were measured using rat-like (Φ = 60, L = 150 mm) and mouse-like (Φ = 25 mm, L = 70 mm) cylindrical phantoms. Line sources filled with high activity 18F (>250 MBq) were inserted parallel to the axes of the phantoms (13.5 and 10 mm offset). For each phantom, list-mode data were collected over 24 h at 350-650 keV and 250-750 keV energy windows and 3.4 ns coincidence window. System scatter fraction was measured when the random event rates were below 1%. Performance phantoms consisting of cylinders with hot rod inserts filled with 18F were imaged. In addition, we performed imaging studies that show the suitability of the Inveon scanner for imaging small structures such as those in mice with a variety of tracers. The radial, tangential and axial resolutions at the center of FOV were 1.46 mm, 1.49 and 1.15 mm, respectively. At a radial offset of 2 cm, the FWHM values were 1.73, 2.20 and 1.47 mm, respectively. At a coincidence window of 3.4 ns, the sensitivity was 5.75% for EW = 350-650 keV and 7.4% for EW = 250-750 keV. For an energy window of 350-650 keV, the peak NECR was 538 kcps at 131.4 MBq for the rat-like phantom, and 1734 kcps at 147.4 MBq for the mouse-like phantom. The system scatter fraction values were 0.22 for the rat phantom and 0.06 for the mouse phantom. The Inveon system

  12. Analysis framework for the J-PET scanner

    CERN Document Server

    Krzemień, W; Gruntowski, A; Stola, K; Trybek, D; Bednarski, T; Białas, P; Czerwiński, E; Kamińska, D; Kapłon, L; Kochanowski, A; Korcyl, G; Kowal, J; Kowalski, P; Kozik, T; Kubicz, E; Moskal, P; Niedźwiecki, Sz; Pałka, M; Raczyński, L; Rudy, Z; Salabura, P; Sharma, N G; Silarski, M; Słomski, A; Smyrski, J; Strzelecki, A; Wieczorek, A; Wiślicki, W; Zieliński, M; Zoń, N

    2015-01-01

    J-PET analysis framework is a flexible, lightweight, ROOT-based software package which provides the tools to develop reconstruction and calibration procedures for PET tomography. In this article we present the implementation of the full data-processing chain in the J-PET framework which is used for the data analysis of the J-PET tomography scanner. The Framework incorporates automated handling of PET setup parameters' database as well as high level tools for building data reconstruction procedures. Each of these components is briefly discussed.

  13. Scatter fraction of the J-PET tomography scanner

    CERN Document Server

    Kowalski, P; Raczyński, L; Alfs, D; Bednarski, T; Białas, P; Czerwiński, E; Gajos, A; Głowacz, B; Jasińska, J; Kamińska, D; Korcyl, G; Kozik, T; Krzemień, W; Kubicz, E; Mohammad, M; Niedźwiecki, Sz; Pałka, M; Pawlik-Niedźwiecka, M; Rudy, Z; Silarski, M; Smyrski, J; Strzelecki, A; Wieczorek, A; Zgardzińska, B; Zieliński, M; Moskal, P

    2016-01-01

    A novel Positron Emission Tomography system, based on plastic scintillators, is being developed by the J-PET collaboration. In this article we present the simulation results of the scatter fraction, representing one of the parameters crucial for background studies defined in the NEMA-NU-2-2012 norm. We elaborate an event selection methods allowing to suppress events in which gamma quanta were scattered in the phantom or underwent the multiple scattering in the detector. The estimated scatter fraction for the single-layer J-PET scanner varies from 37% to 53% depending on the applied energy threshold.

  14. Demonstration: A smartphone 3D functional brain scanner

    DEFF Research Database (Denmark)

    Stahlhut, Carsten; Stopczynski, Arkadiusz; Larsen, Jakob Eg

    We demonstrate a fully portable 3D real-time functional brain scanner consisting of a wireless 14-channel ‘Neuroheadset‘ (Emotiv EPOC) and a Nokia N900 smartphone. The novelty of our system is the ability to perform real-time functional brain imaging on a smartphone device, including stimulus...... tools are preferred. Source localization is implemented locally on the phone with a 3D brain model consisting of 1,028 vertices and 2,048 triangles stored in the mobile application. Our system design benefits from the possibility of being able to integrate with multiple hardware platforms (smartphones...

  15. A new electronic read-out for the YAPPET scanner

    CERN Document Server

    Damiani, C; Malaguti, R; Guerra, A D; Domenico, G D; Zavattini, G

    2002-01-01

    A small animal PET-SPECT scanner (YAPPET) prototype was built at the Physics Department of the Ferrara University and is presently being used at the Nuclear Medicine Department for radiopharmaceutical studies on rats. The first YAPPET prototype shows very good performances, but needs some improvements before it can be fully used for intensive radiopharmaceutical research. The main problem of the actual prototype is its heavy electronics, based on NIM and CAMAC standard modules. For this reason a new, compact read-out electronics was developed and tested. The results of a first series of tests made on the first prototype will be presented in the paper.

  16. Top-up operation experience at APS.

    Energy Technology Data Exchange (ETDEWEB)

    Emery, L.

    1999-03-31

    The Advanced Photon Source (APS) is a 7-OeV, third-generation synchrotrons radiation source. To provide more stable beam for users, in September 1998 we began commissioning a new operating mode called ''top-up.'' In this mode, the beam current does not decay but is maintained at a high level using frequent injection, while photon shutters are open and photon beams are delivered to users. The hardware, software, and safety requirements for top-up will be reported. Safety issues related to injection with open photon shutters are covered in companion papers in this conference. Recent operational experience includes testing aspects of top-up injection and delivering beam to X-ray users for a few hours with fractional current stability of 10{sup {minus}3}. We expect to run several top-up operation shifts in Spring 1999. Issues of importance are orbit and emittance transients during the injection and scheduling of injection pulses for the convenience of users.

  17. Comparison of back side chrome focus monitor to focus self-metrology of an immersion scanner

    Science.gov (United States)

    D'havé, Koen; Machida, Takahiro; Laidler, David; Cheng, Shaunee

    2007-03-01

    Monitoring of the focus performance is recognized to be an important part of a periodic scanner health check, but can one simply apply all techniques that have been used for dry scanners to immersion scanners? And if so how do such techniques compare to scanner self-metrology tests that are used to set up the tool? In this paper we look at one specific off-line focus characterization technique, Back Side Chrome (BSC), which we then try to match with results obtained from two self-metrology focus tests, available on the scanner chosen for this work. The latter tests are also used to set up the immersion scanner. We point out a few concerns, discuss their effect and indicate that for each generation of immersion tool one should redo the entire exercise.

  18. Large-scale three-dimensional measurement via combining 3D scanner and laser rangefinder.

    Science.gov (United States)

    Shi, Jinlong; Sun, Zhengxing; Bai, Suqin

    2015-04-01

    This paper presents a three-dimensional (3D) measurement method of large-scale objects by integrating a 3D scanner and a laser rangefinder. The 3D scanner, used to perform partial section measurement, is fixed on a robotic arm which can slide on a guide rail. The laser rangefinder, used to compute poses of the 3D scanner, is rigidly connected to the 3D scanner. During large-scale measurement, after measuring a partial section, the 3D scanner is straightly moved forward along the guide rail to measure another section. Meanwhile, the poses of the 3D scanner are estimated according to its moved distance for different partial section alignments. The performance and effectiveness are evaluated by experiments.

  19. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  20. AP233: An Information Model for Systems Engineering

    Science.gov (United States)

    Siebes, Georg

    2009-01-01

    In today's world, information is abundant. We have no problems generating it. But we are challenged to find, organize, and exchange information. center dot A standardized model of information can help. Such a model nearly completed its development for Systems Engineering. It is referred to as AP233 (AP = Application Protocol).

  1. Properties of LuAP: CE scintillator containing intentional impurities

    CERN Document Server

    Petrosyan, A G; Ovanesyan, K; Lecoq, Paul; Auffray, Etiennette; Trummer, Julia; Kronberger, Matthias; Pédrini, C; Dujardin, C; Anfre, P

    2007-01-01

    Single crystals of LuAP:Ce and LuYAP(Lu*70%):Ce co-doped with tetravalent (Hf and Zr) and pentavalent (Ta) ions were grown from melts by the Bridgman process. Underlying absorption, slope of the optical edge and transmission in the range of emission were compared to those of LuAP:Ce crystals. Absorption coefficients at 260 nm less than 2 cm−1 have been recorded in LuAP:Ce crystals containing tetravalent ions that are lower than the corresponding figures (5–6 cm−1) measured in undoped LuAP. At high concentrations of added impurities, despite of suppression of the parasitic underlying absorption below 300 nm, the slope of the optical edge and transmission in the range of emission are seriously damaged. Scintillation parameters of crystals with added impurities are compared to those of LuAP:Ce.

  2. Robustness in the design and manufacture of the AP1000 fuel assembly

    Energy Technology Data Exchange (ETDEWEB)

    Sumit, Ray [New Reactor Fuel Engineering, Westinghouse Electric Corporation, Monroeville, PA (United States)

    2009-06-15

    EPRI fuel reliability guidelines. Some of the key specifics that will be addressed in more detail in this paper are discussed below: 1) Grid to Rod Fretting: Early Analysis using Computational Fluid Dynamics showed the presence of inlet flow distributions that could increase the risk of fretting related failures. In response to this, a flow skirt was added and other changes were made to the core plate to make the flow distributions more favorable. Also, scoping tests were performed early on in the program to determine the vibration characteristics of the AP1000 fuel assembly. Based on the results of these tests, the AP1000 grid designs have been further enhanced to ensure that any possibility of grid to rod fretting failures has been eliminated. 2) PCI: The AP1000 plant utilizes the MSHIM strategy, in which 'Gray' control rods rather than soluble Boron are utilized for all load follow maneuvers. The AP1000 rod control system and Gray rod design have been finely tuned to ensure that the key PCI related risk factors, as delineated in the EPRI Fuel Reliability Guidelines, are maintained within the previous Westinghouse experience base. Margins will be monitored using Westinghouse's BEACON{sup TM} core monitoring software. In addition, significant manufacturing improvements will be utilized to minimize the risk for pellet imperfections, a factor which has been shown to be a specific risk factor in causing PCI failures. 3) Debris: One of the key concerns during the first cycle of any reactor is the presence of construction debris and its potential impact on fuel failures. Westinghouse is placing significant focus on a robust FME management process during all aspects of construction. In addition, improvements are being made to the AP1000 fuel assembly to further enhance its debris protection characteristics. These will be discussed in more detail in the paper. 4) Crud Induced Corrosion: Consistent with EPRI fuel reliability guidelines, detailed crud induced

  3. Irradiation in helical scanner: doses estimation, parameters choice; Irradiation en scanner helicoidal: estimation des doses, choix des parametres

    Energy Technology Data Exchange (ETDEWEB)

    Cordoliani, Y.S.; Boyer, B.; Jouan, E.; Beauvais, H

    2001-07-01

    The new generation of helical scanners improves the diagnosis abilities and the service done to the patients. The rational use allows to give the patients a ratio benefit/risk far better than the almost medical examinations. It is particularly true for over sixty years old aged people, that have a null genetic risk and a practically null carcinogen risk; However, for young adults and children, it is necessary to banish any useless irradiation and limit exposure to the strict necessary for the diagnosis. It is necessary to develop a radiation protection culture, possible by the radiation doses index display and doses benchmarks knowledge. (N.C.)

  4. Label-free tissue scanner for colorectal cancer screening

    Science.gov (United States)

    Kandel, Mikhail E.; Sridharan, Shamira; Liang, Jon; Luo, Zelun; Han, Kevin; Macias, Virgilia; Shah, Anish; Patel, Roshan; Tangella, Krishnarao; Kajdacsy-Balla, Andre; Guzman, Grace; Popescu, Gabriel

    2017-06-01

    The current practice of surgical pathology relies on external contrast agents to reveal tissue architecture, which is then qualitatively examined by a trained pathologist. The diagnosis is based on the comparison with standardized empirical, qualitative assessments of limited objectivity. We propose an approach to pathology based on interferometric imaging of "unstained" biopsies, which provides unique capabilities for quantitative diagnosis and automation. We developed a label-free tissue scanner based on "quantitative phase imaging," which maps out optical path length at each point in the field of view and, thus, yields images that are sensitive to the "nanoscale" tissue architecture. Unlike analysis of stained tissue, which is qualitative in nature and affected by color balance, staining strength and imaging conditions, optical path length measurements are intrinsically quantitative, i.e., images can be compared across different instruments and clinical sites. These critical features allow us to automate the diagnosis process. We paired our interferometric optical system with highly parallelized, dedicated software algorithms for data acquisition, allowing us to image at a throughput comparable to that of commercial tissue scanners while maintaining the nanoscale sensitivity to morphology. Based on the measured phase information, we implemented software tools for autofocusing during imaging, as well as image archiving and data access. To illustrate the potential of our technology for large volume pathology screening, we established an "intrinsic marker" for colorectal disease that detects tissue with dysplasia or colorectal cancer and flags specific areas for further examination, potentially improving the efficiency of existing pathology workflows.

  5. Deformation Measurement Using Terrestrial Laser Scanner for Cultural Heritage

    Science.gov (United States)

    Selbesoglu, M. O.; Bakirman, T.; Gokbayrak, O.

    2016-10-01

    Historical structures are one of the most essential element of cultural heritage. They reflect history, lifestyle and tradition of a country and society. However, they are damaged through the years due to human activities and natural hazards. Therefore, digital documentation of structures and monuments is critical for preservation, sustainability and protection of cultural heritage. Terrestrial laser scanner is a widespread used tool for obtaining 3D representation of real world. In this study, we aimed to measure deformation of deformed minaret of a historical mosque using terrestrial laser scanner. In order to represent the geometry of the deformed minaret with high accuracy, 31 horizontal sections were created from the transition segment to the spire of the minaret with 30 cm intervals. The changing curvatures of the minaret were analysed in three parts; cylindrical part, balcony part and upper part. The offsets from the vertical axes for the parts of the minaret were found as 10.14 cm, 13.97 cm and 16.51 cm, respectively.

  6. Adaptation of Industrial Hyperspectral Line Scanner for Archaeological Applications

    Science.gov (United States)

    Miljković, V.; Gajski, D.

    2016-06-01

    The spectral characteristic of the visible light reflected from any of archaeological artefact is the result of the interaction of its surface illuminated by incident light. Every particular surface depends on what material it is made of and/or which layers put on it has its spectral signature. Recent archaeometry recognises this information as very valuable data to extend present documentation of artefacts and as a new source for scientific exploration. However, the problem is having an appropriate hyperspectral imaging system available and adopted for applications in archaeology. In this paper, we present the new construction of the hyperspectral imaging system, made of industrial hyperspectral line scanner ImSpector V9 and CCD-sensor PixelView. The hyperspectral line scanner is calibrated geometrically, and hyperspectral data are geocoded and converted to the hyperspectral cube. The system abilities are evaluated for various archaeological artefacts made of different materials. Our experience in applications, visualisations, and interpretations of collected hyperspectral data are explored and presented.

  7. Source mask optimization study based on latest Nikon immersion scanner

    Science.gov (United States)

    Zhu, Jun; Wei, Fang; Chen, Lijun; Zhang, Chenming; Zhang, Wei; Nishinaga, Hisashi; El-Sewefy, Omar; Gao, Gen-Sheng; Lafferty, Neal; Meiring, Jason; Zhang, Recoo; Zhu, Cynthia

    2016-03-01

    The 2x nm logic foundry node has many challenges since critical levels are pushed close to the limits of low k1 ArF water immersion lithography. For these levels, improvements in lithographic performance can translate to decreased rework and increased yield. Source Mask Optimization (SMO) is one such route to realize these image fidelity improvements. During SMO, critical layout constructs are intensively optimized in both the mask and source domain, resulting in a solution for maximum lithographic entitlement. From the hardware side, advances in source technology have enabled free-form illumination. The approach allows highly customized illumination, enabling the practical application of SMO sources. The customized illumination sources can be adjusted for maximum versatility. In this paper, we present a study on a critical layer of an advanced foundry logic node using the latest ILT based SMO software, paired with state-of-the-art scanner hardware and intelligent illuminator. Performance of the layer's existing POR source is compared with the ideal SMO result and the installed source as realized on the intelligent illuminator of an NSR-S630D scanner. Both simulation and on-silicon measurements are used to confirm that the performance of the studied layer meets established specifications.

  8. Commissioning of a passive rod scanner at INB

    Energy Technology Data Exchange (ETDEWEB)

    Junqueira, Fabio da Silva; Oliveira, Carlos A.; Palheiros, Franklin, E-mail: carlossilva@inb.gov.br, E-mail: franklin@inb.gov.br [Industrias Nucleares do Brasil (INB), Resende, RJ (Brazil). Superintendencia de Engenharia do Combustivel; Fernandez, Pablo Jesus Piñer, E-mail: pineiro@tecnatom.es [Tecnatom, San Sebastian de los Reyes, Madrid (Spain)

    2015-07-01

    For the 21st reload for Angra 1, a shift from Standard to Advanced fuel design will be introduced, where the fuel assemblies under the new design will contain fuel rods with axial blanket, in line with ELETRONUCLEAR's requirement for a higher energy efficient reactor fuel. Additionally, fuel rods for Angra 2 and 3, using gadolinium type burnable poison, have to be submitted to inspections due to the demand for the same type of inspection, which cannot be certified at INB currently. In keeping with CNEN regulations, every fuel-assembly component must be inspected and certified by a qualified method. Nevertheless, INB lacks the means to perform the certification-required inspection aimed at determining the uranium enrichment and presence of gadolinium pellets inside the closed rods. Hence, the use is necessary of a scanner capable of inspecting differently enriched fuel rods and/or gadolinium pellets (axial blanket). This work aims to present the recent Passive Rod Scanner installed at INB with most advance technology in the area, making possible to completely fulfill Angra 1, 2 and 3 rods inspection at INB Resende site. (author)

  9. Noninvasive thermometry with a clinical x-ray CT scanner

    Energy Technology Data Exchange (ETDEWEB)

    Fallone, B.G.; Moran, P.R.; Podgorsak, E.B.

    1982-09-01

    A CT scanner yields CT numbers which are proportional to the fractional difference in effective local electron density of the subject material with respect to that of calibration material. A homogeneous water-equivalent material is used as a calibration phantom under isothermal conditions. Any temperature variation (spatial or temporal) in the subject material subsequently scanned, will generate a CT-number shift in the CT image because of density changes due to thermal expansion. The potential use of the thermally generated CT-number shift in noninvasive thermometry during cancer hyperthermia was studied in vitro in samples of water and muscle tissue. The reproducibility of the area-averaged CT-number measurement on our EMI-7070 scanner was found to depend strongly on the time interval between successive counterclockwise scans and on the size of the region of interest used for area averaging. A linear relationship was found between the CT number and water density in the water temperature range from 10 to 55 /sup 0/C. In the hyperthermia temperature range (36--50 /sup 0/C), the relationship between the CT number and temperature itself is linear, with a CT-number thermal shift of about 0.4 and 0.45 HU//sup 0/C for water and muscle tissue, respectively. The achievable temperature discrimination is a fraction of /sup 0/C at spatial resolutions of the order of a centimeter.

  10. Advancements on galvanometer scanners for high-end applications

    Science.gov (United States)

    Duma, Virgil-Florin; Rolland, Jannick P.

