WorldWideScience

Sample records for plants solanum tuberosum

  1. Expression of modified 7SL RNA gene in transgenic Solanum tuberosum plants

    Czech Academy of Sciences Publication Activity Database

    Vrba, Lukáš; Matoušek, Jaroslav

    2005-01-01

    Roč. 49, - (2005), 371-380 ISSN 0006-3134 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * Solanum tuberosum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.792, year: 2005

  2. Potato (Solanum tuberosum L.).

    Science.gov (United States)

    Chetty, Venkateswari J; Narváez-Vásquez, Javier; Orozco-Cárdenas, Martha L

    2015-01-01

    Agrobacterium-mediated transformation is the most common method for the incorporation of foreign genes into the genome of potato as well as many other species in the Solanaceae family. This chapter describes protocols for the genetic transformation of three species of potato: Solanum tuberosum subsp. tuberosum (Desiréé), S. tuberosum subsp. andigenum (Blue potato), and S. tuberosum subsp. andigena using internodal segments as explants.

  3. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana

    OpenAIRE

    Carvallo, Marcela A.; Pino, María-Teresa; Jeknić, Zoran; Zou, Cheng; Doherty, Colleen J.; Shiu, Shin-Han; Chen, Tony H. H.; Thomashow, Michael F.

    2011-01-01

    Solanum commersonii and Solanum tuberosum are closely related plant species that differ in their abilities to cold acclimate; whereas S. commersonii increases in freezing tolerance in response to low temperature, S. tuberosum does not. In Arabidopsis thaliana, cold-regulated genes have been shown to contribute to freezing tolerance, including those that comprise the CBF regulon, genes that are controlled by the CBF transcription factors. The low temperature transcriptomes and CBF regulons of ...

  4. Defense mechanisms of Solanum tuberosum L. in response to attack by plant-pathogenic bacteria

    Directory of Open Access Journals (Sweden)

    VERA A D POIATTI

    2009-01-01

    Full Text Available The natural resistance of plants to disease is based not only on preformed mechanisms, but also on induced mechanisms. The defense mechanisms present in resistant plants may also be found in susceptible ones. This study attempted to analyze the metabolic alterations in plants of the potato Solanum tuberosum L. cv. Agata that were inoculated with the incompatible plant-pathogenic bacteria X. axonopodis and R. solanacearum, and the compatible bacterium E. carotovora. Levels of total phenolic compounds, including the flavonoid group, and the activities of polyphenol oxidase (PPO and peroxidase (POX were evaluated. Bacteria compatibility was evaluated by means of infiltration of tubers. The defense response was evaluated in the leaves of the potato plants. Leaves were inoculated depending on their number and location on the stem. Multiple-leaf inoculation was carried out on basal, intermediate, and apical leaves, and single inoculations on intermediate leaves. Leaves inoculated with X. axonopodis and with R. solanacearum showed hypersensitive responses within 24 hours post-inoculation, whereas leaves inoculated with E. carotovora showed disease symptoms. Therefore, the R. solanacearum isolate used in the experiments did not exhibit virulence to this potato cultivar. Regardless of the bacterial treatments, the basal leaves showed higher PPO and POX activities and lower levels of total phenolic compounds and flavonoids, compared to the apical leaves. However, basal and intermediate leaves inoculated with R. solanacearum and X. axonopodis showed increases in total phenolic compounds and flavonoid levels. In general, multiple-leaf inoculation showed the highest levels of total phenolics and flavonoids, whereas the single inoculations resulted in the highest increase in PPO activity. The POX activity showed no significant difference between single- and multiple-leaf inoculations. Plants inoculated with E. carotovora showed no significant increase in

  5. Potato plants (Solanum tuberosum L.) are chloride-sensitive: Is this dogma valid?

    Science.gov (United States)

    Hütsch, Birgit W; Keipp, Katrin; Glaser, Ann-Kathrin; Schubert, Sven

    2018-06-01

    Chloride sensitivity of the potato (Solanum tuberosum L.) cultivars Marabel and Désirée was investigated in two pot experiments (soil/sand mixture and hydroponics). It was tested whether there are differential effects of KCl and K 2 SO 4 application on tuber yield and tuber quality, and whether both potato cultivars differ in their chloride sensitivity. Tuber yield, dry matter percentage of the tubers, starch concentration and starch yield were not significantly affected by potassium source (K 2 SO 4 or KCl). After exposure to salt stress in hydroponics (100 mmol L -1 NaCl, 50 mmol L -1 Na 2 SO 4 , 50 mmol L -1 CaCl 2 ) for 5 days, 3-week-old potato plants had significantly reduced shoot dry mass after NaCl and Na 2 SO 4 application. However, CaCl 2 treatment did not significantly affect shoot growth, although the chloride concentration reached 65 to 74 mg Cl - mg -1 dry matter, similar to the NaCl treatment. In contrast, growth reductions were closely related to sodium concentrations, thus plants suffered sodium toxicity and not chloride toxicity. Both potato cultivars are chloride-resistant and can be fertilised with KCl instead of K 2 SO 4 without the risk of depression in tuber yield or tuber quality. The statement that potatoes are chloride-sensitive and that chloride has negative effects on yield performance needs reconsideration. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  6. Plastid transformation in potato: Solanum tuberosum.

    Science.gov (United States)

    Valkov, Vladimir T; Gargano, Daniela; Scotti, Nunzia; Cardi, Teodoro

    2014-01-01

    Although plastid transformation has attractive advantages and potential applications in plant biotechnology, for long time it has been highly efficient only in tobacco. The lack of efficient selection and regeneration protocols and, for some species, the inefficient recombination using heterologous flanking regions in transformation vectors prevented the extension of the technology to major crops. However, the availability of this technology for species other than tobacco could offer new possibilities in plant breeding, such as resistance management or improvement of nutritional value, with no or limited environmental concerns. Herein we describe an efficient plastid transformation protocol for potato (Solanum tuberosum subsp. tuberosum). By optimizing the tissue culture system and using transformation vectors carrying homologous potato flanking sequences, we obtained up to one transplastomic shoot per bombardment. Such efficiency is comparable to that usually achieved in tobacco. The method described in this chapter can be used to regenerate potato transplastomic plants expressing recombinant proteins in chloroplasts as well as in amyloplasts.

  7. Uptake of Plutonium-238 into Solanum tuberosum L. (potato plants) in presence of complexing agent EDTA.

    Science.gov (United States)

    Tawussi, Frank; Gupta, Dharmendra K; Mühr-Ebert, Elena L; Schneider, Stephanie; Bister, Stefan; Walther, Clemens

    2017-11-01

    Bioavailability and plant uptake of radionuclides depend on various factors. Transfer into different plant parts depends on chemical and physical processes, which need to be known for realistic ingestion dose modelling when these plants are used for food. Within the scope of the present work, the plutonium uptake by potato plants (Solanum tuberosum L.) was investigated in hydroponic solution of low concentration [Pu] = 10 -9  mol L -1 . Particular attention was paid to the speciation of radionuclides in the solution which was modelled by the speciation code PHREEQC. The speciation, the solubility and therefore the plant availability of radionuclides mainly depend on the pH value and the redox potential of the solution. During the contamination period, the redox potential did not change significantly. In contrast, the pH value showed characteristic changes depending on exudates excreted by the plants. Plant roots took up high amounts of plutonium (37%-50% of the added total amount). In addition to the uptake into the roots, the radionuclides can also adsorb to the exterior root surface. The solution-to-plant transfer factor showed values between 0.03 and 0.80 (Bq kg -1 / Bq L -1 ) for the potato tubers. By addition of the complexing agent EDTA (10 -4  mol L-1), the plutonium uptake from solution increased by 58% in tubers and by 155% in shoots/leaves. The results showed that excreted substances by plants affect bioavailability of radionuclides at low concentration, on the one hand. On the other hand, the uptake of plutonium by roots and the accumulation in different plant parts can lead to non-negligible ingestion doses, even at low concentration. We are aware of the limited transferability of data obtained in hydroponic solutions to plants growing in soil. However, the aim of this study is twofold: First we want to investigate the influence of Pu speciation on plant uptake in a rather well defined system which can be modelled using available thermodynamic data

  8. Solanum tuberosum L.

    African Journals Online (AJOL)

    user

    2011-02-07

    Feb 7, 2011 ... sampling system. These genotypes were collected from production areas in high altitudes of the ... environmental stress factors (Aytac and Arslanoglu,. 2004). ...... Starch and Sugar Plant Production, Turkey VII. Technical.

  9. Hyperspectral remote sensing for advanced detection of early blight (Alternaria solani) disease in potato (Solanum tuberosum) plants

    Science.gov (United States)

    Atherton, Daniel

    Early detection of disease and insect infestation within crops and precise application of pesticides can help reduce potential production losses, reduce environmental risk, and reduce the cost of farming. The goal of this study was the advanced detection of early blight (Alternaria solani) in potato (Solanum tuberosum) plants using hyperspectral remote sensing data captured with a handheld spectroradiometer. Hyperspectral reflectance spectra were captured 10 times over five weeks from plants grown to the vegetative and tuber bulking growth stages. The spectra were analyzed using principal component analysis (PCA), spectral change (ratio) analysis, partial least squares (PLS), cluster analysis, and vegetative indices. PCA successfully distinguished more heavily diseased plants from healthy and minimally diseased plants using two principal components. Spectral change (ratio) analysis provided wavelengths (490-510, 640, 665-670, 690, 740-750, and 935 nm) most sensitive to early blight infection followed by ANOVA results indicating a highly significant difference (p potato plants.

  10. Expression of recombinant staphylokinase, a fibrin-specific plasminogen activator of bacterial origin, in potato (Solanum tuberosum L.) plants.

    Science.gov (United States)

    Gerszberg, Aneta; Wiktorek-Smagur, Aneta; Hnatuszko-Konka, Katarzyna; Łuchniak, Piotr; Kononowicz, Andrzej K

    2012-03-01

    One of the most dynamically developing sectors of green biotechnology is molecular farming using transgenic plants as natural bioreactors for the large scale production of recombinant proteins with biopharmaceutical and therapeutic values. Such properties are characteristic of certain proteins of bacterial origin, including staphylokinase. For many years, work has been carried out on the use of this protein in thrombolytic therapy. In this study, transgenic Solanum tuberosum plants expressing a CaMV::sak-mgpf-gusA gene fusion, were obtained. AGL1 A. tumefaciens strain was used in the process of transformation. The presence of the staphylokinase gene was confirmed by PCR in 22.5% of the investigated plants. The expression of the fusion transgene was detected using the β-glucuronidase activity assay in 32 putative transgenic plants. Furthermore, on the basis of the GUS histochemical reaction, the transgene expression pattern had a strong, constitutive character in seven of the transformants. The polyacrylamide gel electrophoresis of a protein extract from the SAK/PCR-positive plants, revealed the presence of a119 kDa protein that corresponds to that of the fusion protein SAK-mGFP-GUSA. Western blot analysis, using an antibody against staphylokinase, showed the presence of the staphylokinase domain in the 119 kDa protein in six analyzed transformants. However, the enzymatic test revealed amidolytic activity characteristic of staphylokinase in the protein extract of only one plant. This is the first report on a Solanum tuberosum plant producing a recombinant staphylokinase protein, a plasminogen activator of bacterial origin.

  11. Potato Annexin STANN1 Promotes Drought Tolerance and Mitigates Light Stress in Transgenic Solanum tuberosum L. Plants

    Science.gov (United States)

    Szalonek, Michal; Sierpien, Barbara; Rymaszewski, Wojciech; Gieczewska, Katarzyna; Garstka, Maciej; Lichocka, Malgorzata; Sass, Laszlo; Paul, Kenny; Vass, Imre; Vankova, Radomira; Dobrev, Peter; Szczesny, Pawel; Marczewski, Waldemar; Krusiewicz, Dominika; Strzelczyk-Zyta, Danuta; Hennig, Jacek; Konopka-Postupolska, Dorota

    2015-01-01

    Annexins are a family of calcium- and membrane-binding proteins that are important for plant tolerance to adverse environmental conditions. Annexins function to counteract oxidative stress, maintain cell redox homeostasis, and enhance drought tolerance. In the present study, an endogenous annexin, STANN1, was overexpressed to determine whether crop yields could be improved in potato (Solanum tuberosum L.) during drought. Nine potential potato annexins were identified and their expression characterized in response to drought treatment. STANN1 mRNA was constitutively expressed at a high level and drought treatment strongly increased transcription levels. Therefore, STANN1 was selected for overexpression analysis. Under drought conditions, transgenic potato plants ectopically expressing STANN1 were more tolerant to water deficit in the root zone, preserved more water in green tissues, maintained chloroplast functions, and had higher accumulation of chlorophyll b and xanthophylls (especially zeaxanthin) than wild type (WT). Drought-induced reductions in the maximum efficiency and the electron transport rate of photosystem II (PSII), as well as the quantum yield of photosynthesis, were less pronounced in transgenic plants overexpressing STANN1 than in the WT. This conferred more efficient non-photochemical energy dissipation in the outer antennae of PSII and probably more efficient protection of reaction centers against photooxidative damage in transgenic plants under drought conditions. Consequently, these plants were able to maintain effective photosynthesis during drought, which resulted in greater productivity than WT plants despite water scarcity. Although the mechanisms underlying this stress protection are not yet clear, annexin-mediated photoprotection is probably linked to protection against light-induced oxidative stress. PMID:26172952

  12. Potato Annexin STANN1 Promotes Drought Tolerance and Mitigates Light Stress in Transgenic Solanum tuberosum L. Plants.

    Science.gov (United States)

    Szalonek, Michal; Sierpien, Barbara; Rymaszewski, Wojciech; Gieczewska, Katarzyna; Garstka, Maciej; Lichocka, Malgorzata; Sass, Laszlo; Paul, Kenny; Vass, Imre; Vankova, Radomira; Dobrev, Peter; Szczesny, Pawel; Marczewski, Waldemar; Krusiewicz, Dominika; Strzelczyk-Zyta, Danuta; Hennig, Jacek; Konopka-Postupolska, Dorota

    2015-01-01

    Annexins are a family of calcium- and membrane-binding proteins that are important for plant tolerance to adverse environmental conditions. Annexins function to counteract oxidative stress, maintain cell redox homeostasis, and enhance drought tolerance. In the present study, an endogenous annexin, STANN1, was overexpressed to determine whether crop yields could be improved in potato (Solanum tuberosum L.) during drought. Nine potential potato annexins were identified and their expression characterized in response to drought treatment. STANN1 mRNA was constitutively expressed at a high level and drought treatment strongly increased transcription levels. Therefore, STANN1 was selected for overexpression analysis. Under drought conditions, transgenic potato plants ectopically expressing STANN1 were more tolerant to water deficit in the root zone, preserved more water in green tissues, maintained chloroplast functions, and had higher accumulation of chlorophyll b and xanthophylls (especially zeaxanthin) than wild type (WT). Drought-induced reductions in the maximum efficiency and the electron transport rate of photosystem II (PSII), as well as the quantum yield of photosynthesis, were less pronounced in transgenic plants overexpressing STANN1 than in the WT. This conferred more efficient non-photochemical energy dissipation in the outer antennae of PSII and probably more efficient protection of reaction centers against photooxidative damage in transgenic plants under drought conditions. Consequently, these plants were able to maintain effective photosynthesis during drought, which resulted in greater productivity than WT plants despite water scarcity. Although the mechanisms underlying this stress protection are not yet clear, annexin-mediated photoprotection is probably linked to protection against light-induced oxidative stress.

  13. Potato Annexin STANN1 Promotes Drought Tolerance and Mitigates Light Stress in Transgenic Solanum tuberosum L. Plants.

    Directory of Open Access Journals (Sweden)

    Michal Szalonek

    Full Text Available Annexins are a family of calcium- and membrane-binding proteins that are important for plant tolerance to adverse environmental conditions. Annexins function to counteract oxidative stress, maintain cell redox homeostasis, and enhance drought tolerance. In the present study, an endogenous annexin, STANN1, was overexpressed to determine whether crop yields could be improved in potato (Solanum tuberosum L. during drought. Nine potential potato annexins were identified and their expression characterized in response to drought treatment. STANN1 mRNA was constitutively expressed at a high level and drought treatment strongly increased transcription levels. Therefore, STANN1 was selected for overexpression analysis. Under drought conditions, transgenic potato plants ectopically expressing STANN1 were more tolerant to water deficit in the root zone, preserved more water in green tissues, maintained chloroplast functions, and had higher accumulation of chlorophyll b and xanthophylls (especially zeaxanthin than wild type (WT. Drought-induced reductions in the maximum efficiency and the electron transport rate of photosystem II (PSII, as well as the quantum yield of photosynthesis, were less pronounced in transgenic plants overexpressing STANN1 than in the WT. This conferred more efficient non-photochemical energy dissipation in the outer antennae of PSII and probably more efficient protection of reaction centers against photooxidative damage in transgenic plants under drought conditions. Consequently, these plants were able to maintain effective photosynthesis during drought, which resulted in greater productivity than WT plants despite water scarcity. Although the mechanisms underlying this stress protection are not yet clear, annexin-mediated photoprotection is probably linked to protection against light-induced oxidative stress.

  14. Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.

    Science.gov (United States)

    Gong, Lei; Zhang, Hongxia; Gan, Xiaoyan; Zhang, Li; Chen, Yuchao; Nie, Fengjie; Shi, Lei; Li, Miao; Guo, Zhiqian; Zhang, Guohui; Song, Yuxia

    2015-01-01

    Drought stress can seriously affect tuberization, yield and quality of potato plant. However, the precise molecular mechanisms governing potato stolon's response to drought stress and water supply are not very well understood. In this work, a potato (Solanum tuberosum L.) variant, Ningshu 4, was subjected to severe drought stress treatment (DT) and re-watering treatment (RWT) at tuber bulking stage. Strand-specific cDNA libraries of stolon materials were constructed for paired-end transcriptome sequencing analyses and differentially expressed gene (DEG) examination. In comparison to untreated-control (CT) plants, 3189 and 1797 DEGs were identified in DT and RWT plants and 4154 solely expressed DEGs were screened out from these two comparison groups. Interestingly, 263 genes showed opposite expression patterns in DT and RWT plants. Among them, genes homologous to Protein Phosphatase 2C (PP2C), Aspartic protease in guard cell 1 (ASPG1), auxin-responsive protein, Arabidopsis pseudo response regualtor 2 (APRR2), GA stimulated transcripts in Arabidopsis 6 (GASA6), Calmodulin-like protein 19 (CML19), abscisic acid 8'-hydroxylases and calcium-transporting ATPase, et al. were related with drought-stress and water stimulus response. Sixteen DEGs involved in starch synthesis, accumulation and tuber formation exhibited significantly different expression upon re-watering. In addition, 1630, 1527 and 1596 transcription factor encoding genes were detected in CT, DT and RWT. DEGs of ERF, bHLH, MYB, NAC, WRKY, C2H2, bZIP and HD-ZIP families accounted for 50% in three comparison groups, respectively. Furthermore, characteristics of 565 gene ontology (GO) and 108 Kyoto Encyclopedia of Genes and Genomes pathways (KEGG) were analyzed with the 4154 DEGs. All these results suggest that the drought- and water-stimulus response could be implemented by the regulated expression of metabolic pathway DEGs, and these genes were involved in the endogenous hormone biosynthesis and signal

  15. Transcriptome Profiling of the Potato (Solanum tuberosum L. Plant under Drought Stress and Water-Stimulus Conditions.