    2014-03-01

    Galvanometer-based scanners (GSs) are the most utilized devices for lateral scanning. Their applications range from commercial and industrial to biomedical imaging. They are used mostly for 2-D scanning (with typically two GSs), but also for 1-D or 3-D scanning (the latter by example with GSs in combination with Risley prisms). This paper presents an overview of our contributions in the field of GSs with regard to the requirements of their most challenging applications. Specifically, we studied the optimal scanning functions - to produce the maximum possible duty cycleη, and we found that, contrary to what has been stated in the literature, the scanning function that provides the highest η is not linear plus sinusoidal, but linear plus parabolic. The most common GS input signals (i.e., sawtooth, triangular, and sinusoidal) were investigated experimentally to determine the scanning regimes that produce the minimum image artifacts, for example in Optical Coherence Tomography (OCT). The triangular signal was thus shown to be the best from this point of view, and several rules-of-thumb were extracted to make the best of GSs in OCT. We also discuss aspects of the command functions of GSs that are necessary to achieve a trade-off between a performance criteria related to the duty cycle and voltage regimes of the device. We finally review aspects of the control solutions of GSs we investigated, to obtain the highest possible precision or the fastest possible response of the scanner.

  11. Operation of the preclinical head scanner for proton CT

    Science.gov (United States)

    Sadrozinski, H. F.-W.; Geoghegan, T.; Harvey, E.; Johnson, R. P.; Plautz, T. E.; Zatserklyaniy, A.; Bashkirov, V.; Hurley, R. F.; Piersimoni, P.; Schulte, R. W.; Karbasi, P.; Schubert, K. E.; Schultze, B.; Giacometti, V.

    2016-09-01

    We report on the operation and performance tests of a preclinical head scanner developed for proton computed tomography (pCT). After extensive preclinical testing, pCT is intended to be employed in support of proton therapy treatment planning and pre-treatment verification in patients undergoing particle-beam therapy. In order to assess the performance of the scanner, we have performed CT scans with 200 MeV protons from both the synchrotron of the Loma Linda University Medical Center (LLUMC) and the cyclotron of the Northwestern Medicine Chicago Proton Center (NMCPC). The very high sustained rate of data acquisition, exceeding one million protons per second, allowed a full 360° scan to be completed in less than 7 min. The reconstruction of various phantoms verified accurate reconstruction of the proton relative stopping power (RSP) and the spatial resolution in a variety of materials. The dose for an image with better than 1% uncertainty in the RSP is found to be close to 1 mGy.

  12. Evaluation of Fingerprint Images Captured by Optical Fingerprint Scanner

    Science.gov (United States)

    Takeuchi, Hideyo; Matsumoto, Noriyuki; Kuwayama, Kiyoaki; Umezaki, Taizo

    In this paper, we propose the way to evaluate fingerprint image-quality and how to discriminate remnants from captured images. First, we investigate evaluating fingerprint image-quality. Fingerprint image-quality can be digitized using the "measure" we proposed. We simulate using the dataset consists of 1425 fingerprint images captured from 57 people in Feb, which contains a lot of faded images. In the simulation using all our database, recognition rate is 95.6% while type II error is 0.01%. Recognition rate is improved to 98.1%, with rejecting 3.7% faded images evaluated by our measure from the database. Recognition rate is improved to 99.6%, rejecting 14.2% faded images. And we investigate the way to apply the measure of image-quality to fingerprint verification device with customer’s satisfaction in real world. Next we propose the way to discriminate between remnants and fingerprint images captured from optical scanner by using frequency analysis. We can perfectly prevent the fingerprint verification device from malfunctioning caused by remnant, when strong flashlight or direct sunlight slant in optical scanner in real world.

  13. Operation of the preclinical head scanner for proton CT

    Energy Technology Data Exchange (ETDEWEB)

    Sadrozinski, H.F.-W., E-mail: hartmut@ucsc.edu [SCIPP, U.C. Santa Cruz, Santa Cruz, CA 95064 (United States); Geoghegan, T.; Harvey, E.; Johnson, R.P.; Plautz, T.E.; Zatserklyaniy, A. [SCIPP, U.C. Santa Cruz, Santa Cruz, CA 95064 (United States); Bashkirov, V.; Hurley, R.F.; Piersimoni, P.; Schulte, R.W. [Division of Radiation Research, Loma Linda University, Loma Linda, CA 92354 (United States); Karbasi, P.; Schubert, K.E.; Schultze, B. [School of Engineering and Computer Science, Baylor University, Waco, TX 76798 (United States); Giacometti, V. [Center for Medical Radiation Physics, University of Wollongong, NSW (Australia)

    2016-09-21

    We report on the operation and performance tests of a preclinical head scanner developed for proton computed tomography (pCT). After extensive preclinical testing, pCT is intended to be employed in support of proton therapy treatment planning and pre-treatment verification in patients undergoing particle-beam therapy. In order to assess the performance of the scanner, we have performed CT scans with 200 MeV protons from both the synchrotron of the Loma Linda University Medical Center (LLUMC) and the cyclotron of the Northwestern Medicine Chicago Proton Center (NMCPC). The very high sustained rate of data acquisition, exceeding one million protons per second, allowed a full 360° scan to be completed in less than 7 min. The reconstruction of various phantoms verified accurate reconstruction of the proton relative stopping power (RSP) and the spatial resolution in a variety of materials. The dose for an image with better than 1% uncertainty in the RSP is found to be close to 1 mGy.

  14. Towards a mechanical MPI scanner based on atomic magnetometry

    CERN Document Server

    Colombo, Simone; Tonyushkin, Alexey; Grujic, Zoran D; Dolgovskiy, Vladimir; Weis, Antoine

    2016-01-01

    We report on our progress in the development of an atomic magnetometer (AM) based low-frequency X-space MPI scanner, expected to be free from SAR and PNS constraints. We address major challenges in coil and sensor design due to specificAMproperties. Compared to our previous workwe have changed the AM's mode of operation towards its implementation for detecting weak SPIO response fields in the presence of nearby-located strong drive/selection fields. We demonstrate that a pump-probe AM scheme in a buffer gas filled alkali vapour cell can tolerate mT/m gradients while maintaining a sensitivity in the one-digit pT/Hz^(1/2) range over a bandwidth from DC to several kHz. We give a detailed description of the drive/selection coils' geometry and their hardware implementations that will provide both field-free-line (FFL) and field-free-point (FFP) modes of operation, compatible with a best performance AM operation. We estimate the achievable field of view and spatial resolution of the scanner as well as its sensitivi...

  15. A noble refractive optical scanner with linear response

    Science.gov (United States)

    Mega, Yair J.; Lai, Zhenhua; DiMarzio, Charles A.

    2013-03-01

    Many applications in various fields of science and engineering use steered optical beam systems. Currently, many methods utilize mirrors in order to steer the beam. However, this approach is an off-axis solution, which normally increases the total size of the system as well as its error and complexity. Other methods use a "Risely Prisms" based solution, which is on-axis solution, however it poses some difficulties from an engineering standpoint, and therefore isn't widely used. We present here a novel technique for steering a beam on its optical axis with a linear deflection response. We derived the formulation for the profile required of the refractive optical component necessary for preforming the beam steering. The functionality of the device was simulated analytically using Matlab, as well as using a ray-tracing software, Zemax, and showed agreement with the analytical model. An optical element was manufactured based on the proposed design and the device was tested. The results show agreement with our hypothesis. We also present some proposed geometries of the several other devices, all based on the same concept, which can be used for higher performance applications such as two-dimensional scanner, video rate scanner etc.

  16. MyPlate Food Guide

    Science.gov (United States)

    ... Choosing the Right Sport for You Shyness MyPlate Food Guide KidsHealth > For Teens > MyPlate Food Guide Print ... other sugary drinks. Avoid oversized portions. continue Five Food Groups Different food groups meet different nutrition needs. ...

  17. What Are Growth Plate Injuries?

    Science.gov (United States)

    ... plate injuries are:  Falling down  Competitive sports (like football)  Recreational activities. Other reasons for growth plate injuries are:  Child abuse  Injury from extreme cold (for ...

  18. Stratification in Ap star atmospheres: Simulations

    Science.gov (United States)

    Cowley, Charles R.; Castelli, Fiorella

    2017-01-01

    It is now well established that the atmospheres of Ap stars can be chemically stratified (cf. Babel, A\\&A 258, 645, 1992; Ryabchikova et al. A\\&A 384, 545, 2002). The most convincing cases have been made with the profiles of very strong lines, such as Ca II K. Weaker line profiles are less obvious indicators. The collective behavior of sets or groups of lines have also been used. For example, if higher abundances are derived for strong lines in an atmosphere with zero microturbulence, one may assume that the absorbing species has been pushed into the higher photospheres. An example are the medium-strong Mn II lines in HgMn stars. In this paper, we probe this assumption by calculating line strengths with various assumed stratification models, and then determining abundances from those lines using an {\\bf unstratified} model with the same Teff and log(g). We use the model from Castelli, Kurucz \\& and Hubrig (A\\&A, 508, 401, 2009) for HR 6000, whose spectrum shows numerous indications of stratification. A variety of stratification models are considered, for example, ones where the majority of an absorbing species is concentrated above (or below) $log(\\tau_{5000}$ = -2.0. Cloud models are also investigated, where a species is concentrated within a range of photospheric depths. Curves of growth are generated in unstratified atmospheres for lines by holding the abundance fixed, and increasing log(gf). Similar curves are made in stratified models, and the ratios of strong to weak linesare compared with and without stratification. The effects of stratification on ionization are also investigated, as well as on the profiles of strong lines. We find, in agreement with previous work, that severe abundance jumps are sometimes required to account for some of the observed peculiarities.

  19. Controlling Laminate Plate Elastic Behavior

    OpenAIRE

    Mareš, T.

    2004-01-01

    This paper aims to express the relation of a measure of laminate plate stiffness with respect to the fiber orientation of its plies. The inverse of the scalar product of the lateral displacement of the central plane and lateral loading of the plate is the measure of laminate plate stiffness. In the case of a simply supported rectangular laminate plate this measure of stiffness is maximized, and the optimum orientation of its plies is searched.

  20. Microchannel plate streak camera

    Science.gov (United States)

    Wang, Ching L.

    1989-01-01

    An improved streak camera in which a microchannel plate electron multiplier is used in place of or in combination with the photocathode used in prior streak cameras. The improved streak camera is far more sensitive to photons (UV to gamma-rays) than the conventional x-ray streak camera which uses a photocathode. The improved streak camera offers gamma-ray detection with high temporal resolution. It also offers low-energy x-ray detection without attenuation inside the cathode. Using the microchannel plate in the improved camera has resulted in a time resolution of about 150 ps, and has provided a sensitivity sufficient for 1000 KeV x-rays.

  1. Thermal Decomposition Characteristics of Orthorhombic Ammonium Perchlorate (o-AP) and an 0-AP/HTPB-Based Propellant

    Energy Technology Data Exchange (ETDEWEB)

    BEHRENS JR.,RICHARD; MINIER,LEANNA M.G.

    1999-10-25

    A study to characterize the low-temperature reactive processes for o-AP and an AP/HTPB-based propellant (class 1.3) is being conducted in the laboratory using the techniques of simultaneous thermogravimetric modulated beam mass spectrometry (STMBMS) and scanning electron microscopy (SEM). The results presented in this paper are a follow up of the previous work that showed the overall decomposition to be complex and controlled by both physical and chemical processes. The decomposition is characterized by the occurrence of one major event that consumes up to {approx}35% of the AP, depending upon particle size, and leaves behind a porous agglomerate of AP. The major gaseous products released during this event include H{sub 2}O, O{sub 2}, Cl{sub 2}, N{sub 2}O and HCl. The recent efforts provide further insight into the decomposition processes for o-AP. The temporal behaviors of the gas formation rates (GFRs) for the products indicate that the major decomposition event consists of three chemical channels. The first and third channels are affected by the pressure in the reaction cell and occur at the surface or in the gas phase above the surface of the AP particles. The second channel is not affected by pressure and accounts for the solid-phase reactions characteristic of o-AP. The third channel involves the interactions of the decomposition products with the surface of the AP. SEM images of partially decomposed o-AP provide insight to how the morphology changes as the decomposition progresses. A conceptual model has been developed, based upon the STMBMS and SEM results, that provides a basic description of the processes. The thermal decomposition characteristics of the propellant are evaluated from the identities of the products and the temporal behaviors of their GFRs. First, the volatile components in the propellant evolve from the propellant as it is heated. Second, the hot AP (and HClO{sub 4}) at the AP-binder interface oxidize the binder through reactions that

  2. Electronic Equipment Cold Plates

    Science.gov (United States)

    1976-04-01

    equations for such a flow regiae. For laainar flow and Moderate teaperature differwwe« between the well «nd coolant, a aodifled Sieder -Tate...con- figuration. The heat-transfer coefficients, therefore, were determined by using both the Sieder -Tate and McAdams equations and the coaputed...values used In the analytical predictions. As with th* previous cold Plates, the Sieder -Tate equation gave too low of values for the heat- transfer

  3. Elastic plate spallation

    Science.gov (United States)

    Oline, L.; Medaglia, J.

    1972-01-01

    The dynamic finite element method was used to investigate elastic stress waves in a plate. Strain displacement and stress strain relations are discussed along with the stiffness and mass matrix. The results of studying point load, and distributed load over small, intermediate, and large radii are reported. The derivation of finite element matrices, and the derivation of lumped and consistent matrices for one dimensional problems with Laplace transfer solutions are included. The computer program JMMSPALL is also included.

  4. Plate Tearing by a Cone

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup

    1997-01-01

    The present paper is concerned with steady-state plate tearing by a cone. This is a scenario where a cone is forced through a ductile metal plate with a constant lateral tip penetration in a motion in the plane of the plate. The considered process could be an idealisaton of the damage, which...

  5. Plate Tearing by a Cone

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup

    1998-01-01

    The present paper is concerned with steady-state plate tearing by a cone. This is a scenario where a cone is forced through a ductile metal plate with a constant lateral tip penetration in a motion in the plane of the plate. The considered process could be an idealisation of the damage, which...

  6. The accuracy of the CAD system using intraoral and extraoral scanners for designing of fixed dental prostheses.

    Science.gov (United States)

    Shimizu, Sakura; Shinya, Akikazu; Kuroda, Soichi; Gomi, Harunori

    2017-07-26

    The accuracy of prostheses affects clinical success and is, in turn, affected by the accuracy of the scanner and CAD programs. Thus, their accuracy is important. The first aim of this study was to evaluate the accuracy of an intraoral scanner with active triangulation (Cerec Omnicam), an intraoral scanner with a confocal laser (3Shape Trios), and an extraoral scanner with active triangulation (D810). The second aim of this study was to compare the accuracy of the digital crowns designed with two different scanner/CAD combinations. The accuracy of the intraoral scanners and extraoral scanner was clinically acceptable. Marginal and internal fit of the digital crowns fabricated using the intraoral scanner and CAD programs were inferior to those fabricated using the extraoral scanner and CAD programs.

  7. Improving CT scan capabilities with a new trauma workflow concept: Simulation of hospital logistics using different CT scanner scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Fung Kon Jin, P.H.P., E-mail: p.fungkonjin@amc.uva.nl [Trauma Unit Department of Surgery, Academic Medical Center, Amsterdam (Netherlands); Dijkgraaf, M.G.W., E-mail: m.dijkgraaf@amc.uva.nl [Department of Clinical Epidemiology, Biostatistics, and Bioinformatics, Academic Medical Center, Amsterdam (Netherlands); Alons, C.L., E-mail: clalons@few.vu.nl [Department of Mathematics, VU University Amsterdam, Amsterdam (Netherlands); Kuijk, C. van, E-mail: c.vankuijk@vumc.nl [Department of Radiology, VU Medical Center, Amsterdam (Netherlands); Beenen, L.F.M., E-mail: l.beenen@amc.uva.nl [Department of Radiology, Academic Medical Center, Amsterdam (Netherlands); Koole, G.M., E-mail: koole@few.vu.nl [Department of Mathematics, VU University Amsterdam, Amsterdam (Netherlands); Goslings, J.C., E-mail: j.c.goslings@amc.uva.nl [Trauma Unit Department of Surgery, Academic Medical Center, Amsterdam (Netherlands)

    2011-11-15

    Introduction: The Amsterdam Trauma Workflow (ATW) concept includes a sliding gantry CT scanner serving two mirrored (trauma) rooms. In this study, several predefined scenarios with a varying number of CT scanners and CT locations are analyzed to identify the best performing patient flow management strategy from an institutional perspective on process quality. Materials and methods: A total of six clinically relevant scenarios with variables that included the number of CT scanners, CT scanner location, and different patient categories (regular, urgent, and trauma patients) were evaluated using computer simulation. Each scenario was simulated using institutional data and was assessed for patient waiting times, idle time of CT scanners, and overtime due to scheduling. The best 2- and 3-scanner scenarios were additionally evaluated with the ATW-concept. Results: Based on institutional data, the best 2-scanner scenario distributes all 3 patient categories over both scanners and plans 4 urgent patients per hour while locating both scanners outside of the trauma room. The best 3-scanner scenario distributes urgent and regular patients over all 3 scanners and trauma patients on only 1 scanner and locates all CT scanners outside of the trauma room. The ATW concept reduces waiting times and overtime, while increasing idle time. Conclusion: Choosing the optimal planning and distribution strategies depends on the number and location of available CT scanners, along with number of trauma, urgent and regular patients. The Amsterdam Trauma Workflow concept could provide institutions with the ability of early CT scanning in trauma patients without influencing regular and urgent CT scanning.

  8. Evaluation of resistive-plate-chamber-based TOF-PET applied to in-beam particle therapy monitoring

    Science.gov (United States)

    Torres-Espallardo, I.; Diblen, F.; Rohling, H.; Solevi, P.; Gillam, J.; Watts, D.; España, S.; Vandenberghe, S.; Fiedler, F.; Rafecas, M.

    2015-05-01

    Particle therapy is a highly conformal radiotherapy technique which reduces the dose deposited to the surrounding normal tissues. In order to fully exploit its advantages, treatment monitoring is necessary to minimize uncertainties related to the dose delivery. Up to now, the only clinically feasible technique for the monitoring of therapeutic irradiation with particle beams is Positron Emission Tomography (PET). In this work we have compared a Resistive Plate Chamber (RPC)-based PET scanner with a scintillation-crystal-based PET scanner for this application. In general, the main advantages of the RPC-PET system are its excellent timing resolution, low cost, and the possibility of building large area systems. We simulated a partial-ring scanner based on an RPC prototype under construction within the Fondazione per Adroterapia Oncologica (TERA). For comparison with the crystal-based PET scanner we have chosen the geometry of a commercially available PET scanner, the Philips Gemini TF. The coincidence time resolution used in the simulations takes into account the current achievable values as well as expected improvements of both technologies. Several scenarios (including patient data) have been simulated to evaluate the performance of different scanners. Initial results have shown that the low sensitivity of the RPC hampers its application to hadron-beam monitoring, which has an intrinsically low positron yield compared to diagnostic PET. In addition, for in-beam PET there is a further data loss due to the partial ring configuration. In order to improve the performance of the RPC-based scanner, an improved version of the RPC detector (modifying the thickness of the gas and glass layers), providing a larger sensitivity, has been simulated and compared with an axially extended version of the crystal-based device. The improved version of the RPC shows better performance than the prototype, but the extended version of the crystal-based PET outperforms all other options.