    Directory of Open Access Journals (Sweden)

    Lei Gong

    Full Text Available Drought stress can seriously affect tuberization, yield and quality of potato plant. However, the precise molecular mechanisms governing potato stolon's response to drought stress and water supply are not very well understood. In this work, a potato (Solanum tuberosum L. variant, Ningshu 4, was subjected to severe drought stress treatment (DT and re-watering treatment (RWT at tuber bulking stage. Strand-specific cDNA libraries of stolon materials were constructed for paired-end transcriptome sequencing analyses and differentially expressed gene (DEG examination. In comparison to untreated-control (CT plants, 3189 and 1797 DEGs were identified in DT and RWT plants and 4154 solely expressed DEGs were screened out from these two comparison groups. Interestingly, 263 genes showed opposite expression patterns in DT and RWT plants. Among them, genes homologous to Protein Phosphatase 2C (PP2C, Aspartic protease in guard cell 1 (ASPG1, auxin-responsive protein, Arabidopsis pseudo response regualtor 2 (APRR2, GA stimulated transcripts in Arabidopsis 6 (GASA6, Calmodulin-like protein 19 (CML19, abscisic acid 8'-hydroxylases and calcium-transporting ATPase, et al. were related with drought-stress and water stimulus response. Sixteen DEGs involved in starch synthesis, accumulation and tuber formation exhibited significantly different expression upon re-watering. In addition, 1630, 1527 and 1596 transcription factor encoding genes were detected in CT, DT and RWT. DEGs of ERF, bHLH, MYB, NAC, WRKY, C2H2, bZIP and HD-ZIP families accounted for 50% in three comparison groups, respectively. Furthermore, characteristics of 565 gene ontology (GO and 108 Kyoto Encyclopedia of Genes and Genomes pathways (KEGG were analyzed with the 4154 DEGs. All these results suggest that the drought- and water-stimulus response could be implemented by the regulated expression of metabolic pathway DEGs, and these genes were involved in the endogenous hormone biosynthesis and signal

  16. Distribución Diferencial de Bacterias con Potencial Biocontrolador de Spongospora subterranea en Plantas de Papa (Solanum tuberosum cv. Diacol Capiro Differential Distrubution of Candidadate Biocontrol Bacteria against Spongospora subterranea in Potato Plants (Solanum tuberosum cv. Diacol Capiro

    Directory of Open Access Journals (Sweden)

    Juliana Soler Arango

    2012-06-01

    Full Text Available Resumen. La búsqueda de microorganismos promisorios para biocontrol de patógenos de plantas en el suelo con frecuencia se ha orientado a la detección de productores de hormonas y enzimas líticas, condiciones asociadas a su capacidad para promover crecimiento vegetal. Sin embargo, el suelo es altamente variable en escalas pequeñas y se conoce poco sobre la distribución espacial de microorganismos que expresan esas funciones. Este estudio determinó la capacidad de producción de indoles totales y quitinasas en bacterias cultivables aisladas del interior de la raíz, la rizósfera, la superficie de los tubérculos o suelo de un cultivo de papa (Solanum tuberosum variedad Diacol Capiro. Las muestras se obtuvieron en un campo comercial en el municipio de la Unión en el departamento de Antioquia, Colombia, en plantas que presentaban síntomas de infección por Spongospora subterranea. Se encontró una producción diferencial de indoles o quitinasas según el sitio de aislamiento de las bacterias. No se encontró una alta producción de ambas actividades en un sólo aislamiento, la mayor producción de indoles totales y quitinasas se encontró en bacterias aisladas a partir de raíz y rizósfera, comparada con las aisladas de tubérculos y suelo. Estos resultados sugieren que en el suelo no es aleatoria la distribución de funciones deseables en controladores biológicos. Con estos resultados es posible orientar su búsqueda para optimizar el uso de recursos y el desarrollo de nuevos bioproductos.Abstract. Searching for promising microorganisms to biocontrol soil-borne plant pathogens has been often focused on producers of hormone and lytic enzymes, since these traits are linked to plant growth promotion. However, the environment from inner roots to bulk soil is quite variable, and little is known about the spatial distribution of microorganisms expressing these desirable traits. Using potato plants (Solanum tuberosum var. Diacol Capiro from a

  17. Potato (Solanum tuberosum) greenhouse tuber production as an assay for asexual reproduction effects from herbicides

    Science.gov (United States)

    The present study determined whether young potato plants can be used as an assay to indicate potential effects of pesticides on asexual reproduction. Solanum tuberosum (Russet Burbank) plants were grown from seed pieces in a mineral soil in pots under greenhouse conditions. Plant...

  18. 5-Azacytidine mediated reactivation of silenced transgenes in potato (Solanum tuberosum) at the whole plant level.

    Science.gov (United States)

    Tyč, Dimitrij; Nocarová, Eva; Sikorová, Lenka; Fischer, Lukáš

    2017-08-01

    Transient 5-azacytidine treatment of leaf explants from potato plants with transcriptionally silenced transgenes allows de novo regeneration of plants with restored transgene expression at the whole plant level. Transgenes introduced into plant genomes frequently become silenced either at the transcriptional or the posttranscriptional level. Transcriptional silencing is usually associated with DNA methylation in the promoter region. Treatments with inhibitors of maintenance DNA methylation were previously shown to allow reactivation of transcriptionally silenced transgenes in single cells or tissues, but not at the whole plant level. Here we analyzed the effect of DNA methylation inhibitor 5-azacytidine (AzaC) on the expression of two silenced reporter genes encoding green fluorescent protein (GFP) and neomycin phosphotransferase (NPTII) in potato plants. Whereas no obvious reactivation was observed in AzaC-treated stem cuttings, transient treatment of leaf segments with 10 μM AzaC and subsequent de novo regeneration of shoots on the selective medium with kanamycin resulted in the production of whole plants with clearly reactivated expression of previously silenced transgenes. Reactivation of nptII expression was accompanied by a decrease in cytosine methylation in the promoter region of the gene. Using the plants with reactivated GFP expression, we found that re-silencing of this transgene can be accidentally triggered by de novo regeneration. Thus, testing the incidence of transgene silencing during de novo regeneration could be a suitable procedure for negative selection of transgenic lines (insertion events) which have an inclination to be silenced. Based on our analysis of non-specific inhibitory effects of AzaC on growth of potato shoots in vitro, we estimated that AzaC half-life in the culture media is approximately 2 days.

  19. Accumulation of heavy metals in plants and potential phytoremediation of lead by potato, Solanum tuberosum L.

    Science.gov (United States)

    Antonious, George F; Snyder, John C

    2007-05-01

    The use of sewage sludge as a source of nutrients in crop production is increasing in the United States and worldwide. A field study was conducted on a 10% slope at Kentucky State University Research Farm. Eighteen plots of 22x3.7 m each were separated using metal borders and the soil in six plots was mixed with sewage sludge, six plots were mixed with yard waste compost, and six unamended plots were used for comparison purposes. During a subsequent 3-year study, plots were planted with potato (year 1), pepper (year 2), and broccoli (year 3). The objectives of this investigation were to: (i) characterize chemical properties of soil-incorporated sewage sludge and yard waste compost; (ii) determine the concentration of seven heavy metals (Cd, Cr, Ni, Pb, Zn, Cu, and Mo) in sewage sludge and yard waste compost used for land farming; and (iii) monitor heavy metal concentrations in edible portions of plants at harvest. Concentrations of heavy metals in sewage sludge were below the U.S. EPA limits. Analysis of potato tubers, peppers, and broccoli grown in sludge-amended soil showed that Cd, Cr, Ni, and Pb were not significantly different from control plants. Concentrations of Zn, Cu, and Mo were significantly greater in tubers and peppers grown in sludge compared to their respective controls. Zn and Mo in broccoli heads were higher than their control plants. The ability of potato to accumulate lead needs additional investigation to optimize the phytoremediation of this pollutant element.

  20. Climate Change: Precipitation and Plant Nutrition Interactions on Potato (Solanum tuberosum L.) Yield in North-Eastern Hungary

    Science.gov (United States)

    László Phd, M., ,, Dr.

    2009-04-01

    formation, yield quantity of potato depended decisively on the time of year when they were experienced and the period for which they lasted. Droughts in the winter or summer half-year had much the same effect on yield. Precipitation deficiency in the winter could not be counterbalanced by average rainfall during the vegetation period, and its effect on the yield was similar to that of summer drought. It was also concluded that economic yields could not be achieved with poor N, P, K and Mg nutrient supply even with a normal quantity and distribution of rainfall. Yield was influenced by rainfall to a greater extent (Table 4) than by 0-150 kg ha-1 nitrogen and NP, NK, NPK, NPKMg combinations. Drought and over rainfall negative effects were decreased by increasing N- doses with combinations of potassium, phosphorous and magnesium from 13 to 32% (Table 5). And with the help of regression analysis it was found the polynomial correlation between rainfall and yield could be observed in the case of N: Y'=380.18-2.95x+0.0056x2, n=72, R2=0.95, NP: Y'=387.19-3.04x+0.0059x2, n=72, R2=0.96, NK: Y'=381.65-2.95x+0.0056x2, n=72, R2=0.95, NPK: Y'=390.87-3.07x+0.0060x2, n=72, R2=0.96 and NPKMg: Y'=390.45-3.06x+0.0059x2, n=72, R2=0.96 nutrition systems. The optimum yields ranges between 17-20 t ha-1 at 280-330 mm of rainfall. Acknowledgement: This study were supported by Research Institute for Soil Science and Agricultural Chemistry of the Hungarian Academy of Sciences (RISSAC-HAS), Budapest. References Johnston, A. E., 2000. Some aspects of nitrogen use efficiency in arable agriculture. K. Scogs-o. Lantbr. Akad. Tidskr. 139, 8. Kádár, I., Márton, L., Horváth, S., 2000. Mineral fertilisation of potato (Solanum tuberosum L.) on calcareous chernozem soil. Plant Production. 49, 291-306. Kádár, I., Szemes, I., 1994. A nyírlugosi tartamkísérlet 30 éve. MTA TAKI, Budapest, 248 p. Láng, I., 1973. Műtrágyázási tartamkísérletek homoktalajon. MTA Doktori értekezés. MTA TMB. Budapest

  1. RNA-dependent RNA polymerase 1 in potato (Solanum tuberosum) and its relationship to other plant RNA-dependent RNA polymerases.

    Science.gov (United States)

    Hunter, Lydia J R; Brockington, Samuel F; Murphy, Alex M; Pate, Adrienne E; Gruden, Kristina; MacFarlane, Stuart A; Palukaitis, Peter; Carr, John P

    2016-03-16

    Cellular RNA-dependent RNA polymerases (RDRs) catalyze synthesis of double-stranded RNAs that can serve to initiate or amplify RNA silencing. Arabidopsis thaliana has six RDR genes; RDRs 1, 2 and 6 have roles in anti-viral RNA silencing. RDR6 is constitutively expressed but RDR1 expression is elevated following plant treatment with defensive phytohormones. RDR1 also contributes to basal virus resistance. RDR1 has been studied in several species including A. thaliana, tobacco (Nicotiana tabacum), N. benthamiana, N. attenuata and tomato (Solanum lycopersicum) but not to our knowledge in potato (S. tuberosum). StRDR1 was identified and shown to be salicylic acid-responsive. StRDR1 transcript accumulation decreased in transgenic potato plants constitutively expressing a hairpin construct and these plants were challenged with three viruses: potato virus Y, potato virus X, and tobacco mosaic virus. Suppression of StRDR1 gene expression did not increase the susceptibility of potato to these viruses. Phylogenetic analysis of RDR genes present in potato and in a range of other plant species identified a new RDR gene family, not present in potato and found only in Rosids (but apparently lost in the Rosid A. thaliana) for which we propose the name RDR7.

  2. Resistance to Erwinia spp. in potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Allefs, S.

    1995-01-01

    Blackleg is a disease of potato, Solanum tuberosum , which is caused by the bacteria Erwinia carotovora subsp. carotovora ( Ecc ), E.c. subsp. atroseptica ( Eca ) or

  3. Inhibition of a ubiquitously expressed pectin methyl esterase in Solanum tuberosum L. affects plant growth, leaf growth polarity, and ion partitioning.

    Science.gov (United States)

    Pilling, J; Willmitzer, L; Bücking, H; Fisahn, J

    2004-05-01

    Two pectin methyl esterases (PMEs; EC 3.1.1.11) from Solanum tuberosum were isolated and their expression characterised. One partial clone ( pest1) was expressed in leaves and fruit tissue, while pest2 was a functional full-length clone and was expressed ubiquitously, with a preference for aerial organs. Potato plants were transformed with a chimeric antisense construct that was designed to simultaneously inhibit pest1 and pest2 transcript accumulation; however, reduction of mRNA levels was confined to pest2. The decrease in pest2 transcript was accompanied by up to 50% inhibition of total PME activity, which was probably due to the reduction of only one PME isoform. PME inhibition affected plant development as reflected by smaller stem elongation rates of selected transformants when compared with control plants, leading to a reduction in height throughout the entire course of development. Expansion rates of young developing leaves were measured simultaneously by two displacement transducers in the direction of the leaf tip (proximal-distal axis) and in the perpendicular direction (medial-lateral axis). Significant differences in leaf growth patterns were detected between wild-type and transgenic plants. We suggest that these visual phenotypes could be correlated with modifications of ion accumulation and partitioning within the transgenic plants. The ion-binding capacities of cell walls from PME-inhibited plants were specifically modified as they preferentially bound more sodium, but less potassium and calcium. X-ray microanalysis also indicated an increase in the concentration of several ions within the leaf apoplast of transgenic plants. Moreover, quantification of the total content of major cations revealed differences specific for a given element between the leaves of PME-inhibited and wild-type plants. Reduced growth rates might also be due to effects of PME inhibition on pectin metabolism, predominantly illustrated by an accumulation of galacturonic acid

  4. Comparative metabolite profiling of Solanum tuberosum against six wild Solanum species with Colorado potato beetle resistance.

    Science.gov (United States)

    Tai, Helen H; Worrall, Kraig; Pelletier, Yvan; De Koeyer, David; Calhoun, Larry A

    2014-09-10

    The Colorado potato beetle Leptinotarsa decemlineata (Say) (CPB) is a coleopteran herbivore that feeds on the foliage on Solanum species, in particular, potato. Six resistant wild Solanum species were identified, and two of these species had low levels of glycoalkaloids. Comparative analysis of the untargeted metabolite profiles of the foliage using UPLC-qTOF-MS was done to find metabolites shared between the wild species but not with Solanum tuberosum (L.) to identify resistance-related metabolites. It was found that only S. tuberosum produced the triose glycoalkaloids solanine and chaconine. Instead, the six wild species produced glycoalkaloids that shared in common tetrose sugar side chains. Additionally, there were non-glycoalkaloid metabolites associated with resistance including hydroxycoumarin and a phenylpropanoid, which were produced in all wild species but not in S. tuberosum.

  5. Antibacterial effects of Solanum tuberosum peel ethanol extract in vitro

    Directory of Open Access Journals (Sweden)

    Amanpour Raana

    2015-04-01

    Full Text Available Introduction: Today, medicinal plants are being widely used due to being natural, available, and cheaper than synthetic drugs and having minimum side effects. Since there were reports about the antibacterial properties of Solanum tuberosum (SE, the aim of this study was to investigate the antibacterial effects of SE ethanol extract in vitro condition on Streptococcus pyogenes, Staphylococcus aureus, Pseudomonas aeruginosa and Klebsiella pneumoniae. Methods: Ethanol extract of SE peel was prepared by maceration method. Initially, antibacterial activity of ethanol extract of SE was qualitatively determined by disk diffusion test; then, the minimum inhibitory concentration and minimum bactericidal concentration were qualitatively determined by micro-dilution method. Results: SE peel extract had antibacterial properties and its effect was more pronounced on gram-positive bacteria, especially S. aureus (0.62±0.00 mg/ml. The extract had antibacterial activity on gram-negative bacteria, P. aeruginosa, too (8.33±2.88 mg/ml. Conclusion: SE peel extract has antibacterial activity and its effect on gram-positive bacteria was more pronounced than the investigated gram-negative bacteria. Therefore, it is suggested that SE peel constituent compounds be determined and to determine the exact mechanism of its antibacterial properties, and more comprehensive research be done to apply it, clinically.

  6. Comparative effects of partial root-zone drying and deficit irrigation on nitrogen uptake in potatoes (Solanum tuberosum L.)

    DEFF Research Database (Denmark)

    Wang, Huiqun; Liu, Fulai; Andersen, Mathias Neumann

    2009-01-01

    The effects of partial root-zone drying (PRD) as compared with deficit irrigation (DI) and full irrigation (FI) on nitrogen (N) uptake and partitioning in potato (Solanum tuberosum L.) were investigated. Potato plants were grown in split-root pots and were exposed to FI, PRD, and DI treatments...

  7. Phenotypic performance of transgenic potato (Solanum tuberosum L.) plants with pyramided rice cystatin genes (OCI and OCII)

    Science.gov (United States)

    The evaluation of transgenic plants commonly carried out under controlled conditions in culture rooms and greenhouses can give valuable information about the influence of introduced genes on transgenic plant phenotype. However, an overall assessment of plant performance can only be made by testing t...

  8. Effects of plant genotype and growth stage on the structure of bacterial communities associated with potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Overbeek, van L.S.; Elsas, van J.D.

    2008-01-01

    The effects of genotype, plant growth and experimental factors (soil and year) on potato-associated bacterial communities were studied. Cultivars Achirana Inta, Désirée, Merkur and transgenic Désirée line DL12 (containing T4 lysozyme gene) were assessed in two field experiments. Cross-comparisons

  9. Effects of plant genotype and growth stage on the structure of bacterial communities associated with potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    van Overbeek, Leo; van Elsas, Jan Dirk

    The effects of genotype, plant growth and experimental factors (soil and year) on potato-associated bacterial communities were studied. Cultivars Achirana Inta, Desiree, Merkur and transgenic Desiree line DL12 (containing T4 lysozyme gene) were assessed in two field experiments. Cross-comparisons

  10. Antifungal activity of secondary plant metabolites from potatoes (Solanum tuberosum L.): Glycoalkaloids and phenolic acids show synergistic effects.

    Science.gov (United States)

    Sánchez-Maldonado, A F; Schieber, A; Gänzle, M G

    2016-04-01

    To study the antifungal effects of the potato secondary metabolites α-solanine, α-chaconine, solanidine and caffeic acid, alone or combined. Resistance to glycoalkaloids varied among the fungal species tested, as derived from minimum inhibitory concentrations assays. Synergistic antifungal activity between glycoalkaloids and phenolic compounds was found. Changes in the fluidity of fungal membranes caused by potato secondary plant metabolites were determined by calculation of the generalized polarization values. The results partially explained the synergistic effect between caffeic acid and α-chaconine and supported findings on membrane disruption mechanisms from previous studies on artificial membranes. LC/MS analysis was used to determine variability and relative amounts of sterols in the different fungal species. Results suggested that the sterol pattern of fungi is related to their resistance to potato glycoalkaloids and to their taxonomy. Fungal resistance to α-chaconine and possibly other glycoalkaloids is species dependent. α-Chaconine and caffeic acid show synergistic antifungal activity. The taxonomic classification and the sterol pattern play a role in fungal resistance to glycoalkaloids. Results improve the understanding of the antifungal mode of action of potato secondary metabolites, which is essential for their potential utilization as antifungal agents in nonfood systems. © 2016 The Society for Applied Microbiology.