  9. Electroless silver plating on PET fabric initiated by in situ reduction of polyaniline

    Energy Technology Data Exchange (ETDEWEB)

    Mu, Shipeng; Xie, Huayang [College of Chemistry, Chemical Engineering and Biotechnology, Donghua University, Shanghai 201620 (China); Wang, Wei [College of Chemistry, Chemical Engineering and Biotechnology, Donghua University, Shanghai 201620 (China); Key Lab of Eco-Textile, Ministry of Education, Donghua University, Shanghai 201620 (China); Yu, Dan, E-mail: yudan@dhu.edu.cn [College of Chemistry, Chemical Engineering and Biotechnology, Donghua University, Shanghai 201620 (China); Key Lab of Eco-Textile, Ministry of Education, Donghua University, Shanghai 201620 (China)

    2015-10-30

    Graphical abstract: - Highlights: • We propose a method to initiate electroless plating by reduction of PANI. • The shielding effective of the silver-plated fabric reaches 50–90 dB. • The silver-plated fabric has good antibacterial activity. - Abstract: Novel electroless silver plating poly(ethylene terephthalate) (PET) fabric was prepared by a two-step procedure. In the first step, the in situ polymerized polyaniline (PANI) occurred on the fabric surface in the presence of ammonium persulfate (APS). Then, Ag(0) species reduced from silver nitrate (AgNO{sub 3}) by in situ reduction of PANI were used as catalyst to initiate electroless silver plating. Hence, this composite material was prepared by conductive polymer combined with electroless plating. The silver layer on PET fabric surface was characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD) and energy dispersive spectroscopy (EDX) as well as X-ray photoelectron spectroscopy (XPS). The results showed that the silver layer was plated uniformly and compactly with surface resistance about 0.1 Ω/sq on average. The shielding effectiveness (SE) of silver-plated PET fabric was around 50–90 dB, which was considered to have potential applications in electromagnetic shielding materials. Thermogravimetric (TG) analysis was carried out to study thermal stability. The antibacterial tests demonstrated that the silver-plated fabric exhibited excellent antibacterial activity against Staphylococcus aureus and Escherichia coli both with 100%.

  10. Monte Carlo simulation of sensitivity and NECR of an entire-body PET scanner.

    Science.gov (United States)

    Isnaini, Ismet; Obi, Takashi; Yoshida, Eiji; Yamaya, Taiga

    2014-07-01

    The current positron emission tomography (PET) design is aimed toward establishing an entire-body PET scanner. An entire-body PET scanner is a scanner whose axial field of view (FOV) covers the whole body of a patient, whereas whole-body PET scanner can be of any axial FOV length, but was designed for a whole-body scan. Despite its high production cost, an entire-body depth-of-interaction PET scanner offers many benefits, such as shorter and dynamic PET time acquisition, as well as higher sensitivity and count rate performance. This PET scanner may be cost-effective for clinical PET scanners with high scan throughput. In this work, we evaluated the sensitivity and count rate performance of a 2-m-long PET scanner with conventional data acquisition (DAQ) architecture, using Monte Carlo simulation, and we evaluated two ring diameters (60 and 80 cm) to reduce the scanner cost. From simulation of scanning with a 2-m axial FOV, the sensitivity for a 2-m-long PET scanner of 60 and 80-cm diameter is around 80 and 68 times higher, respectively, than that of the conventional PET scanner. In addition, for the 2-m-long PET scanner with 60-cm diameter, the peak noise equivalent count rate (NECR) was 843 kcps at 125 MBq, whereas the peak for the 80-cm diameter was 989 kcps at 200 MBq. This shows gains of 15.3 and 17.95, respectively, in comparison with that of the conventional PET scanner. The 2-m-long PET scanner with 60-cm ring diameter could not only reduce the number of detectors by 21 %, but also had a 17 % higher sensitivity compared to that with an 80-cm ring diameter. On the other hand, despite the higher sensitivity, the NECR of the 60-cm ring diameter was smaller than that of the 80-cm ring diameter. This results from the single data loss due to dead time, whereas grouping of axially stacked detectors was used in the conventional DAQ architecture. Parallelization of the DAQ architecture is therefore important for the 2-m-long PET scanner to achieve its optimal

  11. Ultra-High-Resolution Computed Tomography of the Lung: Image Quality of a Prototype Scanner.

    Directory of Open Access Journals (Sweden)

    Ryutaro Kakinuma

    Full Text Available The image noise and image quality of a prototype ultra-high-resolution computed tomography (U-HRCT scanner was evaluated and compared with those of conventional high-resolution CT (C-HRCT scanners.This study was approved by the institutional review board. A U-HRCT scanner prototype with 0.25 mm x 4 rows and operating at 120 mAs was used. The C-HRCT images were obtained using a 0.5 mm x 16 or 0.5 mm x 64 detector-row CT scanner operating at 150 mAs. Images from both scanners were reconstructed at 0.1-mm intervals; the slice thickness was 0.25 mm for the U-HRCT scanner and 0.5 mm for the C-HRCT scanners. For both scanners, the display field of view was 80 mm. The image noise of each scanner was evaluated using a phantom. U-HRCT and C-HRCT images of 53 images selected from 37 lung nodules were then observed and graded using a 5-point score by 10 board-certified thoracic radiologists. The images were presented to the observers randomly and in a blinded manner.The image noise for U-HRCT (100.87 ± 0.51 Hounsfield units [HU] was greater than that for C-HRCT (40.41 ± 0.52 HU; P < .0001. The image quality of U-HRCT was graded as superior to that of C-HRCT (P < .0001 for all of the following parameters that were examined: margins of subsolid and solid nodules, edges of solid components and pulmonary vessels in subsolid nodules, air bronchograms, pleural indentations, margins of pulmonary vessels, edges of bronchi, and interlobar fissures.Despite a larger image noise, the prototype U-HRCT scanner had a significantly better image quality than the C-HRCT scanners.

  12. Quantitative evaluation of three-dimensional facial scanners measurement accuracy for facial deformity

    Science.gov (United States)

    Zhao, Yi-jiao; Xiong, Yu-xue; Sun, Yu-chun; Yang, Hui-fang; Lyu, Pei-jun; Wang, Yong

    2015-07-01

    Objective: To evaluate the measurement accuracy of three-dimensional (3D) facial scanners for facial deformity patients from oral clinic. Methods: 10 patients in different types of facial deformity from oral clinical were included. Three 3D digital face models for each patient were obtained by three facial scanners separately (line laser scanner from Faro for reference, stereophotography scanner from 3dMD and structured light scanner from FaceScan for test). For each patient, registration based on Iterative Closest Point (ICP) algorithm was executed to align two test models (3dMD data & Facescan data) to the reference models (Faro data in high accuracy) respectively. The same boundaries on each pair models (one test and one reference models) were obtained by projection function in Geomagic Stuido 2012 software for trimming overlapping region, then 3D average measurement errors (3D errors) were calculated for each pair models also by the software. Paired t-test analysis was adopted to compare the 3D errors of two test facial scanners (10 data for each group). 3D profile measurement accuracy (3D accuracy) that is integrated embodied by average value and standard deviation of 10 patients' 3D errors were obtained by surveying analysis for each test scanner finally. Results: 3D accuracies of 2 test facial scanners in this study for facial deformity were 0.44+/-0.08 mm and 0.43+/-0.05 mm. The result of structured light scanner was slightly better than stereophotography scanner. No statistical difference between them. Conclusions: Both test facial scanners could meet the accuracy requirement (0.5mm) of 3D facial data acquisition for oral clinic facial deformity patients in this study. Their practical measurement accuracies were all slightly lower than their nominal accuracies.

  13. Vegetated landslide monitoring: target tracking with terrestrial laser scanner

    Science.gov (United States)

    Franz, Martin; Carrea, Dario; Abellan, Antonio; Derron, Marc-Henri; Jaboyedoff, Michel

    2013-04-01

    Monitoring landslides with terrestrial LiDAR is currently a well-known technique. One problem often encountered is the vegetation that produces shadow areas on the scans. Indeed, the points behind the obstacle are hidden and are absent from the point cloud. Thereby, locations monitored with terrestrial laser scanner are mostly rock instabilities and few vegetated landslides, being difficult or even impossible to survey vegetated slopes using this method. The Peney landslide (Geneva, Switzerland) is partially vegetated by bushes and trees, and in order to monitor its displacements during the drawdown of the Verbois reservoir located at its base, which activates the movement, an alternative solution has to be found. The Goal of this study are: (1) to illustrate a technique to monitor vegetated landslides with a terrestrial laser scanner and (2) to compare the both manual and automatic methods for displacement vectors extraction. We installed 14 targets, four of which are in stable areas which are considered as references. Targets are made of expanded polystyrene, two are spherical and 12 are cubic. They were installed on metallic poles ranging between 2 to 4 meters high. The LiDAR device was located on a fixed point on a pontoon on the reservoir opposite bank. The whole area, including the targets, needed three scans to be entirely covered and was scanned 10 times along on two weeks (duration of drawdown - filling). The acquired point clouds were cleaned and georeferenced. In order to determine the displacements for every target, two methods (manual and automatic) were used. The manual method consists on manual selection of, for example, the apex of the cubes, and so to have its 3D coordinates for a comparison in time. The automatic method uses an algorithm that recognises shapes trough time series. The obtained displacements were compared with classical measurement methods (theodolite and extensometer) showing good resemblance of results, indicating the validity of

  14. Plate tectonics conserves angular momentum

    Directory of Open Access Journals (Sweden)

    C. Bowin

    2009-03-01

    Full Text Available A new combined understanding of plate tectonics, Earth internal structure, and the role of impulse in deformation of the Earth's crust is presented. Plate accelerations and decelerations have been revealed by iterative filtering of the quaternion history for the Euler poles that define absolute plate motion history for the past 68 million years, and provide an unprecedented precision for plate angular rotation variations with time at 2-million year intervals. Stage poles represent the angular rotation of a plate's motion between adjacent Euler poles, and from which the maximum velocity vector for a plate can be determined. The consistent maximum velocity variations, in turn, yield consistent estimates of plate accelerations and decelerations. The fact that the Pacific plate was shown to accelerate and decelerate, implied that conservation of plate tectonic angular momentum must be globally conserved, and that is confirmed by the results shown here (total angular momentum ~1.4 E+27 kgm2s−1. Accordingly, if a plate decelerates, other plates must increase their angular momentums to compensate. In addition, the azimuth of the maximum velocity vectors yields clues as to why the "bend" in the Emperor-Hawaiian seamount trend occurred near 46 Myr. This report summarizes processing results for 12 of the 14 major tectonic plates of the Earth (except for the Juan de Fuca and Philippine plates. Plate accelerations support the contention that plate tectonics is a product of torques that most likely are sustained by the sinking of positive density anomalies due to phase changes in subducted gabbroic lithosphere at depth in the upper lower mantle (above 1200 km depth. The tectonic plates are pulled along by the sinking of these positive mass anomalies, rather than moving at near constant velocity on the crests of convection cells driven by rising heat. These results imply that spreading centers are primarily passive reactive

  15. Vehicle License Plate Recognition Syst

    Directory of Open Access Journals (Sweden)

    Meenakshi,R. B. Dubey

    2012-12-01

    Full Text Available The vehicle license plate recognition system has greater efficiency for vehicle monitoring in automatic zone access control. This Plate recognition system will avoid special tags, since all vehicles possess a unique registration number plate. A number of techniques have been used for car plate characters recognition. This system uses neural network character recognition and pattern matching of characters as two character recognition techniques. In this approach multilayer feed-forward back-propagation algorithm is used. The performance of the proposed algorithm has been tested on several car plates and provides very satisfactory results.

  16. Large-format imaging plate and weissenberg camera for accurate protein crystallographic data collection using synchrotron radiation.

    Science.gov (United States)

    Sakabe, K; Sasaki, K; Watanabe, N; Suzuki, M; Wang, Z G; Miyahara, J; Sakabe, N

    1997-05-01

    Off-line and on-line protein data-collection systems using an imaging plate as a detector are described and their components reported. The off-line scanner IPR4080 was developed for a large-format imaging plate ;BASIII' of dimensions 400 x 400 mm and 400 x 800 mm. The characteristics of this scanner are a dynamic range of 10(5) photons pixel(-1), low background noise and high sensitivity. A means of reducing electronic noise and a method for finding the origin of the noise are discussed in detail. A dedicated screenless Weissenberg camera matching IPR4080 with synchrotron radiation was developed and installed on beamline BL6B at the Photon Factory. This camera can attach one or two sheets of 400 x 800 mm large-format imaging plate inside the film cassette by evacuation. The positional reproducibility of the imaging plate on the cassette is so good that the data can be processed by batch job. Data of 93% completeness up to 1.6 A resolution were collected on a single axis rotation and the value of R(merge) becomes 4% from a tetragonal lysozyme crystal using a set of two imaging-plate sheets. Comparing two types of imaging plates, the signal-to-noise ratio of the ST-VIP-type imaging plate is 25% better than that of the BASIII-type imaging plate for protein data collection using 1.0 and 0.7 A X-rays. A new on-line protein data-collection system with imaging plates is specially designed to use synchrotron radiation X-rays at maximum efficiency.

  17. Using plate mapping to examine portion size and plate composition for large and small divided plates.

    Science.gov (United States)

    Sharp, David E; Sobal, Jeffery; Wansink, Brian

    2014-12-01

    Does the size of a plate influence the serving of all items equally, or does it influence the serving of some foods - such as meat versus vegetables - differently? To examine this question, we used the new method of plate mapping, where people drew a meal on a paper plate to examine sensitivity to small versus large three-compartment divided plates in portion size and meal composition in a sample of 109 university students. The total drawn meal area was 37% bigger on large plates than small plates, which showed that the portion of plate coverage did not differ by plate size. Men and women drew bigger vegetable portions and men drew bigger meat portions on large plates when compared to small plates. These results suggest that men and women are differentially sensitive to plate size for overall meal size and for meal composition. Implications for decreasing portion size and improving meal balance are that plate size may influence portion size and change the proportions of foods served.

  18. MULTI-OBJECTIVE ONLINE OPTIMIZATION OF BEAM LIFETIME AT APS

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yipeng

    2017-06-25

    In this paper, online optimization of beam lifetime at the APS (Advanced Photon Source) storage ring is presented. A general genetic algorithm (GA) is developed and employed for some online optimizations in the APS storage ring. Sextupole magnets in 40 sectors of the APS storage ring are employed as variables for the online nonlinear beam dynamics optimization. The algorithm employs several optimization objectives and is designed to run with topup mode or beam current decay mode. Up to 50\\% improvement of beam lifetime is demonstrated, without affecting the transverse beam sizes and other relevant parameters. In some cases, the top-up injection efficiency is also improved.

  19. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  20. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.

    1999-10-25

    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  1. Temperature field of steel plate cooling process after plate rolling

    Directory of Open Access Journals (Sweden)

    Huijun Feng, Lingen Chen, Fengrui Sun

    2015-01-01

    Full Text Available Based on numerical calculation with Matlab, the study on cooling process after plate rolling is carried out, and the temperature field distribution of the plate varying with the time is obtained. The effects of the plate thickness, final rolling temperature, cooling water temperature, average flow rate of the cooling water, carbon content of the plate and cooling method on the plate surface and central temperatures as well as final cooling temperature are discussed. For the same cooling time, the plate surface and central temperatures as well as their temperature difference increase; with the decrease in rolling temperature and the increase in average flow rate of the cooling water, the plate surface and central temperatures decrease. Compared with the single water cooling process, the temperature difference between the plate centre and surface based on intermittent cooling is lower. In this case, the temperature uniformity of the plate is better, and the corresponding thermal stress is lower. The fitting equation of the final cooling temperature with respect to plate thickness, final rolling temperature, cooling water temperature and average flow rate of the cooling water is obtained.

  2. Design, construction, characterization, and application of a hyperspectral microarray scanner.

    Science.gov (United States)

    Sinclair, Michael B; Timlin, Jerilyn A; Haaland, David M; Werner-Washburne, Margaret

    2004-04-01

    We describe the design, construction, and operation of a hyperspectral microarray scanner for functional genomic research. The hyperspectral instrument operates with spatial resolutions ranging from 3 to 30 microm and records the emission spectrum between 490 and 900 nm with a spectral resolution of 3 nm for each pixel of the microarray. This spectral information, when coupled with multivariate data analysis techniques, allows for identification and elimination of unwanted artifacts and greatly improves the accuracy of microarray experiments. Microarray results presented in this study clearly demonstrate the separation of fluorescent label emission from the spectrally overlapping emission due to the underlying glass substrate. We also demonstrate separation of the emission due to green fluorescent protein expressed by yeast cells from the spectrally overlapping autofluorescence of the yeast cells and the growth media.

  3. Vibration measurements of a wire scanner - Experimental setup and models

    Science.gov (United States)

    Herranz, Juan; Barjau, Ana; Dehning, Bernd

    2016-03-01

    In the next years the luminosity of the LHC will be significantly increased. This will require a much higher accuracy of beam profile measurement than actually achievable by the current wire scanner. The new performance demands a wire travelling speed up to 20 m s-1 and a position measurement accuracy of the order of 1 μm. The vibrations of the mechanical parts of the system and particularly the vibrations of the thin carbon wire have been identified as the major error sources of wire position uncertainty. Therefore the understanding of the wire vibrations has been given high priority for the design and operation of the new device. This article presents a new strategy to measure the wire vibrations based on the piezoresistive effect of the wire itself. An electronic readout system based on a Wheatstone bridge is used to measure the variation of the carbon wire resistance, which is directly proportional to the wire elongation caused by the oscillations.

  4. An innovative optical and chemical drill core scanner

    Science.gov (United States)

    Sjöqvist, A. S. L.; Arthursson, M.; Lundström, A.; Calderón Estrada, E.; Inerfeldt, A.; Lorenz, H.

    2015-05-01

    We describe a new innovative drill core scanner that semi-automatedly analyses drill cores directly in drill core trays with X-ray fluorescence spectrometry, without the need for much sample preparation or operator intervention. The instrument is fed with entire core trays, which are photographed at high resolution and scanned by a 3-D profiling laser. Algorithms recognise the geometry of the core tray, number of slots, location of the drill cores, calculate the optimal scanning path, and execute a continuous XRF analysis of 2 cm width along the core. The instrument is equipped with critical analytical components that allow an effective QA/QC routine to be implemented. It is a mobile instrument that can be manoeuvred by a single person with a manual pallet jack.

  5. An intensity-based stochastic model for terrestrial laser scanners

    Science.gov (United States)

    Wujanz, D.; Burger, M.; Mettenleiter, M.; Neitzel, F.

    2017-03-01

    Up until now no appropriate models have been proposed that are capable to describe the stochastic characteristics of reflectorless rangefinders - the key component of terrestrial laser scanners. This state has to be rated as unsatisfactory especially from the perception of Geodesy where comprehensive knowledge about the precision of measurements is of vital importance, for instance to weigh individual observations or to reveal outliers. In order to tackle this problem, a novel intensity-based stochastic model for the reflectorless rangefinder of a Zoller + Fröhlich Imager 5006 h is experimentally derived. This model accommodates the influence of the interaction between the emitted signal and object surface as well as the acquisition configuration on distance measurements. Based on two different experiments the stochastic model has been successfully verified for three chosen sampling rates.

  6. Modeling of estuarne chlorophyll a from an airborne scanner

    Science.gov (United States)

    Khorram, Siamak; Catts, Glenn P.; Cloern, James E.; Knight, Allen W.

    1987-01-01

    Near simultaneous collection of 34 surface water samples and airborne multispectral scanner data provided input for regression models developed to predict surface concentrations of estuarine chlorophyll a. Two wavelength ratios were employed in model development. The ratios werechosen to capitalize on the spectral characteristics of chlorophyll a, while minimizing atmospheric influences. Models were then applied to data previously acquired over the study area thre years earlier. Results are in the form of color-coded displays of predicted chlorophyll a concentrations and comparisons of the agreement among measured surface samples and predictions basedon coincident remotely sensed data. The influence of large variations in fresh-water inflow to the estuary are clearly apparent in the results. The synoptic view provided by remote sensing is another method of examining important estuarine dynamics difficult to observe from in situ sampling alone.