  11. Application of potato (Solanum tuberosum plant wastes for the removal of methylene blue and malachite green dye from aqueous solution

    Directory of Open Access Journals (Sweden)

    Neha Gupta

    2016-09-01

    Full Text Available Dye pollutants from the textile, paper, and leather industries are important sources of environmental contamination. In the present study an agricultural waste from potato plant (potato stem powder, PSP and potato leaves powder, PLP was used as an adsorbent for removal of the methylene blue (MB and malachite green (MG dyes from aqueous solution. The adsorbent materials were characterized by scanning electron microscope (SEM and Fourier transform infrared (FTIR spectroscopy. Batch experiments were performed to investigate the effect of physico-chemical parameters, such as pHpzc, ionic strength, adsorbent dose, contact time, initial dyes concentration and temperature. The kinetics of adsorption was studied by applying the pseudo-first order, pseudo-second order and intraparticle diffusion models. The pseudo-second order model better represented the adsorption kinetics and the mechanism was controlled by surface adsorption and intraparticle diffusion. Equilibrium data were analyzed using Langmuir and Freundlich isotherm models. The thermodynamic parameters such as change in enthalpy (ΔH°, entropy (ΔS° and Gibb’s free energy (ΔG° of adsorption systems were also determined and evaluated.

  12. A recombination point is conserved in the mitochondrial genome of higher plant species and located downstream from the cox2 pseudogene in Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Susely F.S. Tada

    2006-01-01

    Full Text Available The potato (Solanum tuberosum L. mitochondrial cox3/sdh4/pseudo-cox2 gene cluster has previously been identified by heterologous hybridization using a Marchantia polymorpha sdh4 probe. In our present study we used Southern blotting using sdh4 and cox2 probes to show that the sdh4 and cox2 genes are clustered in the mitochondria of potato, soybean and pea. Northern blotting revealed cotranscription of sdh4 and cox2 in potato but not in cauliflower, indicating that these genes are not clustered in cauliflower. A putative recombination point was detected downstream of the cox2 pseudogene (pseudo-cox2 in potato mitochondrial DNA (mtDNA. This sequence corresponds to a 32 bp sequence which appears to be well-conserved and is adjacent to the terminals of some mitochondrial genes in Citrullus lanatus, Beta vulgaris and Arabidopsis thaliana and is probably involved in the genic rearrangements. It is possible the potato mtDNA pseudo-cox2 gene was generated by recombination during evolution in the same way as that of several other mitochondrial genes and remains as an inactive partial copy of the functional cox2 which was also detected in potato mtDNA.

  13. Rooting characteristics of Solanum chacoense and Solanum tuberosum in vitro

    Science.gov (United States)

    Increases in root biomass and length have been linked to increased plant nitrogen (N) accumulation; however it is difficult to measure these parameters in soil environments. In vitro methods may aid in elucidating potato-rooting characteristics in relation to N use efficiency (NUE) due to a high lev...

  14. Partial root zone drying (PRD) sustains yield of potatoes (Solanum tuberosum L.) at reduced water supply

    DEFF Research Database (Denmark)

    Shahnazari, Ali; Andersen, Mathias Neumann; Liu, Fulai

    2008-01-01

    Partial root zone drying (PRD) is a new water-saving irrigation strategy being tested in many crop species. Until now it has not been investigated in potatoes (Solanum tuberosum L.). A field experiment on sandy soil in Denmark was conducted under a mobile rainout shelter to study effects of two...... subsurface drip irrigation treatments ((1) Full Irrigation (FI) receiving 100% of evaporative demand; and (2) PRD receiving 70% water of FI) on potato yield, tuber size, leaf water relations and irrigation water use efficiency (IWUE). The PRD treatment was started just after the end of tuber initiation...... for two months during tuber bulking and maturing stage and was shifted from one side to the other side of the plants every 5-10 days when FI plants had used 20-25 mm. Compared to FI plants, stomatal conductance was generally lower in the PRD-treated plants, whereas leaf water potential tended to be lower...

  15. The inheritance of anthocyanin pigmentation in potato (Solanum tuberosum L.) and mapping of tuber skin colour loci using RFLPs.

    NARCIS (Netherlands)

    Eck, van H.J.; Jacobs, J.M.E.; Berg, van den P.M.M.M.; Stiekema, W.J.; Jacobsen, E.

    1994-01-01

    Two existing genetic models for anthocyanin pigmentation are compared: the genetic model as proposed by Lunden (1937, 1960, 1974) for tetraploid potato Solanum tuberosum group Tuberosum and the model by Dodds & Long (1955, 1956) for diploid cultivated Solanum species. By crossing well defined

  16. The nitrogen responsive transcriptome in potato (Solanum tuberosum L.) reveals significant gene regulatory motifs.

    Science.gov (United States)

    Gálvez, José Héctor; Tai, Helen H; Lagüe, Martin; Zebarth, Bernie J; Strömvik, Martina V

    2016-05-19

    Nitrogen (N) is the most important nutrient for the growth of potato (Solanum tuberosum L.). Foliar gene expression in potato plants with and without N supplementation at 180 kg N ha(-1) was compared at mid-season. Genes with consistent differences in foliar expression due to N supplementation over three cultivars and two developmental time points were examined. In total, thirty genes were found to be over-expressed and nine genes were found to be under-expressed with supplemented N. Functional relationships between over-expressed genes were found. The main metabolic pathway represented among differentially expressed genes was amino acid metabolism. The 1000 bp upstream flanking regions of the differentially expressed genes were analysed and nine overrepresented motifs were found using three motif discovery algorithms (Seeder, Weeder and MEME). These results point to coordinated gene regulation at the transcriptional level controlling steady state potato responses to N sufficiency.

  17. Effect of Salt Stress on Growth, Na+ Accumulation and Proline Metabolism in Potato (Solanum tuberosum) Cultivars

    NARCIS (Netherlands)

    Jaarsma, R.; Vries, R.S.M.; de Boer, A.H.

    2013-01-01

    Potato (Solanum tuberosum) is a major crop world-wide and the productivity of currently used cultivars is strongly reduced at high soil salt levels. We compared the response of six potato cultivars to increased root NaCl concentrations. Cuttings were grown hydroponically and treated with 0 mM, 60 mM

  18. Selection of reference genes for transcriptional analysis of edible tubers of potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Mariot, Roberta Fogliatto; Oliveira, De Luisa Abruzzi; Voorhuijzen, M.M.; Staats, Martijn; Hutten, R.C.B.; Dijk, Van J.P.; Kok, Esther; Frazzon, Jeverson

    2015-01-01

    Potato (Solanum tuberosum) yield has increased dramatically over the last 50 years and this has been achieved by a combination of improved agronomy and biotechnology efforts. Gene studies are taking place to improve new qualities and develop new cultivars. Reverse transcriptase quantitative

  19. A new index to assess nitrogen dynamics in potato (Solanum tuberosum L.) production systems of Bolivia

    Science.gov (United States)

    Bolivia is the poorest country in South America with over 80% of the rural population under the poverty line. Agricultural productivity is closely correlated with poverty levels across rural Bolivia. Potato (Solanum tuberosum L.) is one of the most important crops for food security in Bolivia and th...

  20. Involvement of potato (Solanum tuberosum L.) MKK6 in response to potato virus Y.

    Science.gov (United States)

    Lazar, Ana; Coll, Anna; Dobnik, David; Baebler, Spela; Bedina-Zavec, Apolonija; Zel, Jana; Gruden, Kristina

    2014-01-01

    Mitogen-activated protein kinase (MAPK) cascades have crucial roles in the regulation of plant development and in plant responses to stress. Plant recognition of pathogen-associated molecular patterns or pathogen-derived effector proteins has been shown to trigger activation of several MAPKs. This then controls defence responses, including synthesis and/or signalling of defence hormones and activation of defence related genes. The MAPK cascade genes are highly complex and interconnected, and thus the precise signalling mechanisms in specific plant-pathogen interactions are still not known. Here we investigated the MAPK signalling network involved in immune responses of potato (Solanum tuberosum L.) to Potato virus Y, an important potato pathogen worldwide. Sequence analysis was performed to identify the complete MAPK kinase (MKK) family in potato, and to identify those regulated in the hypersensitive resistance response to Potato virus Y infection. Arabidopsis has 10 MKK family members, of which we identified five in potato and tomato (Solanum lycopersicum L.), and eight in Nicotiana benthamiana. Among these, StMKK6 is the most strongly regulated gene in response to Potato virus Y. The salicylic acid treatment revealed that StMKK6 is regulated by the hormone that is in agreement with the salicylic acid-regulated domains found in the StMKK6 promoter. The involvement of StMKK6 in potato defence response was confirmed by localisation studies, where StMKK6 accumulated strongly only in Potato-virus-Y-infected plants, and predominantly in the cell nucleus. Using a yeast two-hybrid method, we identified three StMKK6 targets downstream in the MAPK cascade: StMAPK4_2, StMAPK6 and StMAPK13. These data together provide further insight into the StMKK6 signalling module and its involvement in plant defence.

  1. The role of the potato (Solanum tuberosum) CCD8 gene in stolon and tuber development.

    Science.gov (United States)

    Pasare, Stefania A; Ducreux, Laurence J M; Morris, Wayne L; Campbell, Raymond; Sharma, Sanjeev K; Roumeliotis, Efstathios; Kohlen, Wouter; van der Krol, Sander; Bramley, Peter M; Roberts, Alison G; Fraser, Paul D; Taylor, Mark A

    2013-06-01

    · Strigolactones (SLs) are a class of phytohormones controlling shoot branching. In potato (Solanum tuberosum), tubers develop from underground stolons, diageotropic stems which originate from basal stem nodes. As the degree of stolon branching influences the number and size distribution of tubers, it was considered timely to investigate the effects of SL production on potato development and tuber life cycle. · Transgenic potato plants were generated in which the CAROTENOID CLEAVAGE DIOXYGENASE8 (CCD8) gene, key in the SL biosynthetic pathway, was silenced by RNA interference (RNAi). · The resulting CCD8-RNAi potato plants showed significantly more lateral and main branches than control plants, reduced stolon formation, together with a dwarfing phenotype and a lack of flowering in the most severely affected lines. New tubers were formed from sessile buds of the mother tubers. The apical buds of newly formed transgenic tubers grew out as shoots when exposed to light. In addition, we found that CCD8 transcript levels were rapidly downregulated in tuber buds by the application of sprout-inducing treatments. · These results suggest that SLs could have an effect, solely or in combination with other phytohormones, in the morphology of potato plants and also in controlling stolon development and maintaining tuber dormancy. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  2. Robust regeneration protocol for the Agrobacterium tumefaciens mediated transformation of Solanum tuberosum

    International Nuclear Information System (INIS)

    Abbasi, A.; Bilal, M.; Hussain, J.; Shah, M. M.; Hassan, A.

    2016-01-01

    Plant genetic transformation requires robust regeneration system. Plant growth regulators (PGRs) such as cytokinins (CKs) play a pivotal role in organogenesis; however, CKs are the most expensive PGRs. In the current study, an efficient yet economical protocol for regeneration of potato plant was developed. Stem inter-nodal and leaf explants were cultured on different regeneration media supplemented with varying concentration of different CKs such as kinetin and zeatin. Murashige- Skoog media added with zeatin (1, 1.5 mg/L) was designated as RZ1, RZ1.5, respectively or kinetin (1.5, 2 mg/L) was designated as RK1.5 and RK2, respectively, however, concentrations of other hormones such as NAA (1-Naphthaleneacetic acid) and GA3 (Gibberellic acid A3) were kept same. RZ1 and RZ1.5 gave significantly better Results as compared to RK-type media in all aspects studied such as callus initiation, days to first shoot emergence, number of shoots per explants. RZ1 medium was then selected as regeneration media for Agrobacterium-mediated transformation of potato plants with cyanobacterial phosphoenol pyruvate carboxylase gene, which provided multiple putative transformants on selection media. The transformants were further confirmed through PCR. The current protocol is found to be cost effective and efficient for the regeneration of Solanum tuberosum and can be successfully implied for the Agrobacterium-mediated transformation. (author)

  3. Ultrastructural and physiological responses of potato (Solanum tuberosum L.) plantlets to gradient saline stress

    Science.gov (United States)

    Gao, Hui-Juan; Yang, Hong-Yu; Bai, Jiang-Ping; Liang, Xin-Yue; Lou, Yan; Zhang, Jun-Lian; Wang, Di; Zhang, Jin-Lin; Niu, Shu-Qi; Chen, Ying-Long

    2015-01-01

    Salinity is one of the major abiotic stresses that impacts plant growth and reduces the productivity of field crops. Compared to field plants, test tube plantlets offer a direct and fast approach to investigate the mechanism of salt tolerance. Here we examined the ultrastructural and physiological responses of potato (Solanum tuberosum L. c.v. “Longshu No. 3”) plantlets to gradient saline stress (0, 25, 50, 100, and 200 mM NaCl) with two consequent observations (2 and 6 weeks, respectively). The results showed that, with the increase of external NaCl concentration and the duration of treatments, (1) the number of chloroplasts and cell intercellular spaces markedly decreased, (2) cell walls were thickened and even ruptured, (3) mesophyll cells and chloroplasts were gradually damaged to a complete disorganization containing more starch, (4) leaf Na and Cl contents increased while leaf K content decreased, (5) leaf proline content and the activities of catalase (CAT) and superoxide dismutase (SOD) increased significantly, and (6) leaf malondialdehyde (MDA) content increased significantly and stomatal area and chlorophyll content decline were also detected. Severe salt stress (200 mM NaCl) inhibited plantlet growth. These results indicated that potato plantlets adapt to salt stress to some extent through accumulating osmoprotectants, such as proline, increasing the activities of antioxidant enzymes, such as CAT and SOD. The outcomes of this study provide ultrastructural and physiological insights into characterizing potential damages induced by salt stress for selecting salt-tolerant potato cultivars. PMID:25628634

  4. Radiation hormesis in potatoes (Solanum tuberosum L.) part 1: Laboratory research

    International Nuclear Information System (INIS)

    Wiendl, F.M.; Arthur, V.; Wiendl, J.A.

    1995-01-01

    This paper describes the results of irradiation of potato (Solanum tuberosum L.) tubers of two varieties. Bintje and Baraka, with gamma radiations of Cobalt-60 at a dose of: 0.0. 2.5. 5.0 and 7.5 Gy, at the dose rate of 150 Gy per hour. Twenty eight potatoes of each variety were irradiated with each dose. Half of these potatoes were planted individually into aluminium cages of about 15 X 10 X 3 cm, using circa 120 ml of vermiculite in each cage, immediately after radiation. After seven days the rest of the potatoes was planted under the same conditions. The whole experiment was conducted into a chamber under dark conditions and temperature between 23 and 27 centigrade. Almost every two or three days each potato received circa 50 ml of plain water. After 143 to 154 days of irradiation the experiment was finished, and the following parameter were determined. Weight of potatoes without sprouts or roots; number of the eyes on which occurred sprouting; length of the longest sprout of its respective eye; humid weight of the sprouts; dry weight of the sprouts; humid weight of the roots; dry weight of the roots. (author). 19 refs, 2 tabs

  5. Purification and Partial Characterization of Potato (Solanum tuberosum) Invertase and Its Endogenous Proteinaceous Inhibitor

    Science.gov (United States)

    Bracho, Geracimo E.; Whitaker, John R.

    1990-01-01

    Invertase plays an important role in the hydrolysis of sucrose in higher plants, especially in the storage organs. In potato (Solanum tuberosum) tubers, and in some other plant tissues, the enzyme seems to be controlled by interaction with an endogenous proteinaceous inhibitor. An acid invertase from potato tubers (variety russet) was purified 1560-fold to electrophoretic homogeneity by consecutive use of concanvalin A-Sepharose 4B affinity chromatography, DEAE-Sephadex A-50-120 chromatography, Sephadex G-150 chromatography, and DEAE-Sephadex A-50-120 chromatography. The enzyme contained 10.9% carbohydrate, had an apparent molecular weight of 60,000 by gel filtration, and was composed of two identical molecular weight subunits (Mr 30,000). The enzyme had a Km for sucrose of 16 millimolar at pH 4.70 and was most stable and had maximum activity around pH 5. The endogenous inhibitor was purified 610-fold to homogeneity by consecutive treatment at pH 1 to 1.5 at 37°C for 1 hour, (NH4)2SO4 fractionation, Sephadex G-100 chromatography, DEAE-Sephadex G-50-120 chromatography, and hydroxylapatite chromatography. The inhibitor appears to be a single polypeptide (Mr 17,000) without glyco groups. The purified inhibitor was stable over the pH range of 2 to 7 when incubated at 37°C for 1 hour. Images Figure 2 PMID:16667287

  6. Ultrastructural and physiological responses of potato (Solanum tuberosum L. plantlets to gradient saline stress

    Directory of Open Access Journals (Sweden)

    Hui-Juan eGao

    2015-01-01

    Full Text Available Salinity is one of the major abiotic stresses that impacts plant growth and reduces the productivity of field crops. Compared to field plants, test tube plantlets offer a direct and fast approach to investigate the mechanism of salt tolerance. Here we examined the ultrastructural and physiological responses of potato (Solanum tuberosum L. c.v. ‘Longshu No. 3’ plantlets to gradient saline stress (0, 25, 50, 100 and 200 mM NaCl with two consequent observations (two and six weeks, respectively. The results showed that, with the increase of external NaCl concentration and the duration of treatments, (1 the number of chloroplasts and cell intercellular spaces markedly decreased, (2 cell walls were thickened and even ruptured, (3 mesophyll cells and chloroplasts were gradually damaged to a complete disorganization containing more starch, (4 leaf Na and Cl contents increased while leaf K content decreased, (5 leaf proline content and the activities of catalase (CAT and superoxide dismutase (SOD increased significantly, and (6 leaf malondialdehyde (MDA content increased significantly and stomatal area and chlorophyll content decline were also detected. Severe salt stress (200 mM NaCl inhibited plantlet growth. These results indicated that potato plantlets adapt to salt stress to some extent through accumulating osmoprotectants, such as proline, increasing the activities of antioxidant enzymes, such as CAT and SOD. The outcomes of this study provide ultrastructural and physiological insights into characterizing potential damages induced by salt stress for selecting salt-tolerant potato cultivars.

  7. Infra-red thermography for high throughput field phenotyping in Solanum tuberosum.

    Directory of Open Access Journals (Sweden)

    Ankush Prashar

    Full Text Available The rapid development of genomic technology has made high throughput genotyping widely accessible but the associated high throughput phenotyping is now the major limiting factor in genetic analysis of traits. This paper evaluates the use of thermal imaging for the high throughput field phenotyping of Solanum tuberosum for differences in stomatal behaviour. A large multi-replicated trial of a potato mapping population was used to investigate the consistency in genotypic rankings across different trials and across measurements made at different times of day and on different days. The results confirmed a high degree of consistency between the genotypic rankings based on relative canopy temperature on different occasions. Genotype discrimination was enhanced both through normalising data by expressing genotype temperatures as differences from image means and through the enhanced replication obtained by using overlapping images. A Monte Carlo simulation approach was used to confirm the magnitude of genotypic differences that it is possible to discriminate. The results showed a clear negative association between canopy temperature and final tuber yield for this population, when grown under ample moisture supply. We have therefore established infrared thermography as an easy, rapid and non-destructive screening method for evaluating large population trials for genetic analysis. We also envisage this approach as having great potential for evaluating plant response to stress under field conditions.