  7. Crop water-stress assessment using an airborne thermal scanner

    Science.gov (United States)

    Millard, J. P.; Jackson, R. D.; Reginato, R. J.; Idso, S. B.; Goettelman, R. C.

    1978-01-01

    An airborne thermal scanner was used to measure the temperature of a wheat crop canopy in Phoenix, Arizona. The results indicate that canopy temperatures acquired about an hour and a half past solar noon were well correlated with presunrise plant water tension, a parameter directly related to plant growth and development. Pseudo-colored thermal images reading directly in stress degree days, a unit indicative of crop irrigation needs and yield potential, were produced. The aircraft data showed significant within-field canopy temperature variability, indicating the superiority of the synoptic view provided by aircraft over localized ground measurements. The standard deviation between airborne and ground-acquired canopy temperatures was 2 C or less.

  8. Detector characterization for an inline PET scanner in hadrontherapy

    Energy Technology Data Exchange (ETDEWEB)

    Taverne, Marina [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Boutemeur, Madjid [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Buthod, Anthony [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Guigues, Laurent [CREATIS, INSA Lyon, avenue Albert Einstein, 69100 Villeurbanne (France); Henriquet, Pierre [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Lollierou, Julien [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Ricol, Marie-Charlotte [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Rosset-Lanchet, Remi [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Roubin, Mathieu [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Saidi, Reda [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France); Sappey-Marinier, Dominique [CREATIS, INSA Lyon, avenue Albert Einstein, 69100 Villeurbanne (France); Testa, Etienne [IPNL, Universite Claude Bernard Lyon 1, 4 rue Enrico Fermi, 69100 Villeurbanne (France)]. E-mail: taverne@ipnl.in2p3.fr

    2007-02-01

    Our group at the 'Institut de Physique Nucleaire de Lyon' (IPNL) is working on physics and detectors for medical imaging. We are presently developing a small animal Positron Emission Tomograph (PET) scanner prototype with an innovative slow control and data acquisition features, for a demonstration purpose and within the crystal clear international collaboration. We also investigate a feasibility study of an online PET dedicated for inline and in situ dose deposition control in hadrontherapy. Here, we present the characterization setup and method we used to calibrate the detector heads of our PET prototype. Each of these heads consists of a single block continuous scintillating LySO crystal coupled to a multi-anode photomultiplier equipped with its proper acquisition readout chain.

  9. Advanced Multispectral Scanner (AMS) study. [aircraft remote sensing

    Science.gov (United States)

    1978-01-01

    The status of aircraft multispectral scanner technology was accessed in order to develop preliminary design specifications for an advanced instrument to be used for remote sensing data collection by aircraft in the 1980 time frame. The system designed provides a no-moving parts multispectral scanning capability through the exploitation of linear array charge coupled device technology and advanced electronic signal processing techniques. Major advantages include: 10:1 V/H rate capability; 120 deg FOV at V/H = 0.25 rad/sec; 1 to 2 rad resolution; high sensitivity; large dynamic range capability; geometric fidelity; roll compensation; modularity; long life; and 24 channel data acquisition capability. The field flattening techniques of the optical design allow wide field view to be achieved at fast f/nos for both the long and short wavelength regions. The digital signal averaging technique permits maximization of signal to noise performance over the entire V/H rate range.

  10. ARIES segmented gamma-ray scanner user manual

    Energy Technology Data Exchange (ETDEWEB)

    Biddle, R.S.; Sheppard, G.A.; Schneider, C.M.

    1998-04-16

    The segmented gamma-ray scatter (SGS) designated as Win{_}SGS at the Los Alamos Plutonium Facility has been installed and is intended for use in quantifying the radioisotope content of DOE-STD-3013-96 equivalent containers. The SGS features new software written in C and a new user interface that runs under Microsoft Windows{trademark}. The operation of the ARIES Segmented Gamma-ray Scanner is documented in this manual. It covers user instructions as well as hardware and software details. Additional information is found in the documentation for the commercially available components and modules that compose the SGS. The objective of the ARIES project is to demonstrate technology to dismantle plutonium pits from excess nuclear weapons, convert the plutonium to a metal ingot or an oxide powder, package the metal or oxide, and verify the contents of the package by nondestructive assay.

  11. Real Plates and Dubious Microplates

    Science.gov (United States)

    Kogan, M. G.; Steblov, G. M.

    2008-12-01

    From the onset of plate tectonics, the existence of most of the plates was never put in doubt, although the boundaries of some plates, like Africa, were later revised. There are however, two microplates in northeast Asia, the Amurian and Okhotsk, whose existence and the sense of rotation was revised several times. The rms value of plate-residual GPS velocities is 0.5-0.9 mm/a for sets of stations representing the motion of the following plates: Antarctic, Australian, Eurasian, North American, Nubian, Pacific, and South American. This value can be regarded as an upper bound on deviation of real plates from infinite stiffness. The rms value of plate-residual GPS velocities is 1.2-1.8 mm/a for the Indian, Nazca, and Somalian plates. Higher rms values for India and Nazca are attributed to the noisier data. The higher rms value for Somalia appears to arise from the distributed deformation to the east of the East African Rift; whether this statement is true can only be decided from observations of denser network in the future. From the analysis of plate-residual GPS velocities, the Canadian Arctic and northeastern Siberia belong to the North American plate. The detailed GPS survey on Sakhalin Island shows that the Sea of Okhotsk region also belongs to the North American plate while the region to the west of it belongs to the Eurasian plate. These results provide a constraint on the geometry of the North American plate and put in doubt the existence of smaller plates in northeast Asia.

  12. Absolute dosimetric characterization of Gafchromic EBT3 and HDv2 films using commercial flat-bed scanners and evaluation of the scanner response function variability

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S. N.; Revet, G.; Fuchs, J. [LULI-CNRS, Ecole Polytechnique, CEA: Universite Paris-Saclay, UPMC Univ Paris 06, Sorbonne Universities, F-91128 Palaiseau Cedex (France); Institute of Applied Physics, 46 Ulyanov Street, 603950 Nizhny Novgorod (Russian Federation); Gauthier, M.; Glenzer, S.; Propp, A. [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, California 94025 (United States); Bazalova-Carter, M. [Department of Physics and Astronomy, University of Victoria, Victoria, British Columbia V8P 5C2 (Canada); Bolanos, S. [LULI-CNRS, Ecole Polytechnique, CEA: Universite Paris-Saclay, UPMC Univ Paris 06, Sorbonne Universities, F-91128 Palaiseau Cedex (France); Riquier, R. [LULI-CNRS, Ecole Polytechnique, CEA: Universite Paris-Saclay, UPMC Univ Paris 06, Sorbonne Universities, F-91128 Palaiseau Cedex (France); CEA, DAM, DIF, F-91297 Arpajon (France); Antici, P. [INRS-EMT, Varennes, J3X1S2 Québec (Canada); Morabito, A. [ELI-ALPS, ELI-HU non profit kft, Dugonics ter 13, H-6720, Szeged (Hungary); Starodubtsev, M. [Institute of Applied Physics, 46 Ulyanov Street, 603950 Nizhny Novgorod (Russian Federation)

    2016-07-15

    Radiochromic films (RCF) are commonly used in dosimetry for a wide range of radiation sources (electrons, protons, and photons) for medical, industrial, and scientific applications. They are multi-layered, which includes plastic substrate layers and sensitive layers that incorporate a radiation-sensitive dye. Quantitative dose can be retrieved by digitizing the film, provided that a prior calibration exists. Here, to calibrate the newly developed EBT3 and HDv2 RCFs from Gafchromic™, we used the Stanford Medical LINAC to deposit in the films various doses of 10 MeV photons, and by scanning the films using three independent EPSON Precision 2450 scanners, three independent EPSON V750 scanners, and two independent EPSON 11000XL scanners. The films were scanned in separate RGB channels, as well as in black and white, and film orientation was varied. We found that the green channel of the RGB scan and the grayscale channel are in fact quite consistent over the different models of the scanner, although this comes at the cost of a reduction in sensitivity (by a factor ∼2.5 compared to the red channel). To allow any user to extend the absolute calibration reported here to any other scanner, we furthermore provide a calibration curve of the EPSON 2450 scanner based on absolutely calibrated, commercially available, optical density filters.

  13. Human Immunodeficiency Virus Type 2 (HIV-2 Gag Is Trafficked in an AP-3 and AP-5 Dependent Manner.

    Directory of Open Access Journals (Sweden)

    Justine E Alford

    Full Text Available Although human immunodeficiency virus (HIV types 1 and 2 are closely related lentiviruses with similar replication cycles, HIV-2 infection is associated with slower progression to AIDS, a higher proportion of long term non-progressors, and lower rates of transmission than HIV-1, likely as a consequence of a lower viral load during HIV-2 infection. A mechanistic explanation for the differential viral load remains unclear but knowledge of differences in particle production between HIV-1 and HIV-2 may help to shed light on this issue. In contrast to HIV-1, little is known about the assembly of HIV-2 particles, and the trafficking of HIV-2 Gag, the structural component of the virus, within cells. We have established that HIV-2 Gag accumulates in intracellular CD63 positive compartments, from which it may be delivered or recycled to the cell surface, or degraded. HIV-2 particle release was dependent on the adaptor protein complex AP-3 and the newly identified AP-5 complex, but much less so on AP-1. In contrast, HIV-1 particle release required AP-1 and AP-3, but not AP-5. AP-2, an essential component of clathrin-mediated endocytosis, which was previously shown to be inhibitory to HIV-1 particle release, had no effect on HIV-2. The differential requirement for adaptor protein complexes confirmed that HIV-1 and HIV-2 Gag have distinct cellular trafficking pathways, and that HIV-2 particles may be more susceptible to degradation prior to release.

  14. 21 CFR 862.2400 - Densitometer/scanner (integrating, reflectance, TLC, or radiochromatogram) for clinical use.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Densitometer/scanner (integrating, reflectance, TLC, or radiochromatogram) for clinical use. 862.2400 Section 862.2400 Food and Drugs FOOD AND DRUG..., reflectance, TLC, or radiochromatogram) for clinical use. (a) Identification. A densitometer/scanner...

  15. Laser identification system based on acousto-optical barcode scanner principles

    Science.gov (United States)

    Khansuvarov, Ruslan A.; Korol, Georgy I.; Preslenev, Leonid N.; Bestugin, Aleksandr R.; Paraskun, Arthur S.

    2016-09-01

    The main purpose of the bar code in the modern world is the unique identification of the product, service, or any of their features, so personal and stationary barcode scanners so widely used. One of the important parameters of bar code scanners is their reliability, accuracy of the barcode recognition, response time and performance. Nowadays, the most popular personal barcode scanners contain a mechanical part, which extremely impairs the reliability indices. Group of SUAI engineers has proposed bar code scanner based on laser beam acoustic deflection effect in crystals [RU patent No 156009 issued 4/16/2015] Through the use of an acousto-optic deflector element in barcode scanner described by a group of engineers SUAI, it can be implemented in the manual form factor, and the stationary form factor of a barcode scanner. Being a wave electronic device, an acousto-optic element in the composition of the acousto-optic barcode scanner allows you to clearly establish a mathematical link between the encoded function of the bar code with the accepted input photodetector intensities function that allows you to speak about the great probability of a bar code clear definition. This paper provides a description of the issued patent, the description of the principles of operation based on the mathematical analysis, a description of the layout of the implemented scanner.

  16. Digitisation of electron microscope films: Six useful tests applied to three film scanners

    Energy Technology Data Exchange (ETDEWEB)

    Henderson, R. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom)]. E-mail: rh15@mrc-lmb.cam.ac.uk; Cattermole, D. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom); McMullan, G. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom); Scotcher, S. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom); Fordham, M. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom); Amos, W.B. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom); Faruqi, A.R. [MRC Laboratory of Molecular Biology, Hills Road, Cambridge CB2 2QH (United Kingdom)

    2007-02-15

    A series of simple tests have been used to measure the performance of flat-bed film scanners suitable for digitisation of electron micrographs. Two of the film scanners evaluated are commercially available and one has been constructed in the laboratory paying special attention to the needs of the electron microscopist. The tests may be useful for others.

  17. Development of a proton Computed Tomography (pCT) scanner at NIU

    CERN Document Server

    Uzunyan, S A; Boi, S; Coutrakon, G; Dyshkant, A; Erdelyi, B; Gearhart, A; Hedin, D; Johnson, E; Krider, J; Zutshi, V; Ford, R; Fitzpatrick, T; Sellberg, G; Rauch, J E; Roman, M; Rubinov, P; Wilson, P; Lalwani, K; Naimuddin, M

    2013-01-01

    We describe the development of a proton Computed Tomography (pCT) scanner at Northern Illinois University (NIU) in collaboration with Fermilab and Delhi University. This paper provides an overview of major components of the scanner and a detailed description of the data acquisition system (DAQ).

  18. Application of intra-oral dental scanners in the digital workflow of implantology

    NARCIS (Netherlands)

    van der Meer, Wicher J; Andriessen, Frank S; Wismeijer, Daniel; Ren, Yijin

    2012-01-01

    UNLABELLED: Intra-oral scanners will play a central role in digital dentistry in the near future. In this study the accuracy of three intra-oral scanners was compared. MATERIALS AND METHODS: A master model made of stone was fitted with three high precision manufactured PEEK cylinders and scanned wit

  19. Application of intra-oral dental scanners in the digital workflow of implantology

    NARCIS (Netherlands)

    van der Meer, W.J.; Andriessen, F.S.; Wismeijer, D.; Ren, Y.

    2012-01-01

    Intra-oral scanners will play a central role in digital dentistry in the near future. In this study the accuracy of three intra-oral scanners was compared. Materials and methods: A master model made of stone was fitted with three high precision manufactured PEEK cylinders and scanned with three intr

  20. Validity and Repeatability of the Sizestream 3D Scanner and Poikos Modeling System

    NARCIS (Netherlands)

    Vonk, T.E.; Daanen, H.A.M.

    2015-01-01

    Three-dimensional (3D) body scanning becomes increasingly important in the medical, ergonomical and apparel industry. The SizeStream 3D body scanner is a 3D body scanner in the shape of a fitting room that can generate a 3D copy of the human body in a few seconds. The Poikos modeling system

  1. Calibration between a Laser Range Scanner and an Industrial Robot Manipulator

    DEFF Research Database (Denmark)

    Andersen, Thomas Timm; Andersen, Nils Axel; Ravn, Ole

    2014-01-01

    In this paper we present a method for findingthe transformation between a laser scanner and a robotmanipulator. We present the design of a flat calibration targetthat can easily fit between a laser scanner and a conveyor belt,making the method easily implementable in a manufacturingline.We prove...

  2. Application of intra-oral dental scanners in the digital workflow of implantology

    NARCIS (Netherlands)

    van der Meer, W.J.; Andriessen, F.S.; Wismeijer, D.; Ren, Y.

    2012-01-01

    Intra-oral scanners will play a central role in digital dentistry in the near future. In this study the accuracy of three intra-oral scanners was compared. Materials and methods: A master model made of stone was fitted with three high precision manufactured PEEK cylinders and scanned with three intr

  3. The estimation of pre- and postpromotion dips with store-level scanner data

    NARCIS (Netherlands)

    Heerde, Harald J. van; Leeflang, Peter S.H.; Wittink, Dick R.

    1999-01-01

    One of the mysteries of store-level scanner data modeling is the lack of a dip in sales in the week(s) following a promotion. Researchers expect to find a postpromotion dip because analyses of household scanner panel data indicate that consumers tend to accelerate their purchases in response to a pr

  4. The estimation of pre- and postpromotion dips with store-level scanner data

    NARCIS (Netherlands)

    Van Heerde, HJ; Leeflang, PSH; Wittink, DR

    2000-01-01

    One of the mysteries of store-level scanner data modeling is the lack of a dip in sales in the weeks following a promotion. Researchers expect to find a postpromotion dip because analyses of household scanner panel data indicate that consumers tend to accelerate their purchases in response to a prom

  5. Validity and Repeatability of the Sizestream 3D Scanner and Poikos Modeling System

    NARCIS (Netherlands)

    Vonk, T.E.; Daanen, H.A.M.

    2015-01-01

    Three-dimensional (3D) body scanning becomes increasingly important in the medical, ergonomical and apparel industry. The SizeStream 3D body scanner is a 3D body scanner in the shape of a fitting room that can generate a 3D copy of the human body in a few seconds. The Poikos modeling system generate

  6. Performance of the Transverse Oscillation method using beamformed data from a commercial scanner

    DEFF Research Database (Denmark)

    Pihl, Michael Johannes; Nikolov, S.; Haugaard, P.

    2009-01-01

    of this is evaluated on a commercial platform. Beamformed data are acquired using a commercial BK Medical scanner as opposed to the previously reported results obtained with the experimental scanner RASMUS. The implementation is evaluated using an in-house circulating flow rig by calculating the relative mean standard...

  7. Effect of multifunctional protein YB-1 on the AP site cleavage by AP endonuclease 1 and tyrosyl phosphodiesterase 1

    Directory of Open Access Journals (Sweden)

    Ovchinnikov L. P.

    2012-07-01

    Full Text Available Apurinic/apyrimidinic sites (AP sites which represent one of the most abundantly generated DNA lesions in the cell are generally repaired by base excision repair (BER pathway. Multifunctional protein YB-1 is known to participate in cellular response to genotoxic stress and was shown to interact with several components of BER – DNA glycosylases NTH1, NEIL2, DNA polymerase and DNA ligase III. Therefore, it is of great interest to investigate the influence of YB-1 on one of the major BER enzymes, responsible for AP site cleavage, AP endonuclease APE1, and on tyrosyl phosphodiesterase Tdp1, participating in APE1 independent pathway of AP site repair. Aim. Effect of multifunctional protein YB-1 on the AP site cleavage by the activities of APE1 and Tdp1 was studied. Methods. Gel-mobility shift assays and enzyme activity tests. Results. YB-1 was shown to inhibit the cleavage of AP site located in single-stranded DNA by both APE1 and Tdp1. Stimulation of APE1 activity on protruding double-stranded DNA in the presence of YB-1 was observed, whereas no effect on Tdp1-mediated cleavage of AP site in double-stranded DNA was found. Conclusions. YB-1 can modulate the repair of AP sites in DNA by both positively stimulating APE1 during the classic BER of AP sites and avoiding a possible generation of doublestrand breaks, arising from the cleavage of single-stranded portion of DNA substrate already used by different DNA-processing pathway

  8. SU-E-P-11: Comparison of Image Quality and Radiation Dose Between Different Scanner System in Routine Abdomen CT

    Energy Technology Data Exchange (ETDEWEB)

    Liao, S; Wang, Y; Weng, H [Chiayi Chang Gung Memorial Hospital of The C.G.M.F, Puzi City, Chiayi County, Taiwan (China)

    2015-06-15

    Purpose To evaluate image quality and radiation dose of routine abdomen computed tomography exam with the automatic current modulation technique (ATCM) performed in two different brand 64-slice CT scanners in our site. Materials and Methods A retrospective review of routine abdomen CT exam performed with two scanners; scanner A and scanner B in our site. To calculate standard deviation of the portal hepatic level with a region of interest of 12.5 mm x 12.5mm represented to the image noise. The radiation dose was obtained from CT DICOM image information. Using Computed tomography dose index volume (CTDIv) to represented CT radiation dose. The patient data in this study were with normal weight (about 65–75 Kg). Results The standard deviation of Scanner A was smaller than scanner B, the scanner A might with better image quality than scanner B. On the other hand, the radiation dose of scanner A was higher than scanner B(about higher 50–60%) with ATCM. Both of them, the radiation dose was under diagnostic reference level. Conclusion The ATCM systems in modern CT scanners can contribute a significant reduction in radiation dose to the patient. But the reduction by ATCM systems from different CT scanner manufacturers has slightly variation. Whatever CT scanner we use, it is necessary to find the acceptable threshold of image quality with the minimum possible radiation exposure to the patient in agreement with the ALARA principle.