  8. Invasion of Solanum tuberosum L. by Aspergillus terreus: a microscopic and proteomics insight on pathogenicity.

    Science.gov (United States)

    Louis, Bengyella; Waikhom, Sayanika Devi; Roy, Pranab; Bhardwaj, Pardeep Kumar; Singh, Mohendro Wakambam; Chandradev, Sharma K; Talukdar, Narayan Chandra

    2014-06-10

    Aspergillus terreus is one of the most harmful filamentous fungal pathogen of humans, animals and plants. Recently, researchers have discovered that A. terreus can cause foliar blight disease in potato (Solanum tuberosum L.). We used light and scanning electron microscopy, and performed proteomics analysis in an attempt to dissect the invasion process of A. terreus in this important crop. Microscopic study revealed that invasion of leaf tissue is marked by rapid germination of A. terreus phialidic conidia (PC) by 4 h after inoculation. By 8 h after inoculation, primary germ tubes from PC differentiated into irregular protuberance, often displayed stomata atropism, and failed to penetrate via the epidermal cells. Colonization of leaf tissues was associated with high rate of production of accessory conidia (AC). These analyses showed the occurrence of a unique opposing pattern of AC, tissue-specific and produced on melanized colonizing hyphae during the infection of leaf tissue. A significant proteome change hallmarked by differential expression of class I patatin, lipoxygenase, catalase-peroxidase complex, and cysteine proteinase inhibitor were observed during tuber colonization. These proteins are often involved in signal transduction pathways and crosstalk in pathogenic responses. A. terreus abundantly produced AC and multipolar germinating PC to invade potato leaf tissue. Additionally, A. terreus differentially induced enzymes in potato tuber during colonization which facilitates rapid disease development.

  9. Isolation and characterization of StERF transcription factor genes from potato (Solanum tuberosum L.).

    Science.gov (United States)

    Wang, Zemin; Zhang, Ning; Zhou, Xiangyan; Fan, Qiang; Si, Huaijun; Wang, Di

    2015-04-01

    Ethylene response factor (ERF) is a major subfamily of the AP2/ERF family and plays significant roles in the regulation of abiotic- and biotic-stress responses. ERF proteins can interact with the GCC-box cis-element and then initiate a transcriptional cascade activating downstream ethylene response and enhancing plant stress tolerance. In this research, we cloned five StERF genes from potato (Solanum tuberosum L.). The expressional analysis of StERF genes revealed that they showed tissue- or organ-specific expression patterns and the expression levels in leaf, stem, root, flower, and tuber were different. The assays of quantitative real-time polymerase chain reaction (qRT-PCR) and the reverse transcription-PCR (RT-PCR) showed that the expression of five StERF genes was regulated by ethephon, methyl jasmonate (MeJA), salt and drought stress. The result from the yeast one-hybrid experiment showed that five StERFs had trans-activation activity and could specifically bind to the GCC-box cis-elements. The StERFs responded to abiotic factors and hormones suggested that they possibly had diverse roles in stress and hormone regulation of potato. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  10. [Polymorphism of KPI-A genes from plants of the subgenus Potatoe (sect. Petota, Estolonifera and Lycopersicum) and subgenus Solanum].

    Science.gov (United States)

    Krinitsyna, A A; Mel'nikova, N V; Belenikin, M S; Poltronieri, P; Santino, A; Kudriavtseva, A V; Savilova, A M; Speranskaia, A S

    2013-01-01

    Kunitz-type proteinase inhibitor proteins of group A (KPI-A) are involved in the protection of potato plants from pathogens and pests. Although sequences of large number of the KPI-A genes from different species of cultivated potato (Solanum tuberosum subsp. tuberosum) and a few genes from tomato (Solanum lycopersicum) are known to date, information about the allelic diversity of these genes in other species of the genus Solanum is lacking. In our work, the consensus sequences of the KPI-A genes were established in two species of subgenus Potatoe sect. Petota (Solanum tuberosum subsp. andigenum--5 genes and Solanum stoloniferum--2 genes) and in the subgenus Solanum (Solanum nigrum--5 genes) by amplification, cloning, sequencing and subsequent analysis. The determined sequences of KPI-A genes were 97-100% identical to known sequences of the cultivated potato of sect. Petota (cultivated potato Solanum tuberosum subsp. tuberosum) and sect. Etuberosum (S. palustre). The interspecific variability of these genes did not exceed the intraspecific variability for all studied species except Solanum lycopersicum. The distribution of highly variable and conserved sequences in the mature protein-encoding regions was uniform for all investigated KPI-A genes. However, our attempts to amplify the homologous genes using the same primers and the genomes of Solanum dulcamarum, Solanum lycopersicum and Mandragora officinarum resulted in no product formation. Phylogenetic analysis of KPI-A diversity showed that the sequences of the S. lycopersicum form independent cluster, whereas KPI-A of S. nigrum and species of sect. Etuberosum and sect. Petota are closely related and do not form species-specific subclasters. Although Solanum nigrum is resistant to all known races of economically one of the most important diseases of solanaceous plants oomycete Phytophthora infestans aminoacid sequences encoding by KPI-A genes from its genome have nearly or absolutely no differences to the same from

  11. Transfer of U, Al and Mn in the water–soil–plant (Solanum tuberosum L.) system near a former uranium mining area (Cunha Baixa, Portugal) and implications to human health

    International Nuclear Information System (INIS)

    Neves, M.O.; Figueiredo, V.R.; Abreu, M.M.

    2012-01-01

    Knowledge about metals in crops, grown in contaminated soils around mine sites, is limited and concerns about exposure to hazardous elements through the consumption of contaminated foodstuff, are high. In this study a field experiment was carried out in two agricultural soils located near a former uranium mine area (Cunha Baixa, Portugal). The purpose of the study was to assess the effect of irrigation water quality on soil–potato (Solanum tuberosum L.) crop system and to evaluate if the consumption of the crop represents health risk to the local villagers. The soils were divided in two plots: one irrigated with contaminated water (U: 1.03–1.04 mg/L; Al: 7.5–8.00 mg/L; Mn: 4.52 mg/L) and the other with uncontaminated water (U: 14–10 μg/L; Al: 17–23 μg/L; Mn: 2.4–5.7 μg/L). After irrigation and potato growth, only soil characteristics, as salinity and total U and Mn concentrations were significantly different from those measured at the beginning of the experiment. Within the potato plants, elements were mostly translocated and concentrated in the aerial part: stems and leaves (U: 73–87%; Al: 85–96%; Mn: 85–94%), which minimize the risk of contamination of the edible tissue. In potato tubers, the highest average concentrations (121–590 μg U/kg; 25–64 mg Al/kg; 12–13 mg Mn/kg dry weight) were registered at soil plots irrigated with contaminated water. Uranium and Al were mostly concentrated in the potato peel (88–96 and 76–85%, respectively), and Mn (67–78%) in the pulp, which reinforces the importance of removing peel to minimize human exposure. The risk analysis calculated for non-cancer health effects (hazard quotient), related only to the exposure through the consumption of this basic foodstuff, revealed safety for Cunha Baixa village residents (adults and children) even when potato crop was grown on U enriched soils and irrigated with contaminated water. - Highlights: ► Field experiment with potato in agricultural soils near a

  12. Transfer of U, Al and Mn in the water-soil-plant (Solanum tuberosum L.) system near a former uranium mining area (Cunha Baixa, Portugal) and implications to human health

    Energy Technology Data Exchange (ETDEWEB)

    Neves, M.O., E-mail: orquidia.neves@ist.utl.pt [Centro de Petrologia e Geoquimica, Instituto Superior Tecnico, Universidade Tecnica de Lisboa (TULisbon), Av. Rovisco Pais 1049-001 Lisboa (Portugal); Figueiredo, V.R., E-mail: vera.figueiredo@ist.utl.pt [Instituto Superior Tecnico, Universidade Tecnica de Lisboa (TULisbon), Av. Rovisco Pais 1049-001 Lisboa (Portugal); Abreu, M.M., E-mail: manuelaabreu@isa.utl.pt [Unidade de Investigacao de Quimica Ambiental, Instituto Superior de Agronomia, Universidade Tecnica de Lisboa (TULisbon), Tapada da Ajuda, 1349-017 Lisboa (Portugal)

    2012-02-01

    Knowledge about metals in crops, grown in contaminated soils around mine sites, is limited and concerns about exposure to hazardous elements through the consumption of contaminated foodstuff, are high. In this study a field experiment was carried out in two agricultural soils located near a former uranium mine area (Cunha Baixa, Portugal). The purpose of the study was to assess the effect of irrigation water quality on soil-potato (Solanum tuberosum L.) crop system and to evaluate if the consumption of the crop represents health risk to the local villagers. The soils were divided in two plots: one irrigated with contaminated water (U: 1.03-1.04 mg/L; Al: 7.5-8.00 mg/L; Mn: 4.52 mg/L) and the other with uncontaminated water (U: 14-10 {mu}g/L; Al: 17-23 {mu}g/L; Mn: 2.4-5.7 {mu}g/L). After irrigation and potato growth, only soil characteristics, as salinity and total U and Mn concentrations were significantly different from those measured at the beginning of the experiment. Within the potato plants, elements were mostly translocated and concentrated in the aerial part: stems and leaves (U: 73-87%; Al: 85-96%; Mn: 85-94%), which minimize the risk of contamination of the edible tissue. In potato tubers, the highest average concentrations (121-590 {mu}g U/kg; 25-64 mg Al/kg; 12-13 mg Mn/kg dry weight) were registered at soil plots irrigated with contaminated water. Uranium and Al were mostly concentrated in the potato peel (88-96 and 76-85%, respectively), and Mn (67-78%) in the pulp, which reinforces the importance of removing peel to minimize human exposure. The risk analysis calculated for non-cancer health effects (hazard quotient), related only to the exposure through the consumption of this basic foodstuff, revealed safety for Cunha Baixa village residents (adults and children) even when potato crop was grown on U enriched soils and irrigated with contaminated water. - Highlights: Black-Right-Pointing-Pointer Field experiment with potato in agricultural soils near

  13. Application time of nitrogen fertilizer 15N by a potato crop (Solanum Tuberosum L.)

    International Nuclear Information System (INIS)

    Bastidas, O.G.; Urquiaga, S.