  9. Plate Full of Color

    Centers for Disease Control (CDC) Podcasts

    2008-08-04

    The Eagle Books are a series of four books that are brought to life by wise animal characters - Mr. Eagle, Miss Rabbit, and Coyote - who engage Rain That Dances and his young friends in the joy of physical activity, eating healthy foods, and learning from their elders about health and diabetes prevention. Plate Full of Color teaches the value of eating a variety of colorful and healthy foods.  Created: 8/4/2008 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP).   Date Released: 8/5/2008.

  10. Dynamics of Tectonic Plates

    CERN Document Server

    Pechersky, E; Sadowski, G; Yambartsev, A

    2014-01-01

    We suggest a model that describes a mutual dynamic of tectonic plates. The dynamic is a sort of stick-slip one which is modeled by a Markov random process. The process defines a microlevel of the dynamic. A macrolevel is obtained by a scaling limit which leads to a system of integro-differential equations which determines a kind of mean field systems. Conditions when Gutenberg-Richter empirical law are presented on the mean field level. These conditions are rather universal and do not depend on features of resistant forces.

  11. Dynamics of Tectonic Plates

    OpenAIRE

    2014-01-01

    We suggest a model that describes a mutual dynamic of tectonic plates. The dynamic is a sort of stick-slip one which is modeled by a Markov random process. The process defines a microlevel of the dynamic. A macrolevel is obtained by a scaling limit which leads to a system of integro-differential equations which determines a kind of mean field systems. Conditions when Gutenberg-Richter empirical law are presented on the mean field level. These conditions are rather universal and do not depend ...

  12. Surface curvature of pelvic joints from three laser scanners: separating anatomy from measurement error.

    Science.gov (United States)

    Villa, Chiara; Gaudio, Daniel; Cattaneo, Cristina; Buckberry, Jo; Wilson, Andrew S; Lynnerup, Niels

    2015-03-01

    Recent studies have reported that quantifying symphyseal and auricular surface curvature changes on 3D models acquired by laser scanners has a potential for age estimation. However, no tests have been carried out to evaluate the repeatability of the results between different laser scanners. 3D models of the two pelvic joints were generated using three laser scanners (Custom, Faro, and Minolta). The surface curvature, the surface area, and the distance between co-registered meshes were investigated. Close results were found for surface areas (differences between 0.3% and 2.4%) and for distance deviations (average laser scanners, but still showing similar trends with increasing phases/scores. Applying a smoothing factor to the 3D models, it was possible to separate anatomy from the measurement error of each instrument, so that similar curvature values could be obtained (p laser scanner.

  13. The AP2/EREBP family of plant transcription factors.

    Science.gov (United States)

    Riechmann, J L; Meyerowitz, E M

    1998-06-01

    AP2 (APETALA2) and EREBPs (ethylene-responsive element binding proteins) are the prototypic members of a family of transcription factors unique to plants, whose distinguishing characteristic is that they contain the so-called AP2 DNA-binding domain. AP2/ REBP genes form a large multigene family, and they play a variety of roles throughout the plant life cycle: from being key regulators of several developmental processes, like floral organ identity determination or control of leaf epidermal cell identity, to forming part of the mechanisms used by plants to respond to various types of biotic and environmental stress. The molecular and biochemical characteristics of the AP2/EREBP transcription factors and their diverse functions are reviewed here, and this multigene family is analyzed within the context of the Arabidopsis thaliana genome sequence project.

  14. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford

    1996-08-07

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  15. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  16. A hot-spare injector for the APS linac.

    Energy Technology Data Exchange (ETDEWEB)

    Lewellen, J. W.

    1999-04-13

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades.

  17. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  18. The mechanical behavior of locking compression plates compared with dynamic compression plates in a cadaver radius model.

    Science.gov (United States)

    Gardner, Michael J; Brophy, Robert H; Campbell, Deirdre; Mahajan, Amit; Wright, Timothy M; Helfet, David L; Lorich, Dean G

    2005-10-01

    The purpose of this cadaveric study was to compare the mechanical behavior of a locked compression plate, which uses threaded screw heads to create a fixed angle construct, with a dynamic compression plate construct in a cadaver radius model. Mechanical study with cyclic testing and high-speed optical motion analysis. Biomechanics laboratory at an academic institution. Eighteen pairs of fresh-frozen human cadaver radii were divided into 3 groups of 6 to be tested as a group in each of the following force applications: anteroposterior (AP) bending, mediolateral bending, or torsion. Each bone was osteotomized leaving a 5-mm fracture gap and then fixed with a plate. For each pair, 1 radius received a standard plate (limited-contact dynamic compression plates; LC-DCP), the contralateral radius was fixed with a locking compression plate (LCP), and specimens underwent cyclic loading. Normalized stiffness, average energy absorbed, and Newton-cycles to failure were calculated. In addition, a 3-dimensional, high-speed, infrared motion analysis system was used to evaluate motion at the fracture site. Construct stiffness, fracture site motion, cycles to failure, and energy absorption. Repeated measures ANOVA were used to detect differences between groups with time. In the torsion group, LCP specimens failed at 60% greater Newton-cycles than the LC-DCP (1473 vs. 918; P different biomechanical behavior with time. As cycling progressed in the LC-DCP specimens under torsion testing, stiffness (measured at the actuator at the bone ends) did not change significantly; however, fracture motion (measured at the fracture surfaces) decreased significantly (P = 0.04). The LCP specimens did not display similar behavior. Our findings indicated that LCP constructs may demonstrate subtle mechanical superiority compared with the LC-DCP. The LCP specimens had less energy absorption in the AP group and survived longer in the torsion group. Discordance of motion between measurement regions was

  19. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  20. GeoDCAT-AP: Use cases and open issues

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; Lutz, Michael

    2016-01-01

    This paper illustrates some issues and use cases identified during the design and implementation of GeoDCAT-AP, a metadata profile aiming to provide a representation of geospatial metadata compliant with the DCAT application profile for European data portals (DCAT-AP). In particular, the paper focuses on those issues that may have a possible relevance also outside the geospatial domain, covering topics concerning metadata profile-based negotiation, publishing metadata on the Web, represen...

  1. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  2. Design considerations for a limited angle, dedicated breast, TOF PET scanner

    Energy Technology Data Exchange (ETDEWEB)

    Surti, S; Karp, J S [Department of Radiology, University of Pennsylvania, Philadelphia, PA 19104 (United States)], E-mail: surti@mail.med.upenn.edu, E-mail: joelkarp@mail.med.upenn.edu

    2008-06-07

    Development of partial ring, dedicated breast positron emission tomography (PET) scanners is an active area of research. Due to the limited angular coverage, generation of distortion and artifact-free, fully 3D tomographic images is not possible without rotation of the detectors. With time-of-flight (TOF) information, it is possible to achieve the 3D tomographic images with limited angular coverage and without detector rotation. We performed simulations for a breast scanner design with a ring diameter and an axial length of 15 cm and comprising a full (180{sup 0} in-plane angular coverage), 2/3 (120{sup 0} in-plane angular coverage) or 1/2 (90{sup 0} in-plane angular coverage) ring detector. Our results show that as the angular coverage decreases, improved timing resolution is needed to achieve distortion-free and artifact-free images with TOF. The contrast recovery coefficient (CRC) value for small hot lesions in a partial ring scanner is similar to a full ring non-TOF scanner. Our results indicate that a timing resolution of 600 ps is needed for a 2/3 ring scanner, while a timing resolution of 300 ps is needed for a 1/2 ring scanner. We also analyzed the ratio of lesion CRC to the background pixel noise (SNR) and concluded that TOF improves the SNR values of the partial ring scanner, and helps to compensate for the loss in sensitivity due to reduced geometric sensitivity in a limited angle coverage PET scanner. In particular, it is possible to maintain similar SNR characteristic in a 2/3 ring scanner with a timing resolution of 300 ps as in a full ring non-TOF scanner.

  3. Design considerations for a limited angle, dedicated breast, TOF PET scanner

    Science.gov (United States)

    Surti, S.; Karp, J. S.

    2008-06-01

    Development of partial ring, dedicated breast positron emission tomography (PET) scanners is an active area of research. Due to the limited angular coverage, generation of distortion and artifact-free, fully 3D tomographic images is not possible without rotation of the detectors. With time-of-flight (TOF) information, it is possible to achieve the 3D tomographic images with limited angular coverage and without detector rotation. We performed simulations for a breast scanner design with a ring diameter and an axial length of 15 cm and comprising a full (180° in-plane angular coverage), 2/3 (120° in-plane angular coverage) or 1/2 (90° in-plane angular coverage) ring detector. Our results show that as the angular coverage decreases, improved timing resolution is needed to achieve distortion-free and artifact-free images with TOF. The contrast recovery coefficient (CRC) value for small hot lesions in a partial ring scanner is similar to a full ring non-TOF scanner. Our results indicate that a timing resolution of 600 ps is needed for a 2/3 ring scanner, while a timing resolution of 300 ps is needed for a 1/2 ring scanner. We also analyzed the ratio of lesion CRC to the background pixel noise (SNR) and concluded that TOF improves the SNR values of the partial ring scanner, and helps to compensate for the loss in sensitivity due to reduced geometric sensitivity in a limited angle coverage PET scanner. In particular, it is possible to maintain similar SNR characteristic in a 2/3 ring scanner with a timing resolution of 300 ps as in a full ring non-TOF scanner.

  4. CMS Resistive plate Champers

    CERN Document Server

    Zainab, Karam

    2013-01-01

    There are many types of gas detectors which are used in CERN in LHC project, There is a main parts for the gas detectors which must be in all gas detectors types like Multiwire proportional chambers, such as the micromesh gaseous structure chamber (the MicroMegas), Gas-electron multiplier (GEM) detector, Resistive Plate Champers... Compact Muon Solenoid (CMS) experiment detecting muons which are powerful tool for recognizing signatures of interesting physics processes. The CMS detector uses: drift tube (DT), cathode strip chamber (CSC) and resistive plate chamber (RPC). Building RPC’s was my project in summer student program (hardware). RPC’s have advantages which are triggering detector and Excellent time resolution which reinforce the measurement of the correct beam crossing time. RPC’s Organized in stations :  RPC barrel (RB) there are 4 stations, namely RB1, RB2, RB3, and RB4  While in the RPC endcap (RE) the 3 stations are RE1, RE2, and RE3. In the endcaps a new starion will be added and this...

  5. Correlation of PUV and SUV in the extremities while using PEM as a high-resolution positron emission scanner

    Energy Technology Data Exchange (ETDEWEB)

    Rahim, Sania [The University of Texas MD Anderson Cancer Center, Division of Diagnostic Imaging, Houston, TX (United States); MD Anderson Cancer Center, Houston, TX (United States); Mawlawi, Osama; Taylor, Shree; Millican, Richelle; Swanston, Nancy M.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Division of Diagnostic Imaging, Houston, TX (United States); Fox, Patricia [The University of Texas MD Anderson Cancer Center, Division of Biostatistics, Houston, TX (United States); Brown, J.E. [Yale University Hospital, Department of Radiology, New Haven, CT (United States)

    2014-04-15

    Owing to its unique configuration of two adjustable plate detectors positron emission mammography, or PEM, could theoretically also function as a high-resolution positron emission scanner for the extremities or neck. PEM quantitates its activity via a ''PEM uptake value,'' or PUV, and although its relationship to the standardized uptake value, or SUV, has been demonstrated in the breasts, to our knowledge there are no studies validating PUV in other sites such as the extremities. This was a retrospective chart review of two separate protocols of a total of 15 patients. The patients all had hypermetabolic lesions in the extremities or neck on imaging with PET/CT and were sent after their PET/CT to PEM for further imaging. Owing to the sequential nature of these examinations no additional radiotracer was administered. Spearman's rank order correlation was calculated between the PUVmax obtained from PEM images, and the SUVmax for all. Spearman's rank order correlation for all sites was 0.42, which is not significantly different from 0 (p = 0.13). When neck lesions were excluded from the group, there was a strong and statistically significant correlation between PUVmax and SUVmax, with Spearman's rank correlation of 0.73, and significantly different from 0 (p = 0.0068). The correlation of PUV and SUV in the extremities indicates the potential use of PEM as a semiquantitative, high-resolution positron emission scanner and warrants further investigation, especially in the realms of disease processes that often present in the extremities, such as melanoma, osteomyelitis, and arthritis, as well as playing a role in the imaging of patients with metallic hardware post-limb salvage surgery. (orig.)

  6. AP1000模块化施工分析%Analysis of the AP1000 Modular Construction

    Institute of Scientific and Technical Information of China (English)

    邹玮

    2014-01-01

    文章针对AP1000机组模块化施工的技术和进度特点进行了分析,特别是对AP1000模块化施工面临的挑战和问题进行了深入的分析.这些挑战和问题有些是首台AP1000机组所特有的,有些将在后续AP1000机组建设过程中继续存在,文章分别阐述并提出了几项建议措施.

  7. Localised Plate Motion on Venus

    Science.gov (United States)

    Ghail, R. C.

    1996-03-01

    The volcanic and tectonic features observed in Dali Vinculum, Parga Vinculum and Imdr Regio are concentrated at long, narrow, curvilinear zones, with relatively minor volcanism and tectonism between these zones. These zones, whilst more diffuse than terrestrial plate boundaries, nevertheless define the margins of tectonic plates. In contrast to Earth, however, it appears that venusian plates are neither created nor destroyed by lateral motion. Rather, plates are thinned and intruded at vincula plate boundaries, vertically accreted by small-scale intra-plate (planitia) volcanism and perhaps destroyed by delamination of thickened crust in tesserae and montane regions such as Thetis Regio and Ishtar Terra. The diversity in age both between and within these three areas together with the evidence for infrequent, small scale resurfacing in the planitiae are difficult to reconcile with a non-uniformitarian geological process.

  8. Tectonics of the Easter plate

    Science.gov (United States)

    Engeln, J. F.; Stein, S.

    1984-01-01

    A new model for the Easter plate is presented in which rift propagation has resulted in the formation of a rigid plate between the propagating and dying ridges. The distribution of earthquakes, eleven new focal mechanisms, and existing bathymetric and magnetic data are used to describe the tectonics of this area. Both the Easter-Nazca and Easter-Pacific Euler poles are sufficiently close to the Easter plate to cause rapid changes in rates and directions of motion along the boundaries. The east and west boundaries are propagating and dying ridges; the southwest boundary is a slow-spreading ridge and the northern boundary is a complex zone of convergent and transform motion. The Easter plate may reflect the tectonics of rift propagation on a large scale, where rigid plate tectonics requires boundary reorientation. Simple schematic models to illustrate the general features and processes which occur at plates resulting from large-scale rift propagation are used.

  9. Tectonics of the Easter plate

    Science.gov (United States)

    Engeln, J. F.; Stein, S.

    1984-01-01

    A new model for the Easter plate is presented in which rift propagation has resulted in the formation of a rigid plate between the propagating and dying ridges. The distribution of earthquakes, eleven new focal mechanisms, and existing bathymetric and magnetic data are used to describe the tectonics of this area. Both the Easter-Nazca and Easter-Pacific Euler poles are sufficiently close to the Easter plate to cause rapid changes in rates and directions of motion along the boundaries. The east and west boundaries are propagating and dying ridges; the southwest boundary is a slow-spreading ridge and the northern boundary is a complex zone of convergent and transform motion. The Easter plate may reflect the tectonics of rift propagation on a large scale, where rigid plate tectonics requires boundary reorientation. Simple schematic models to illustrate the general features and processes which occur at plates resulting from large-scale rift propagation are used.

  10. MRI-derived measurements of human subcortical, ventricular and intracranial brain volumes: Reliability effects of scan sessions, acquisition sequences, data analyses, scanner upgrade, scanner vendors and field strengths.

    Science.gov (United States)

    Jovicich, Jorge; Czanner, Silvester; Han, Xiao; Salat, David; van der Kouwe, Andre; Quinn, Brian; Pacheco, Jenni; Albert, Marilyn; Killiany, Ronald; Blacker, Deborah; Maguire, Paul; Rosas, Diana; Makris, Nikos; Gollub, Randy; Dale, Anders; Dickerson, Bradford C; Fischl, Bruce

    2009-05-15

    Automated MRI-derived measurements of in-vivo human brain volumes provide novel insights into normal and abnormal neuroanatomy, but little is known about measurement reliability. Here we assess the impact of image acquisition variables (scan session, MRI sequence, scanner upgrade, vendor and field strengths), FreeSurfer segmentation pre-processing variables (image averaging, B1 field inhomogeneity correction) and segmentation analysis variables (probabilistic atlas) on resultant image segmentation volumes from older (n=15, mean age 69.5) and younger (both n=5, mean ages 34 and 36.5) healthy subjects. The variability between hippocampal, thalamic, caudate, putamen, lateral ventricular and total intracranial volume measures across sessions on the same scanner on different days is less than 4.3% for the older group and less than 2.3% for the younger group. Within-scanner measurements are remarkably reliable across scan sessions, being minimally affected by averaging of multiple acquisitions, B1 correction, acquisition sequence (MPRAGE vs. multi-echo-FLASH), major scanner upgrades (Sonata-Avanto, Trio-TrioTIM), and segmentation atlas (MPRAGE or multi-echo-FLASH). Volume measurements across platforms (Siemens Sonata vs. GE Signa) and field strengths (1.5 T vs. 3 T) result in a volume difference bias but with a comparable variance as that measured within-scanner, implying that multi-site studies may not necessarily require a much larger sample to detect a specific effect. These results suggest that volumes derived from automated segmentation of T1-weighted structural images are reliable measures within the same scanner platform, even after upgrades; however, combining data across platform and across field-strength introduces a bias that should be considered in the design of multi-site studies, such as clinical drug trials. The results derived from the young groups (scanner upgrade effects and B1 inhomogeneity correction effects) should be considered as preliminary and in

  11. Data of evolutionary structure change: 1AP4A-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AP4A-1CLMA 1AP4 1CLM A A ---------------------------------------...DDS LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDR...36 1CLM A 1CLMA

  12. Aluminum Manganese Molten Salt Plating

    Science.gov (United States)

    2006-06-01

    Dry fixture thoroughly with the air gun. Be especially careful to dry water out of crevices. Note: water is a contaminant to the plating process...easily destroyed if blown with the air. Be especially careful to dry water out of crevices. Note: water is a contaminant to the plating process and...especially careful to dry water out of crevices. 13. Carefully remove part from fixture. If residual plating solution is present at attachments points

  13. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  14. Glass-bead peen plating

    Science.gov (United States)

    Graves, J. R.

    1974-01-01

    Peen plating of aluminum, copper, and nickel powders was investigated. Only aluminum was plated successfully within the range of peen plating conditions studied. Optimum plating conditions for aluminum were found to be: (1) bead/powder mixture containing 25 to 35% powder by weight, (2) peening intensity of 0.007A as measured by Almen strip, and (3) glass impact bead diameter of at least 297 microns (0.0117 inches) for depositing-100 mesh aluminum powder. No extensive cleaning or substrate preparation is required beyond removing loose dirt or heavy oil.

  15. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome.

    Science.gov (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin

    2015-02-01

    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  16. Intermittent plate tectonics?

    Science.gov (United States)

    Silver, Paul G; Behn, Mark D

    2008-01-04

    Although it is commonly assumed that subduction has operated continuously on Earth without interruption, subduction zones are routinely terminated by ocean closure and supercontinent assembly. Under certain circumstances, this could lead to a dramatic loss of subduction, globally. Closure of a Pacific-type basin, for example, would eliminate most subduction, unless this loss were compensated for by comparable subduction initiation elsewhere. Given the evidence for Pacific-type closure in Earth's past, the absence of a direct mechanism for termination/initiation compensation, and recent data supporting a minimum in subduction flux in the Mesoproterozoic, we hypothesize that dramatic reductions or temporary cessations of subduction have occurred in Earth's history. Such deviations in the continuity of plate tectonics have important consequences for Earth's thermal and continental evolution.

  17. VISAS AND GREEN PLATES

    CERN Multimedia

    2000-01-01

    From 3 April 2000, all questions relating to visa requests for Switzerland, France, or Russia for a member of the personnel must be addressed to Ms. Agnita Querrou (telephone 72838, office 5-2-019, e-mail Agnita.Querrou@cern.ch).The Users' Office continues to deal with requests for letters of invitation and questions concerning visas for users in EP Division.Questions relating to removals, requests for green plates, to privileges of members of the personnel and to the importation of vehicles are still dealt with by Ms Zuzana Miller (telephone 79257, office 33-1-017, e-mail Zuzana.Muller@cern.ch) and Ms Joëlle Belleman (telephone 73962, office 33-1-019, e-mail Joelle.Belleman@cern.ch).

  18. Comparison of working efficiency of terrestrial laser scanner in day and night conditions

    Science.gov (United States)

    Arslan, A. E.; Kalkan, K.

    2013-10-01

    Terrestrial Laser Scanning is a popular and widely used technique to scan existing objects, document historical sites and items, and remodel them if and when needed. Their ability to collect thousands of point data per second makes them an invaluable tool in many areas from engineering to historical reconstruction. There are many scanners in the market with different technical specifications. One main technical specification of laser scanners is range and illumination. In this study, it is tested to be determined the optimal working times of a laser scanner and the scanners consistency with its specifications sheet. In order to conduct this work, series of GNSS measurements in Istanbul Technical University have been carried out, connected to the national reference network, to determine precise positions of target points and the scanner, which makes possible to define a precise distance between the scanner and targets. Those ground surveys has been used for calibration and registration purposes. Two different scan campaigns conducted at 12 am and 11 pm to compare working efficiency of laser scanner in different illumination conditions and targets are measured with a handheld spectro-radiometer in order to determine their reflective characteristics. The obtained results are compared and their accuracies have been analysed.

  19. Plate osteosynthesis of simple forearm fractures : LCP versus DC plates

    NARCIS (Netherlands)

    Stevens, Charles Tjerk; Ten Duis, Henk Jan

    2008-01-01

    The aim of this study was to compare the time to radiological bony union of simple A-type fractures of the forearm, treated with either a locking compression plate (LCP) or a dynamic compression plate (DCP). For each fracture, the relation between the use of compression and radiological healing time

  20. Plate osteosynthesis of simple forearm fractures : LCP versus DC plates

    NARCIS (Netherlands)

    Stevens, Charles Tjerk; Ten Duis, Henk Jan

    The aim of this study was to compare the time to radiological bony union of simple A-type fractures of the forearm, treated with either a locking compression plate (LCP) or a dynamic compression plate (DCP). For each fracture, the relation between the use of compression and radiological healing time

  1. Biomechanical Study of the Fixation Strength of Anteromedial Plating for Humeral Shaft Fractures

    Institute of Scientific and Technical Information of China (English)

    Yin-Feng Zheng; Jun-Lin Zhou; Xiao-Hong Wang; Lei Shan; Yang Liu

    2016-01-01

    Background:Open reduction and internal fixation with plate and screws are the gold standard for the surgical treatment of humeral shaft fractures,this study was to compare the mechanical properties of anteromedial,anterolateral,and posterior plating for humeral shaft fractures.Methods:A distal third humeral shaft fracture model was constructed using fourth-generation sawbones (#3404,composite bone).Atotal of 24 sawbones with a distal third humeral shaft fracture was randomly divided into three Groups:A,B,and C (n =8 in each group) for anteromedial,anterolateral,and posterior plating,respectively.All sawbones were subjected to horizontal torsional fatigue tests,horizontal torsional and axial compressive fatigue tests,four-point bending fatigue tests in anteroposterior (AP) and mediolateral (ML) directions and horizontal torsional destructive tests.Results:In the horizontal torsional fatigue tests,the mean torsional angle amplitude in Groups A,B,and C were 6.12°,6.53°,and 6.81°.In horizontal torsional and axial compressive fatigue tests,the mean torsional angle amplitude in Groups A,B,and C were 5.66°,5.67°,and 6.36°.The mean plate displacement amplitude was 0.05 mm,0.08 mm,and 0.10 mm.Group A was smaller than Group C (P < 0.05).In AP four-point bending fatigue tests,the mean plate displacement amplitude was 0.16 mm,0.13 mm,and 0.20 mm.Group B was smaller than Group C (P < 0.05).In ML four-point bending fatigue tests,the mean plate displacement amplitude were 0.16 mm,0.19 mm,and 0.17 mm.In horizontal torsional destructive tests,the mean torsional rigidity in Groups A,B,and C was 0.82,0.75,and 0.76 N.m/deg.The yielding torsional angle was 24.50°,25.70°,and 23.86°.The mean yielding torque was 18.46,18.05,and 16.83 N·m,respectively.Conclusions:Anteromedial plating was superior to anterolateral or posterior plating in all mechanical tests except in AP four-point bending fatigue tests compared to the anterolateral plating group.We can suggest that

  2. Accuracy evaluation of a lower-cost and four higher-cost laser scanners.

    Science.gov (United States)

    Campanelli, Valentina; Howell, Stephen M; Hull, Maury L

    2016-01-04

    Knowing the accuracy of laser scanners is imperative to select the best scanner to generate bone models. However, errors stated by manufacturers may not apply to bones. The three objectives of this study were to determine: 1) whether the overall error stated by the manufacturers of five laser scanners was different from the root mean squared error (RMSE) computed by scanning a gage block; 2) the repeatability of 3D models generated by the laser scanners when scanning a complex freeform surface such as a distal femur and whether this differed from the repeatability when scanning a gage block; 3) whether the errors for one lower-cost laser scanner are comparable to those of four higher-cost laser scanners. The RMSEs in scanning the gage block were 2 to 52µm lower than the overall errors stated by the manufacturers. The repeatability in scanning the bovine femur 10 times was significantly worse than that in scanning the gage block 10 times. The precision of the lower-cost laser scanner was comparable to that of the higher-cost laser scanners, but the bias was an order of magnitude greater. The contributions of this study are that 1) the overall errors stated by the manufacturers are an upper bound when simple geometric objects like a gage block are scanned, 2) the repeatability is worse on average three times when scanning a complex freeform surface compared to scanning the gage block, and 3) the main difference between the lower-cost and the higher-cost laser scanners is the bias.

  3. Revised benchmarking of contact-less fingerprint scanners for forensic fingerprint detection: challenges and results for chromatic white light scanners (CWL)

    Science.gov (United States)

    Kiltz, Stefan; Leich, Marcus; Dittmann, Jana; Vielhauer, Claus; Ulrich, Michael

    2011-02-01

    Mobile contact-less fingerprint scanners can be very important tools for the forensic investigation of crime scenes. To be admissible in court, data and the collection process must adhere to rules w.r.t. technology and procedures of acquisition, processing and the conclusions drawn from that evidence. Currently, no overall accepted benchmarking methodology is used to support some of the rules regarding the localisation, acquisition and pre-processing using contact-less fingerprint scanners. Benchmarking is seen essential to rate those devices according to their usefulness for investigating crime scenes. Our main contribution is a revised version of our extensible framework for methodological benchmarking of contact-less fingerprint scanners using a collection of extensible categories and items. The suggested main categories describing a contact-less fingerprint scanner are properties of forensic country-specific legal requirements, technical properties, application-related aspects, input sensory technology, pre-processing algorithm, tested object and materials. Using those it is possible to benchmark fingerprint scanners and describe the setup and the resulting data. Additionally, benchmarking profiles for different usage scenarios are defined. First results for all suggested benchmarking properties, which will be presented in detail in the final paper, were gained using an industrial device (FRT MicroProf200) and conducting 18 tests on 10 different materials.

  4. Plate tectonics, damage and inheritance.

    Science.gov (United States)

    Bercovici, David; Ricard, Yanick

    2014-04-24

    The initiation of plate tectonics on Earth is a critical event in our planet's history. The time lag between the first proto-subduction (about 4 billion years ago) and global tectonics (approximately 3 billion years ago) suggests that plates and plate boundaries became widespread over a period of 1 billion years. The reason for this time lag is unknown but fundamental to understanding the origin of plate tectonics. Here we suggest that when sufficient lithospheric damage (which promotes shear localization and long-lived weak zones) combines with transient mantle flow and migrating proto-subduction, it leads to the accumulation of weak plate boundaries and eventually to fully formed tectonic plates driven by subduction alone. We simulate this process using a grain evolution and damage mechanism with a composite rheology (which is compatible with field and laboratory observations of polycrystalline rocks), coupled to an idealized model of pressure-driven lithospheric flow in which a low-pressure zone is equivalent to the suction of convective downwellings. In the simplest case, for Earth-like conditions, a few successive rotations of the driving pressure field yield relic damaged weak zones that are inherited by the lithospheric flow to form a nearly perfect plate, with passive spreading and strike-slip margins that persist and localize further, even though flow is driven only by subduction. But for hotter surface conditions, such as those on Venus, accumulation and inheritance of damage is negligible; hence only subduction zones survive and plate tectonics does not spread, which corresponds to observations. After plates have developed, continued changes in driving forces, combined with inherited damage and weak zones, promote increased tectonic complexity, such as oblique subduction, strike-slip boundaries that are subparallel to plate motion, and spalling of minor plates.

  5. Scanner color management model based on improved back-propagation neural network

    Institute of Scientific and Technical Information of China (English)

    Xinwu Li

    2008-01-01

    Scanner color management is one of the key techniques for color reproduction in information optics.A new scanner color management model is presented based on analyzing rendering principle of scanning objects.In this model,a standard color target is taken as experimental sample.Color blocks in color shade area are used to substitute complete color space to solve the difficulties in selecting experimental color blocks.Immune genetic algorithm is used to correct back-propagation neural network(BPNN)to speed up the convergence of the model.Experimental results show that the model can improve the accuracy of scanner color management.

  6. Mechanical optimisation of a high-precision fast wire scanner at CERN

    CERN Document Server

    Samuelsson, Sebastian; Veness, Raymond

    Wire scanners are instruments used to measure the transverse beam prole in particle accelerators by passing a thin wire through the particle beam. To avoid the issues of vacuum leakage through the bellows and wire failure related to current designs of wire scanners, a new concept for a wire scanner has been developed at CERN. This design has all moving parts inside the beam vacuum and has a nominal wire scanning speed of 20 m/s. The demands on the design associated with this together with the high precision requirements create a need for\

  7. 3D handheld laser scanner based approach for automatic identification and localization of EEG sensors.

    Science.gov (United States)

    Koessler, Laurent; Cecchin, Thierry; Ternisien, Eric; Maillard, Louis

    2010-01-01

    This paper describes and assesses for the first time the use of a handheld 3D laser scanner for scalp EEG sensor localization and co-registration with magnetic resonance images. Study on five subjects showed that the scanner had an equivalent accuracy, a better repeatability, and was faster than the reference electromagnetic digitizer. According to electrical source imaging, somatosensory evoked potentials experiments validated its ability to give precise sensor localization. With our automatic labeling method, the data provided by the scanner could be directly introduced in the source localization studies.

  8. High Resolution Aircraft Scanner Mapping of Geothermal and Volcanic Areas

    Energy Technology Data Exchange (ETDEWEB)

    Mongillo, M.A.; Cochrane, G.R.; Wood, C.P.; Shibata, Y.

    1995-01-01

    High spectral resolution GEOSCAN Mkll multispectral aircraft scanner imagery has been acquired, at 3-6 m spatial resolutions, over much of the Taupo Volcanic Zone as part of continuing investigations aimed at developing remote sensing techniques for exploring and mapping geothermal and volcanic areas. This study examined the 24-band: visible, near-IR (NIR), mid-IR (MIR) and thermal-IR (TIR) imagery acquired over Waiotapu geothermal area (3 m spatial resolution) and White Island volcano (6 m resolution). Results show that color composite images composed of visible and NIR wavelengths that correspond to color infrared (CIR) photographic wavelengths can be useful for distinguishing among bare ground, water and vegetation features and, in certain cases, for mapping various vegetation types. However, combinations which include an MIR band ({approx} 2.2 {micro}m) with either visible and NIR bands, or two NIR bands, are the most powerful for mapping vegetation types, water bodies, and bare and hydrothermally altered ground. Combinations incorporating a daytime TIR band with NIR and MIR bands are also valuable for locating anomalously hot features and distinguishing among different types of surface hydrothermal alteration.

  9. The Surface Wave Scattering-Microwave Scanner (SWS-MS)

    Science.gov (United States)

    Geffrin, Jean-Michel; Chamtouri, Maha; Merchiers, Olivier; Tortel, Hervé; Litman, Amélie; Bailly, Jean-Sébastien; Lacroix, Bernard; Francoeur, Mathieu; Vaillon, Rodolphe

    2016-01-01

    The Surface Wave Scattering-Microwave Scanner (SWS-MS) is a device that allows the measurement of the electromagnetic fields scattered by objects totally or partially submerged in surface waves. No probe is used to illuminate the sample, nor to guide or scatter the local evanescent waves. Surface waves are generated by total internal reflection and the amplitude and phase of the fields scattered by the samples are measured directly, both in the far-field and the near-field regions. The device's principles and their practical implementation are described in details. The surface wave generator is assessed by measuring the spatial distribution of the electric field above the surface. Drift correction and the calibration method for far-field measurements are explained. Comparison of both far-field and near-field measurements against simulation data shows that the device provides accurate results. This work suggests that the SWS-MS can be used for producing experimental reference data, for supporting a better understanding of surface wave scattering, for assisting in the design of near-field optical or infrared systems thanks to the scale invariance rule in electrodynamics, and for performing nondestructive control of defects in materials.

  10. Vacuum Actuator and Controller Design for a Fast Wire Scanner

    CERN Document Server

    Dehning, B; Herranz Alvarez, J; Koujili, M; Sirvent Blasco, J L

    2012-01-01

    To cope with increasing requirements in terms of accuracy and beam intensity limits a beam wire scanner (BWS) design is under development for the CERN accelerators complex. The main parameters have been determined; the wire speed should be 20 m·s -1 when interacting with the beam and a beam width determination accuracy of 2µm under the harsh radioactive environment should be reached. To meet this goal, the proposed solution locates all moveable parts of the actuator and the angular sensors in the beam vacuum pipe in order to reduce the friction and to allow a direct position measurement. One absolute positioning sensor will be used for the brushless motor feedback and one custom, high precision incremental design will target the beam size determination. The laboratory tests set up for the actuator and the incremental sensor will be presented along with the motor control feedback loops developed with the DSpace environment using Simulink and MatLab tools. Finally, the development of the digital...

  11. Fast Automatic Precision Tree Models from Terrestrial Laser Scanner Data

    Directory of Open Access Journals (Sweden)

    Mathias Disney

    2013-01-01

    Full Text Available This paper presents a new method for constructing quickly and automatically precision tree models from point clouds of the trunk and branches obtained by terrestrial laser scanning. The input of the method is a point cloud of a single tree scanned from multiple positions. The surface of the visible parts of the tree is robustly reconstructed by making a flexible cylinder model of the tree. The thorough quantitative model records also the topological branching structure. In this paper, every major step of the whole model reconstruction process, from the input to the finished model, is presented in detail. The model is constructed by a local approach in which the point cloud is covered with small sets corresponding to connected surface patches in the tree surface. The neighbor-relations and geometrical properties of these cover sets are used to reconstruct the details of the tree and, step by step, the whole tree. The point cloud and the sets are segmented into branches, after which the branches are modeled as collections of cylinders. From the model, the branching structure and size properties, such as volume and branch size distributions, for the whole tree or some of its parts, can be approximated. The approach is validated using both measured and modeled terrestrial laser scanner data from real trees and detailed 3D models. The results show that the method allows an easy extraction of various tree attributes from terrestrial or mobile laser scanning point clouds.

  12. Evaluation of a laser scanner for surface topography.

    Science.gov (United States)

    Hill, D L; Berg, D C; Raso, V J; Lou, E; Durdle, N G; Mahood, J K; Moreau, M J

    2002-01-01

    A Minolta VIVID 700 portable non-contact 3D laser scanner was evaluated on 15 subjects with idiopathic scoliosis. The 3D map was compared to two structured light pattern (lines and dots) techniques to determine the reliability, ease of use, speed, and quality. The parameters used for the clinical assessment of scoliosis were measured twice for the Minolta and light projection systems. The edges of the image and areas where occlusion typically occur were examined. The absolute distance in calculated depth between adjacent points was examined to determine errors. The Minolta system and the dot pattern produced regular grids of points. The light projection pattern produced an irregular grid, with more resolution along the video line and less resolution between projected lines, resulted in a somewhat jagged appearance of the surface map. The Minolta system was less sensitive to edge effects, occlusion, and sharp transitions of depth. The comparison of clinical parameters showed good results between repetitions but moderate results between techniques.

  13. 2D MEMS scanner integrating a position feedback

    Directory of Open Access Journals (Sweden)

    Lani Sebastien

    2015-01-01

    Full Text Available An integrated position sensor for a dual-axis electromagnetic tilting mirror is presented. This tilting mirror is composed of a silicon based mirror directly assembled on a silicon membrane supported by flexible beams. The position sensors are constituted by 4 Wheatstone bridges of piezoresistors which are fabricated by doping locally the flexible beams. A permanent magnet is attached to the membrane and the scanner is mounted above planar coils deposited on a ceramic substrate to achieve electromagnetic actuation. The performances of the piezoresistive sensors are evaluated by measuring the output signal of the piezoresistors as a function of the tilt of the mirror and the temperature. White light interferometry was performed for all measurement to measure the exact tilt angle. The minimum detectable angle with such sensors was 30μrad (around 13bits in the range of the minimum resolution of the interferometer. The tilt reproducibility was 0.0186%, obtained by measuring the tilt after repeated actuations with a coil current of 50mA during 30 min and the stability over time was 0.05% in 1h without actuation. The maximum measured tilt angle was 6° (mechanical limited by nonlinearity of the MEMS system.

  14. a Light-Weight Laser Scanner for Uav Applications

    Science.gov (United States)

    Tommaselli, A. M. G.; Torres, F. M.

    2016-06-01

    Unmanned Aerial Vehicles (UAV) have been recognized as a tool for geospatial data acquisition due to their flexibility and favourable cost benefit ratio. The practical use of laser scanning devices on-board UAVs is also developing with new experimental and commercial systems. This paper describes a light-weight laser scanning system composed of an IbeoLux scanner, an Inertial Navigation System Span-IGM-S1, from Novatel, a Raspberry PI portable computer, which records data from both systems and an octopter UAV. The performance of this light-weight system was assessed both for accuracy and with respect to point density, using Ground Control Points (GCP) as reference. Two flights were performed with the UAV octopter carrying the equipment. In the first trial, the flight height was 100 m with six strips over a parking area. The second trial was carried out over an urban park with some buildings and artificial targets serving as reference Ground Control Points. In this experiment a flight height of 70 m was chosen to improve target response. Accuracy was assessed based on control points the coordinates of which were measured in the field. Results showed that vertical accuracy with this prototype is around 30 cm, which is acceptable for forest applications but this accuracy can be improved using further refinements in direct georeferencing and in the system calibration.

  15. A LIGHT-WEIGHT LASER SCANNER FOR UAV APPLICATIONS

    Directory of Open Access Journals (Sweden)

    A. M. G. Tommaselli

    2016-06-01

    Full Text Available Unmanned Aerial Vehicles (UAV have been recognized as a tool for geospatial data acquisition due to their flexibility and favourable cost benefit ratio. The practical use of laser scanning devices on-board UAVs is also developing with new experimental and commercial systems. This paper describes a light-weight laser scanning system composed of an IbeoLux scanner, an Inertial Navigation System Span-IGM-S1, from Novatel, a Raspberry PI portable computer, which records data from both systems and an octopter UAV. The performance of this light-weight system was assessed both for accuracy and with respect to point density, using Ground Control Points (GCP as reference. Two flights were performed with the UAV octopter carrying the equipment. In the first trial, the flight height was 100 m with six strips over a parking area. The second trial was carried out over an urban park with some buildings and artificial targets serving as reference Ground Control Points. In this experiment a flight height of 70 m was chosen to improve target response. Accuracy was assessed based on control points the coordinates of which were measured in the field. Results showed that vertical accuracy with this prototype is around 30 cm, which is acceptable for forest applications but this accuracy can be improved using further refinements in direct georeferencing and in the system calibration.

  16. Modified robust sliding-mode control method for wafer scanner

    Directory of Open Access Journals (Sweden)

    Yiguang Wang

    2015-03-01

    Full Text Available This article studies the precision motion control of a long-stroke reticle stage driven by the permanent magnet linear motor in wafer scanner. A robust sliding-mode control method is proposed for tracking the reference trajectory in the presence of un-modeled dynamics, parametric uncertainty and external disturbances including force ripple, cogging and friction in the controlled system. A modified sliding-mode term based on the variable structure technique for eliminating the tracking error is employed in the proposed control law. The system stability and tracking convergence of the closed-loop control system are guaranteed by Lyapunov theory theoretically. The feasibility and effectiveness of the proposed method are demonstrated by comparative experiments on a linear motion testbed. The experimental results show that better tracking performance can be achieved by the proposed method compared with the conventional proportional–integral–derivative method and it can be considered as a possible alternative in the precision motion control system.

  17. Physical performance evaluation of a 256-slice CT-scanner for four-dimensional imaging.

    Science.gov (United States)

    Mori, Shinichiro; Endo, Masahiro; Tsunoo, Takanori; Kandatsu, Susumu; Tanada, Shuji; Aradate, Hiroshi; Saito, Yasuo; Miyazaki, Hiroaki; Satoh, Kazumasa; Matsushita, Satoshi; Kusakabe, Masahiro

    2004-06-01

    We have developed a prototype 256-slice CT-scanner for four-dimensional (4D) imaging that employs continuous rotations of a cone-beam. Since a cone-beam scan along a circular orbit does not collect a complete set of data to make an exact reconstruction of a volume [three-dimensional (3D) image], it might cause disadvantages or artifacts. To examine effects of the cone-beam data collection on image quality, we have evaluated physical performance of the prototype 256-slice CT-scanner with 0.5 mm slices and compared it to that of a 16-slice CT-scanner with 0.75 mm slices. As a result, we found that image noise, uniformity, and high contrast detectability were independent of z coordinate. A Feldkamp artifact was observed in distortion measurements. Full width at half maximum (FWHM) of slice sensitivity profiles (SSP) increased with z coordinate though it seemed to be caused by other reasons than incompleteness of data. With regard to low contrast detectability, smaller objects were detected more clearly at the midplane (z = 0 mm) than at z = 40 mm, though circular-band like artifacts affected detection. The comparison between the 16-slice and the 256-slice scanners showed better performance for the 16-slice scanner regarding the SSP, low contrast detectability, and distortion. The inferiorities of the 256-slice scanner in other than distortion measurement (Feldkamp artifact) seemed to be partly caused by the prototype nature of the scanner and should be improved in the future scanner. The image noise, uniformity, and high contrast detectability were almost identical for both CTs. The 256-slice scanner was superior to the 16-slice scanner regarding the PSF, though it was caused by the smaller transverse beam width of the 256-slice scanner. In order to compare both scanners comprehensively in terms of exposure dose, noise, slice thickness, and transverse spatial resolution, K=Dsigma2ha3 was calculated, where D was exposure dose (CT dose index), sigma was magnitude of

  18. Casimir Effect for Dielectric Plates

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    We generalize Kupisewska method to the three-dimensional system and another derivation of the Casimir effect between two dielectric plates is presented based on the explicit quantization of the electromagnetic field in the presence of dielectrics, where the physical meaning of "evanescent mode" is discussed. The Lifshitz's formula is rederived perfect metallic plates will the evanescent modes become unimportant.

  19. Micro-channel plate detector

    Science.gov (United States)

    Elam, Jeffrey W.; Lee, Seon W.; Wang, Hsien -Hau; Pellin, Michael J.; Byrum, Karen; Frisch, Henry J.

    2015-09-22

    A method and system for providing a micro-channel plate detector. An anodized aluminum oxide membrane is provided and includes a plurality of nanopores which have an Al coating and a thin layer of an emissive oxide material responsive to incident radiation, thereby providing a plurality of radiation sensitive channels for the micro-channel plate detector.

  20. Gold plating on spectacle frames.

    Science.gov (United States)

    Kenny, I; Mitchell, J W; Walsh, G

    1997-05-01

    An investigation was carried out into the thickness and standard of application of the plating and lacquer coatings applied to three metal spectacle frames. All conform to BS 6625 (1991) for plating thickness, but there was considerable variation in regularity and porosity.

  1. Plate shell structures of glass

    DEFF Research Database (Denmark)

    Bagger, Anne

    . This modelling technique is used to model a plate shell structure with a span of 11.5 meters in the FE software \\textsc{Abaqus}. The structure is analyzed with six different connection details with varying stiffness characteristics, to investigate the influence of these characteristics on the structural effects...... University, a script has been developed for an automated generation of a given plate shell geometry and a corresponding finite element (FE) model. A suitable FE modelling technique is proposed, suggesting a relatively simple method of modelling the connection detail's stiffness characteristics....... Based on these investigations, and FE analysis of other plate shell models, the structural behaviour is described. Possible methods of estimating the stresses in a given plate shell structure are proposed. The non-linear behaviour of a plate shell structure is investigated for varying parameters...

  2. The moving plate capacitor paradox

    Science.gov (United States)

    Davis, B. R.; Abbott, D.; Parrondo, J. M. R.

    2000-03-01

    For the first time we describe an apparent paradox concerning a moving plate capacitor driven by thermal noise from a resistor. A demon restores the plates of the capacitor to their original position, only when the voltage across the capacitor is small—hence only small forces are present for the demon to work against. The demon has to work harder than this to avoid the situation of perpetual motion, but the question is how? We explore the concept of a moving plate capacitor, driven by noise, a step further by examining the case where the restoring force on the capacitor plates is provided by a simple spring, rather than some unknown demon. We display simulation results with interesting behavior, particularly where the capacitor plates collide with each other.

  3. SAMI Automated Plug Plate Configuration

    CERN Document Server

    Lorente, Nuria P F; Goodwin, Michael

    2012-01-01

    The Sydney-AAO Multi-object Integral field spectrograph (SAMI) is a prototype wide-field system at the Anglo-Australian Telescope (AAT) which uses a plug-plate to mount its 13 x 61-core imaging fibre bundles (hexabundles) in the optical path at the telescope's prime focus. In this paper we describe the process of determining the positions of the plug-plate holes, where plates contain three or more stacked observation configurations. The process, which up until now has involved several separate processes and has required significant manual configuration and checking, is now being automated to increase efficiency and reduce error. This is carried out by means of a thin Java controller layer which drives the configuration cycle. This layer controls the user interface and the C++ algorithm layer where the plate configuration and optimisation is carried out. Additionally, through the Aladin display package, it provides visualisation and facilitates user verification of the resulting plates.

  4. Calibration of Strömgren-Crawford photometry for Ap-stars compared to Hipparcos results

    Science.gov (United States)

    Vogt, Nikolaus; Paunzen, Ernst; Maitzen, Hans M.

    25 years ago Bidelman and MacConnell (1973) published a list of nearly 800 Ap-stars which they had identified on objective prism plates collected at the Cerro Tololo Interamerican Observatory as kind of a precursor work for the huge Michigan project of two-dimensional spectral classification. This list has been used as basis for 3 different photometric projects carried out at ESO-La Silla with limiting magnitude V = 8.5: 1. uvby photometry by Vogt and Faúndez (1979); 2. δa photometry by Maitzen and Vogt (1983) in the system of Maitzen (1976) demonstrating the very high agreement of photometric Ap-detections with the spectroscopic results of Bidelman and MacConnell; 3. Hβ photometry of 226 objects which were observed at the Danish 50cm telescope on La Silla in 1982. The latter work was intended not only to formally complete Strögren-Crawford data for a significantly large set of chemically peculiar stars (excluding Am and HgMn objects) but also to yield their galactic locations. Reddening corrections mattered only for the hot peculiars. Absolute magnitudes were derived according to the calibrations worked out by Crawford two decades ago for normal main sequence AB stars. The Hipparcos catalogue which appeared in 1997 offers an independent way to check whether these calibrations derived for normal stars do apply also for chemically peculiar stars. Fortunately, we identified Hipparcos parallaxes for two thirds of our sample. We divided our objects according to 3 calibration groups: early (= B type stars), intermediate (A0-A2 type stars), late (other A type stars). First of all we consider normal stars with published β-values in order to compare their photometric absolute magnitudes to those based on the Hipparcos catalogue. The degree of correlation between both quantities is not excellent for the normal B-type stars, but no systematic trend is visible. For the stars around the Balmer maximum (intermediate group) we also do not recognize a significant systematic

  5. Thin plate neotectonic models of the Australian plate

    Science.gov (United States)

    Burbidge, D. R.

    2004-10-01

    Thin plate finite element models of the neotectonic deformation of the Australian plate have been calculated in order to estimate the stress and strain rate within the plate, specifically concentrating on the Australian continent. The model includes plate-bounding faults, an anelastic brittle-ductile layered rheology and the option of laterally varying elevation and heat flow. The results of the models are compared to (1) the velocity of geodetic benchmarks on the Australian plate, (2) the spreading rate of the mid-oceanic ridges along the Australian plate's margins, (3) the direction of the maximum horizontal principal stress, (4) the stress regime within the plate, and (5) the crustal thickness estimated from the depth to the base of Mohorovicic discontinuity's transition zone. A variety of models are tested with a wide range of input parameters. The model with the smallest misfit with observations predicts that the strain rate for most of the Australian continent is approximately 10-17 s-1. This model has a slightly lower strain rate in the central Australia and is higher off the northern coast of Australia than for the rest of the continent. Strain rates of this magnitude would be difficult to observe from geodetic or geologic data for most parts of Australia but would be enough to generate much of the seismicity that has been observed over the last century.

  6. Underwater electrical discharge in plate to plate configuration

    Science.gov (United States)

    Stelmashuk, Vitaliy

    2016-09-01

    Two main configurations of high voltage electrodes submersed in water have been used for an electrical discharge generation: pin to pin and pin to plate. An electrical breakdown between plate electrodes is generally difficult to reproduce, because there is a uniform and weak electric field. One major advantage of using plate electrodes is their greater ``wear hardness'' to high-energy discharges. The plate electrodes can withstand extremely high energy deposition at which the pin electrode is quickly destroyed. The electrical discharge between plate electrodes can be initiated by creating an inhomogeneity in the electrical field. Two methods of discharge initiation between plate electrodes are proposed for this aim: 1) focusing of a shock wave in the interelectrode region; 2) a bubble injection into the electrode gap. The shock wave creates favourable conditions for the electrical breakdown between the two plate electrodes: it causes that numerous microbubbles of dissolved air start to grow and serve as locations for streamer initiation. In the second method the gas bubble is injected from the one of the electrodes, which has a gas inlet hole on the lateral face for this purpose. A ``volcano'' like morphology of positive streamers are observed in the experiments with weak electric field. The authors are grateful to MEYS grant INGO LG 15013.

  7. APS-U LATTICE DESIGN FOR OFF-AXIS ACCUMULATION

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yipeng; Borland, M.; Lindberg, R.; Sajaev, V.

    2017-06-25

    A 67-pm hybrid-seven-bend achromat (H7BA) lattice is being proposed for a future Advanced Photon Source (APS) multi-bend-achromat (MBA) upgrade project. This lattice design pushes for smaller emittance and requires use of a swap-out (on-axis) injection scheme due to limited dynamic acceptance. Alternate lattice design work has also been performed for the APS upgrade to achieve better beam dynamics performance than the nominal APS MBA lattice, in order to allow off-axis accumulation. Two such alternate H7BA lattice designs, which target a still-low emittance of 90 pm, are discussed in detail in this paper. Although the single-particle-dynamics performance is good, simulations of collective effects indicate that surprising difficulty would be expected accumulating high single-bunch charge in this lattice. The brightness of the 90-pm lattice is also a factor of two lower than the 67-pm H7BA lattice.

  8. Westinghouse plans global new builds for AP1000

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Lubomir [NucNet, Brussels (Belgium)

    2014-10-15

    Interview with Danny Roderick, Westinghouse Electric Company, President and Chief Executive Officer since September 2012, about perspectives and future plans for AP1000 new build worldwide. Within three to four years there wille be 'shovels in the ground' for three new AP1000 reactors in the UK, as well as new units in China and Bulgaria. Four AP1000 reactors are under construction in the United States at Vogtle and VC Summer, and soon at Turkey Point. Additionally Danny Roderick spoke about the acquisition of NuGen, technology transfer, the influence of the Ukraine crises on the nuclear market in East Europe and the future need for more nuclear worldwide and in the UK and Bulgaria.

  9. Prevention of aspiration pneumonia (AP) with oral care.

    Science.gov (United States)

    Tada, Akio; Miura, Hiroko

    2012-01-01

    AP is a major cause of morbidity and mortality in elderly patients, especially frail elderly patients. The aim of this article is to review effect of oral care, including oral hygiene and improvement of oral function, on the prevention of AP among elderly people in hospitals and nursing homes. There is now a substantial body of work studying the effect of oral care on the prevention of respiratory diseases. Oral hygiene, consisting of oral decontamination and mechanical cleaning by dental professionals, has resulted in significant clinical effects (decreased incidence of pneumonia and decreased mortality from respiratory diseases) in clinical randomized trials. Moreover, studies examining oral colonization by pneumonia pathogens have shown the effect of oral hygiene on eliminating these pathogens. In addition, swallowing training has been shown to improve the movement and function of swallowing-related muscles, also resulting in decreased incidence of pneumonia. These findings support the contention that oral care is effective in the prevention of AP.

  10. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts

    Science.gov (United States)

    Magrogan, Serena

    2014-01-01

    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  11. Highly curved microchannel plates

    Science.gov (United States)

    Siegmund, O. H. W.; Cully, S.; Warren, J.; Gaines, G. A.; Priedhorsky, W.; Bloch, J.

    1990-01-01

    Several spherically curved microchannel plate (MCP) stack configurations were studied as part of an ongoing astrophysical detector development program, and as part of the development of the ALEXIS satellite payload. MCP pairs with surface radii of curvature as small as 7 cm, and diameters up to 46 mm have been evaluated. The experiments show that the gain (greater than 1.5 x 10 exp 7) and background characteristics (about 0.5 events/sq cm per sec) of highly curved MCP stacks are in general equivalent to the performance achieved with flat MCP stacks of similar configuration. However, gain variations across the curved MCP's due to variations in the channel length to diameter ratio are observed. The overall pulse height distribution of a highly curved surface MCP stack (greater than 50 percent FWHM) is thus broader than its flat counterpart (less than 30 percent). Preconditioning of curved MCP stacks gives comparable results to flat MCP stacks, but it also decreases the overall gain variations. Flat fields of curved MCP stacks have the same general characteristics as flat MCP stacks.

  12. Surgical treatment of acute acromioclavicular joint dislocations: hook plate versus minimally invasive reconstruction.

    Science.gov (United States)

    Metzlaff, S; Rosslenbroich, S; Forkel, P H; Schliemann, B; Arshad, H; Raschke, M; Petersen, W

    2016-06-01

    This study was performed to compare the clinical results of a minimally invasive technique for acute acromioclavicular (AC) joint dislocation repair with the traditional hook plate fixation. Forty-four patients with an acute (within 2 weeks after trauma) complete AC joint separation (35 male, nine female; median age 36.2 years, range 18-56) underwent surgical repair with either a minimally invasive AC joint repair or a conventional hook plate. Functional outcome was evaluated using the Constant-Murley Score (CMS), the TAFT score and the AC joint instability score (ACJI). Radiographic evaluation was performed with bilateral anterior-posterior (a.p.) stress and Alexander views. All patients were available after a median follow-up of 32 months (range 24-51). There were no significant differences in the mean CMS, Taft score and the ACJI between the two groups. The radiological assessment revealed no significant difference in the coracoclavicular distance. In both groups, a slight loss of reduction was observed. Periarticular ossification was seen in 11 patients of the minimally invasive AC joint repair and eight patients of the hook plate group but this did not affect the final outcome. Hook plates were removed after a median interval of 11.9 weeks (range 10-13). Good clinical results can be achieved with both minimally invasive AC joint repair and hook plate fixation. However, in the hook plate group a second operation is mandatory for plate removal. III.

  13. Tromboembolia pulmonar após videoartroscopia de ombro

    OpenAIRE

    Fabio Farina Dal Molin; Siluê Franzoni Dal Molin

    2010-01-01

    Embora fenômenos tromboembólicos sejam complicações frequentes em cirurgias dos membros inferiores, apenas dois relatos de casos de tromboembolia pulmonar após artroscopia de ombro são encontrados na literatura. É descrito o caso de uma paciente com 76 anos com embolia pulmonar bilateral após artroscopia cirúrgica do ombro. Não foram encontradas anormalidades vasculares e nenhuma origem do trombo foi detectada, ficando desconhecida a causa exata responsável pela tromboembolia.Though thromboem...

  14. THE PARALLEL RECURSIVE AP ADAPTIVE ALGORITHM BASED ON VOLTERRA SERIES

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Aiming at the nonlinear system identification problem, a parallel recursive affine projection (AP) adaptive algorithm for the nonlinear system based on Volterra series is presented in this paper. The algorithm identifies in parallel the Volterra kernel of each order, recursively estimate the inverse of the autocorrelation matrix for the Volterra input of each order, and remarkably improve the convergence speed of the identification process compared with the NLMS and conventional AP adaptive algorithm based on Volterra series. Simulation results indicate that the proposed method in this paper is efficient.

  15. First Magnetic Doppler Images of a roAp star

    Science.gov (United States)

    Lüftinger, T.; Kochukhov, O.; Ryabchikova, T.; Weiss, W. W.; Ilyin, I.

    2007-06-01

    We present the first analysis of the magnetic field geometry and elemental abundance distributions on the surface of a rapidly oscillating Ap (roAp) star, using an elaborate magnetic Doppler Imaging (MDI) code (Piskunov et al. 2002, Kochukhov et al. 2002), inv, which allows to reconstruct simultaneously and consistently the magnetic field geometry and abundance distributions on a stellar surface without any a priori assumptions. We analysed Stokes I and V time series obtained with the SOFIN polarimeter and recovered the magnetic field and surface abundance structures of Fe and Nd (among others). These two elements are found to be anticorrelated.

  16. ION EFFECTS IN THE APS PARTICLE ACCUMULATOR RING

    Energy Technology Data Exchange (ETDEWEB)

    Calvey, J.; Harkay, K.; Yao, CY.

    2017-06-25

    Trapped ions in the APS Particle Accumulator Ring (PAR) lead to a positive coherent tune shift in both planes, which increases along the PAR cycle as more ions accumulate. This effect has been studied using an ion simulation code developed at SLAC. After modifying the code to include a realistic vacuum profile, multiple ionization, and the effect of shaking the beam to measure the tune, the simulation agrees well with our measurements. This code has also been used to evaluate the possibility of ion instabilities at the high bunch charge needed for the APS-Upgrade.

  17. Electro-Optic Laser Scanners for Space-Based Lidar Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The purpose of this phase II SBIR is to design and build new non-mechanical, electro-optic (EO) laser scanners that will be suitable for space based laser ranging,...

  18. Scanner Certification Tool for the Standardization of Digitized Documents : Focusing on Target Factors and Measurement Programs

    National Research Council Canada - National Science Library

    Hyung-Ju Park; Dong-Hwan Har

    2010-01-01

    .... Moreover, to produce a scanner certification standard, we overcome existing problems related to the growing market. We anticipate that this new standard will see a high degree of application in the current environment.

  19. Electro-Optic Laser Scanners for Space-Based Lidar Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Vescent Photonics propose to design and build revolutionary non-mechanical, electro-optic (EO) laser scanners that will be suitable for space based laser ranging,...

  20. Symptoms and Cognitive Effects of Exposure to Magnetic Stray Fields of MRI Scanners

    NARCIS (Netherlands)

    Vocht, Frank Gérard de

    2006-01-01

    People working routinely with magnetic resonance imaging (MRI) systems report a number of symptoms related to their presence in the inhomogeneous static magnetic fields (the stray field) surrounding these scanners. Experienced symptoms and neurobehavioral performance among engineers manufacturing

  1. 'What does a scanner see?' Techno-fascination and unreliability in the mind-game film.

    NARCIS (Netherlands)

    Schuster, L.

    2008-01-01

    In popular cinema, paranoia and conspiracy plots often go hand in hand with questions of technological innovation. For example, A Scanner Darkly (Richard Linklater, US 2006) combines issues such as audiovisual surveillance, conspiracy, and manipulation without disambiguating between paranoid delusio

  2. Polarization property analysis of a periscopic scanner with three-dimensional polarization ray-tracing calculus.

    Science.gov (United States)

    Yang, Yufei; Yan, Changxiang

    2016-02-20

    The polarization properties of a two-axis periscopic optical scanner constituted by a pair of rotating planar mirrors have been studied by using the three-dimensional polarization ray-tracing matrix method. The separate and cumulative matrices that define the transformation of the polarization state are obtained and expressed in terms of the rotation angles of two mirrors. The variations of diattenuation and retardance are investigated and graphically shown as functions of the rotation angles. On this basis, a further investigation about the cumulative polarization aberrations of three different metal-coated periscopic scanners is accomplished. Finally, the output polarization states of the three metal-coated scanners are calculated with the input beam of the arbitrary polarization states, and the results show that aluminum film is more appropriate than gold film or silver film for the polarization-maintaining periscopic scanner.

  3. 'What does a scanner see?' Techno-fascination and unreliability in the mind-game film.

    NARCIS (Netherlands)

    Schuster, L.

    2008-01-01

    In popular cinema, paranoia and conspiracy plots often go hand in hand with questions of technological innovation. For example, A Scanner Darkly (Richard Linklater, US 2006) combines issues such as audiovisual surveillance, conspiracy, and manipulation without disambiguating between paranoid

  4. Symptoms and Cognitive Effects of Exposure to Magnetic Stray Fields of MRI Scanners

    NARCIS (Netherlands)

    Vocht, Frank Gérard de

    2006-01-01

    People working routinely with magnetic resonance imaging (MRI) systems report a number of symptoms related to their presence in the inhomogeneous static magnetic fields (the stray field) surrounding these scanners. Experienced symptoms and neurobehavioral performance among engineers manufacturing 0.

  5. 'What does a scanner see?' Techno-fascination and unreliability in the mind-game film.

    NARCIS (Netherlands)

    Schuster, L.

    2008-01-01

    In popular cinema, paranoia and conspiracy plots often go hand in hand with questions of technological innovation. For example, A Scanner Darkly (Richard Linklater, US 2006) combines issues such as audiovisual surveillance, conspiracy, and manipulation without disambiguating between paranoid delusio

  6. The mechatronic design of a fast wire scanner in IHEP U-70 accelerator

    Science.gov (United States)

    Baranov, V. T.; Makhov, S. S.; Savin, D. A.; Terekhov, V. I.

    2016-10-01

    This paper presents the mechatronic design of a fast wire scanner based on a servomotor. The design of the wire scanner is motivated by the need to measure the transverse profile of the high power proton and carbon beams at the IHEP U-70 accelerator. This paper formulates the requirements to the fast wire scanner system for the high intensity proton beam at the U-70 accelerator. The results on the design of electro-mechanical device for the wire scanner with a wire traveling speed 10-20 m/s are presented. The solution consists in a brushless servomotor and standard motor control electronics. High radiation levels in the accelerator enclosure dictate the use of a resolver as the position feedback element.

  7. Scanner external calibration algorithm based on fixed point in robot remanufacturing system

    Institute of Scientific and Technical Information of China (English)

    ZHU Sheng; CUI Pei-zhi; SHEN Chan-duo; GUO Ying-chun

    2005-01-01

    This paper deals with the scanner exterior calibration algorithm when the scanner is arranged by the robot and the object scanned is fixed on a rotate device in the Robot Remanufacturing System. The method of calibrating the relationship between the scanner coordinate and the robot Tool0, such as the rotation, Rx, Ry, R,, and the transformation X, Y, Z is studied. The data of Tool0 can be directly obtained from the relationship with the robot base-coordinate. So, the coordinate relationship between the scanner coordinate and the robot base coordinate can be easily gotten. This paper explains the basic algorithm theory, computing method, data collecting process and the resulted data in detail. The calibration algorithm is deduced under the orthogonal coordinate.

  8. Mobile network architecture of the long-range WindScanner system

    DEFF Research Database (Denmark)

    Vasiljevic, Nikola; Lea, Guillaume; Hansen, Per

    In this report we have presented the network architecture of the long-range WindScanner system that allows utilization of mobile network connections without the use of static public IP addresses. The architecture mitigates the issues of additional fees and contractual obligations that are linked...... to the acquisition of the mobile network connections with static public IP addresses. The architecture consists of a hardware VPN solution based on the network appliances Z1 and MX60 from Cisco Meraki with additional 3G or 4G dongles. With the presented network architecture and appropriate configuration, we fulfill...... the requirements of running the long-range WindScanner system using a mobile network such as 3G. This architecture allows us to have the WindScanners and the master computer in different geographical locations, and in general facilitates deployments of the long-range WindScanner system....

  9. Terrestrial laser scanner data from Hetch Hetchy area, Yosemite National Park, California, USA

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These data are 3D point cloud data collected by laser scanner in the Hetch Hetchy area of Yosemite National Park, USA. The data were collected to assess landscape...

  10. [Determination of loganin in Cornus officinalis Sieb. et Zucc. by TLC scanner].

    Science.gov (United States)

    Li, K M; Yang, X J; Yu, M Q; Xie, C; Xu, L Z

    1994-12-01

    The content of loganin extracted from Cornus of ficinalis was determined directly on a CS-930 TLC scanner. The method is simple and sensitive, and can serve as an index for checking the quality of C. of ficinalis.

  11. Indonesian Landforms and Plate Tectonics

    Directory of Open Access Journals (Sweden)

    Herman Th. Verstappen

    2014-06-01

    Full Text Available DOI: 10.17014/ijog.v5i3.103The horizontal configuration and vertical dimension of the landforms occurring in the tectonically unstable parts of Indonesia were resulted in the first place from plate tectonics. Most of them date from the Quaternary and endogenous forces are ongoing. Three major plates – the northward moving Indo-Australian Plate, the south-eastward moving SE-Asian Plate and the westward moving Pacific Plate - meet at a plate triple-junction situated in the south of New Guinea’s Bird’s Head. The narrow North-Moluccan plate is interposed between the Asia and Pacific. It tapers out northward in the Philippine Mobile Belt and is gradually disappearing. The greatest relief amplitudes occur near the plate boundaries: deep ocean trenches are associated with subduction zones and mountain ranges with collision belts. The landforms of the more stable areas of the plates date back to a more remote past and, where emerged, have a more subdued relief that is in the first place related to the resistance of the rocks to humid tropical weathering Rising mountain ranges and emerging island arcs are subjected to rapid humid-tropical river erosions and mass movements. The erosion products accumulate in adjacent sedimentary basins where their increasing weight causes subsidence by gravity and isostatic compensations. Living and raised coral reefs, volcanoes, and fault scarps are important geomorphic indicators of active plate tectonics. Compartmental faults may strongly affect island arcs stretching perpendicular to the plate movement. This is the case on Java. Transcurrent faults and related pull-apart basins are a leading factor where plates meet at an angle, such as on Sumatra. The most complicated situation exists near the triple-junction and in the Moluccas. Modern research methods, such as GPS measurements of plate movements and absolute dating of volcanic outbursts and raised coral reefs are important tools. The mega-landforms resulting

  12. Indonesian Landforms and Plate Tectonics

    Directory of Open Access Journals (Sweden)

    Herman Th. Verstappen

    2014-06-01

    Full Text Available DOI: 10.17014/ijog.v5i3.103The horizontal configuration and vertical dimension of the landforms occurring in the tectonically unstable parts of Indonesia were resulted in the first place from plate tectonics. Most of them date from the Quaternary and endogenous forces are ongoing. Three major plates – the northward moving Indo-Australian Plate, the south-eastward moving SE-Asian Plate and the westward moving Pacific Plate - meet at a plate triple-junction situated in the south of New Guinea’s Bird’s Head. The narrow North-Moluccan plate is interposed between the Asia and Pacific. It tapers out northward in the Philippine Mobile Belt and is gradually disappearing. The greatest relief amplitudes occur near the plate boundaries: deep ocean trenches are associated with subduction zones and mountain ranges with collision belts. The landforms of the more stable areas of the plates date back to a more remote past and, where emerged, have a more subdued relief that is in the first place related to the resistance of the rocks to humid tropical weathering Rising mountain ranges and emerging island arcs are subjected to rapid humid-tropical river erosions and mass movements. The erosion products accumulate in adjacent sedimentary basins where their increasing weight causes subsidence by gravity and isostatic compensations. Living and raised coral reefs, volcanoes, and fault scarps are important geomorphic indicators of active plate tectonics. Compartmental faults may strongly affect island arcs stretching perpendicular to the plate movement. This is the case on Java. Transcurrent faults and related pull-apart basins are a leading factor where plates meet at an angle, such as on Sumatra. The most complicated situation exists near the triple-junction and in the Moluccas. Modern research methods, such as GPS measurements of plate movements and absolute dating of volcanic outbursts and raised coral reefs are important tools. The mega-landforms resulting

  13. Effects of injected dose, BMI and scanner type on NECR and image noise in PET imaging.

    Science.gov (United States)

    Chang, Tingting; Chang, Guoping; Kohlmyer, Steve; Clark, John W; Rohren, Eric; Mawlawi, Osama R

    2011-08-21

    Noise equivalent count rate (NECR) and image noise are two different but related metrics that have been used to predict and assess image quality, respectively. The aim of this study is to investigate, using patient studies, the relationships between injected dose (ID), body mass index (BMI) and scanner type on NECR and image noise measurements in PET imaging. Two groups of 90 patients each were imaged on a GE DSTE and a DRX PET/CT scanner, respectively. The patients in each group were divided into nine subgroups according to three BMI (20-24.9, 25-29.9, 30-45 kg m(-2)) and three ID (296-444, 444-555, 555-740 MBq) ranges, resulting in ten patients/subgroup. All PET data were acquired in 3D mode and reconstructed using the VuePoint HD® fully 3D OSEM algorithm (2 iterations, 21(DRX) or 20 (DSTE) subsets). NECR and image noise measurements for bed positions covering the liver were calculated for each patient. NECR was calculated from the trues, randoms and scatter events recorded in the DICOM header of each patient study, while image noise was determined as the standard deviation of 50 non-neighboring voxels in the liver of each patient. A t-test compared the NECR and image noise for different scanners but with the same BMI and ID. An ANOVA test on the other hand was used to compare the results of patients with different BMI but the same ID and scanner type as well as different ID but the same BMI and scanner type. As expected the t-test showed a significant difference in NECR between the two scanners for all BMI and ID subgroups. However, contrary to what is expected no such findings were observed for image noise measurement. The ANOVA results showed a statistically significant difference in both NECR and image noise among the different BMI for each ID and scanner subgroup. However, there was no statistically significant difference in NECR and image noise across different ID for each BMI and scanner subgroup. Although the GE DRX PET/CT scanner has better count rate

  14. Effects of injected dose, BMI and scanner type on NECR and image noise in PET imaging

    Science.gov (United States)

    Chang, Tingting; Chang, Guoping; Kohlmyer, Steve; Clark, John W., Jr.; Rohren, Eric; Mawlawi, Osama R.

    2011-08-01

    Noise equivalent count rate (NECR) and image noise are two different but related metrics that have been used to predict and assess image quality, respectively. The aim of this study is to investigate, using patient studies, the relationships between injected dose (ID), body mass index (BMI) and scanner type on NECR and image noise measurements in PET imaging. Two groups of 90 patients each were imaged on a GE DSTE and a DRX PET/CT scanner, respectively. The patients in each group were divided into nine subgroups according to three BMI (20-24.9, 25-29.9, 30-45 kg m-2) and three ID (296-444, 444-555, 555-740 MBq) ranges, resulting in ten patients/subgroup. All PET data were acquired in 3D mode and reconstructed using the VuePoint HD® fully 3D OSEM algorithm (2 iterations, 21(DRX) or 20 (DSTE) subsets). NECR and image noise measurements for bed positions covering the liver were calculated for each patient. NECR was calculated from the trues, randoms and scatter events recorded in the DICOM header of each patient study, while image noise was determined as the standard deviation of 50 non-neighboring voxels in the liver of each patient. A t-test compared the NECR and image noise for different scanners but with the same BMI and ID. An ANOVA test on the other hand was used to compare the results of patients with different BMI but the same ID and scanner type as well as different ID but the same BMI and scanner type. As expected the t-test showed a significant difference in NECR between the two scanners for all BMI and ID subgroups. However, contrary to what is expected no such findings were observed for image noise measurement. The ANOVA results showed a statistically significant difference in both NECR and image noise among the different BMI for each ID and scanner subgroup. However, there was no statistically significant difference in NECR and image noise across different ID for each BMI and scanner subgroup. Although the GE DRX PET/CT scanner has better count rate

  15. Two-Dimensional Metrology with Flatbed Scanners at Room and Liquid Nitrogen Temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Grau Carles, A.; Grau Malonda, A. [CIEMAT. Madrid (Spain)

    2000-07-01

    We study the capability of the commercial flatbed scanner as a measuring instrument of two-coordinate sample both at room and liquid nitrogen temperatures. We describes simple procedure to calibrate the scanner, and the most adequate standard configuration to carry out the measurements. To illustrate the procedure, we measure the relative positions of the conductors in a cross-section of a superconducting magnet of CERN. (Author) 8 refs.

  16. Development of Monte Carlo simulations to provide scanner-specific organ dose coefficients for contemporary CT

    Science.gov (United States)

    Jansen, Jan T. M.; Shrimpton, Paul C.

    2016-07-01

    The ImPACT (imaging performance assessment of CT scanners) CT patient dosimetry calculator is still used world-wide to estimate organ and effective doses (E) for computed tomography (CT) examinations, although the tool is based on Monte Carlo calculations reflecting practice in the early 1990’s. Subsequent developments in CT scanners, definitions of E, anthropomorphic phantoms, computers and radiation transport codes, have all fuelled an urgent need for updated organ dose conversion factors for contemporary CT. A new system for such simulations has been developed and satisfactorily tested. Benchmark comparisons of normalised organ doses presently derived for three old scanners (General Electric 9800, Philips Tomoscan LX and Siemens Somatom DRH) are within 5% of published values. Moreover, calculated normalised values of CT Dose Index for these scanners are in reasonable agreement (within measurement and computational uncertainties of  ±6% and  ±1%, respectively) with reported standard measurements. Organ dose coefficients calculated for a contemporary CT scanner (Siemens Somatom Sensation 16) demonstrate potential deviations by up to around 30% from the surrogate values presently assumed (through a scanner matching process) when using the ImPACT CT Dosimetry tool for newer scanners. Also, illustrative estimates of E for some typical examinations and a range of anthropomorphic phantoms demonstrate the significant differences (by some 10’s of percent) that can arise when changing from the previously adopted stylised mathematical phantom to the voxel phantoms presently recommended by the International Commission on Radiological Protection (ICRP), and when following the 2007 ICRP recommendations (updated from 1990) concerning tissue weighting factors. Further simulations with the validated dosimetry system will provide updated series of dose coefficients for a wide range of contemporary scanners.

  17. Predicting the Impact of Full Body Scanners on Air Travel and Passenger Safety

    Science.gov (United States)

    2010-06-01

    porn is among the legal and operational issues under discussion. Simon Davies of Privacy International voiced his concern over the current privacy...May 31, 2010, from http://www.tampaairport.com/security/index.asp Travis, A. (2010). New scanners break child porn laws. Guardian.co.uk. Retrieved...May 20, 2010, from http://www.guardian.co.uk/politics/2010/jan/04/new-scanners- child- porn -laws TSA.gov, Transportaion Security Administration. (2010

  18. Preprocessing techniques to reduce atmospheric and sensor variability in multispectral scanner data.

    Science.gov (United States)

    Crane, R. B.

    1971-01-01

    Multispectral scanner data are potentially useful in a variety of remote sensing applications. Large-area surveys of earth resources carried out by automated recognition processing of these data are particularly important. However, the practical realization of such surveys is limited by a variability in the scanner signals that results in improper recognition of the data. This paper discusses ways by which some of this variability can be removed from the data by preprocessing with resultant improvements in recognition results.

  19. ANALYSIS OF THE PERFORMANCE OF A LASER SCANNER FOR PREDICTIVE AUTOMOTIVE APPLICATIONS

    OpenAIRE

    Zeisler, J; Maas, H.-G.

    2015-01-01

    In this paper we evaluate the use of a laser scanner for future advanced driver assistance systems. We focus on the important task of predicting the target vehicle for longitudinal ego vehicle control. Our motivation is to decrease the reaction time of existing systems during cut-in maneuvers of other traffic participants. A state-of-the-art laser scanner, the Ibeo Scala B2 R , is presented, providing its sensing characteristics and the subsequent high level object data output. We ev...

  20. Optimizing spatial resolution with the mechanical design of an X-ray computed tomography scanner

    Science.gov (United States)

    Harris, Lowell D.; Bernardi, Richard T.; Hughes, Simon H. C.; Slocum, Robert E.

    The most important factor limiting spatial resolution in a well-designed CT scanner - the width of the X-ray beam as it passes through the object being examined - is described. The Advanced Computed Tomography Inspection System (ACTIS), a second-generation CT scanner that has a variable geometry to allow a wide variety of objects to be scanned at peak spatial resolution, even with different radiation sources, is described.