    1987-01-01

    This study was performed at the ''San Jorge'' experimental farm of the Instituto Colombiano Agropecuario (ICA), Bogota, Colombia. The study was performed to investigate the effect of timing of application of nitrogen fertilizer on the productivity of, and the efficiency of utilization of 15 N-labelled fertilizer by, a potato crop (Solanum tuberosum L.), cv. Tequendama. The crop was fertilized with 100, 200 and 100 Kg/ha -1 of N, P 2 O 5 and K 2 O respectively. The N fertilizers were either added as 15 N labelled urea (2.955 at.% 15 N excess) or as labelled ammonium sulphate (2.071 at.% 15 N excess). In all treatments with nitrogen, a total of 100 Kg N ha -1 was added, but the nitrogen was added either in two or three split doses (only one dose being labelled with 15 N) at the following times: at planting, 35 days after emergence (DAE) and/or 60 DAE. It was found that: a) Nitrogen fertilization increased tuber production from 24 to 43 t/ha -1 ; b) The tubers constituted approximately 80% of total plant dry matter and 70% of the total nitrogen and fertilizer N accumulated by the plant; c) The fertilizer use efficiency varied between 49 and 68%, and the highest efficiency occurred when the nitrogen was split in three doses; d) The urea and ammonium sulphate gave similar results in all parameters evaluated; e) When the total nitrogen difference method was applied to interpretation of the results the fertilizer use efficiency was overestimated by 15 to 30%

  14. Effect of bacterial inoculation, plant genotype and developmental stage on root-associated and endophytic bacterial communities in potato (Solanum tuberosum)

    NARCIS (Netherlands)

    Andreote, F.D.; Rocha, da U.N.; Araujo, W.L.; Azevedo, J.L.; Overbeek, van L.S.

    2010-01-01

    Beneficial bacteria interact with plants by colonizing the rhizosphere and roots followed by further spread through the inner tissues, resulting in endophytic colonization. The major factors contributing to these interactions are not always well understood for most bacterial and plant species. It is

  15. Studies regarding the effects of Rosmarinus officinalis oil treatments in healthy and potato virus Y (PVY infected plants Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Carmen Liliana BĂDĂRĂU

    2010-11-01

    Full Text Available The potato virus Y cause loss in yield and quality of tubers. Hydrogen peroxide, ascorbic acid and antioxidants such as rosmarinic acid present in oils extracted from Rosmarinus officinalis plants are implicated in signaling against stress. The effects of these chemicals on tuber yield and pigments content were evaluated in plants testing positive after virus mechanical infection. Without chemical treatment, positive plants showed significant reductions in leaf pigments content and tuber weights compared to uninfected controls. Hydrogen peroxide, ascorbic acid and oil treatments of PVY infected plants significantly reduced the number of minitubers, enhancing their weights, while leaf pigment content also increased. This research demonstrates potential benefits of treatments with oils extracted from Rosmarinus officinalis plants and hydrogen peroxide or ascorbic acid in enhancing the yield and quality of tubers.

  16. Detection and sequencing of Potato virus Y (PVY and Potato leafroll virus (PLRV in a volunteer plant of Solanum tuberosum L. cv. Diacol-Capiro

    Directory of Open Access Journals (Sweden)

    Héctor Camilo Medina Cárdenas

    2017-10-01

    Full Text Available Viral diseases are among the most limiting factors in the production of potato in Colombia and the rest of the world. The best strategy to control plant viruses consists on the use of certified seed tubers, control of arthropod vectors and the use of adequate crop management practices that reduce mechanical transmission and the presence of viral reservoirs like weeds and volun-teer plants. However, the successful implementation of these practices relies on the availability of highly sensitive techniques that allow for the asymptomatic detection of viruses. In this work, we tested the performance of Next-generation sequencing (NGS and real time RT-PCR (RT-qPCR on a single volunteer potato plant (cv. Diacol-Capiro growing naturally in a seed-tuber storage facility in Yarumal (Antioquia. Our NGS results demonstrate a mixed infection with Potato virus Y (PVY and Potato leafroll virus (PLRV. RT-qPCR was performed in roots, main stolons, crown (root collar and upper, middle and lower leaves using specific primers for PVY, PLRV, Potato virus S (PVS, Potato virus V (PVV, Potato virus X (PVX and Potato yellow vein virus (PYVV. Only PVY and PLRV were detected in good agreement with the NGS data. This work demonstrates the use-fulness of both techniques for supporting integrated management of plant viruses in potato, in-cluding virus detection in natural reservoirs such as volunteer plants and weeds.

  17. Expression of an isoflavone reductase-like gene enhanced by pollen tube growth in pistils of Solanum tuberosum.

    Science.gov (United States)

    van Eldik, G J; Ruiter, R K; Colla, P H; van Herpen, M M; Schrauwen, J A; Wullems, G J

    1997-03-01

    Successful sexual reproduction relies on gene products delivered by the pistil to create an environment suitable for pollen tube growth. These compounds are either produced before pollination or formed during the interactions between pistil and pollen tubes. Here we describe the pollination-enhanced expression of the cp100 gene in pistils of Solanum tuberosum. Temporal analysis of gene expression revealed an enhanced expression already one hour after pollination and lasts more than 72 h. Increase in expression also occurred after touching the stigma and was not restricted to the site of touch but spread into the style. The predicted CP100 protein shows similarity to leguminous isoflavone reductases (IFRs), but belongs to a family of IFR-like NAD(P)H-dependent oxidoreductases present in various plant species.

  18. Genome-wide analysis and expression profiling of the ERF transcription factor family in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Charfeddine, Mariam; Saïdi, Mohamed Najib; Charfeddine, Safa; Hammami, Asma; Gargouri Bouzid, Radhia

    2015-04-01

    The ERF transcription factors belong to the AP2/ERF superfamily, one of the largest transcription factor families in plants. They play important roles in plant development processes, as well as in the response to biotic, abiotic, and hormone signaling. In the present study, 155 putative ERF transcription factor genes were identified from the potato (Solanum tuberosum) genome database, and compared with those from Arabidopsis thaliana. The StERF proteins are divided into ten phylogenetic groups. Expression analyses of five StERFs were carried out by semi-quantitative RT-PCR and compared with published RNA-seq data. These latter analyses were used to distinguish tissue-specific, biotic, and abiotic stress genes as well as hormone-responsive StERF genes. The results are of interest to better understand the role of the AP2/ERF genes in response to diverse types of stress in potatoes. A comprehensive analysis of the physiological functions and biological roles of the ERF family genes in S. tuberosum is required to understand crop stress tolerance mechanisms.

  19. Híbridos somáticos obtenidos por fusión de protoplastos entre Solanum tuberosum L. subsp. tuberosum y la especie silvestre Solanum circaeifolium Bitter

    Directory of Open Access Journals (Sweden)

    Rosa Espejo

    2013-03-01

    Full Text Available Con la finalidad de obtener híbridos somáticos interespecíficos, se fusionaron protoplastos de la especie tetraploide Solanum tuberosum y de la especie silvestre diploide Solanum circaeifolium utilizando polietilenglicol. Los productos de fusión fueron cultivados en el medio V-KM suplementado con albúmina de suero bovino. Las primeras divisiones celulares ocurrieron a los 3 a 4 días de cultivo. Después de la formación de colonias se observó una rápida proliferación de callos, a partir de los cuales se regeneraron 19 plantas. El análisis molecular usando RAPD, confirmó que los regenerantes presentaban segmentos de ADN de ambos parentales, sugiriendo su posible naturaleza de híbridos somáticos. Las observaciones del número de cromosomas indicaron que todos los híbridos fueron aneuploides. En condiciones de invernadero, los regenerantes derivados de la fusión de protoplastos, mostraron características morfológicas intermedias entre las líneas parentales. Este estudio muestra la producción de híbridos somáticos de papa con el método de fusión presentado.

  20. Partitioning of photoassimilates by potato plants (Solanum tuberosum L.) as influenced by irradiance. II. Partitioning patterns by four clones grown under high and low irradiance

    International Nuclear Information System (INIS)

    Gawronska, H.; Dwelle, R.B.; Pavek, J.J.

    1990-01-01

    This paper is the second in a three-part series describing the influence of varied irradiance on growth and photoassimilate partitioning by potato plants. Four clones (Russet Burbank, Lemhi Russet, A66107-51, and A6948-4) were grown under two light regimes: a) high light levels (HL) of 500 to 1200 μE m -2 s -1 , varying with changes in natural sunlight and time of day, and b) low light levels (LL) at approximately one quarter of high light (21 to 28%). Three weeks after tuber initiation, the most recently-matured leaf was labelled with 14 CO 2 , and plants were harvested: 1) one day after labelling, and 2) two weeks after labelling. Plants of all clones responded to the low light levels in a similar way by: 1) changing some morphological characteristics, 2) decreasing biomass accumulation and tuber yield, and 3) changing the sink-source relationship by promoting growth of leaves and stems at the expense of tubers. However, there were evident clonal differences in reactions to growth under low light; e.g., Lemhi Russet appeared to be most sensitive to light stress, while clones A66107-51 and A6848-4 were much less sensitive. No matter what the prior light history (HL or LL), clone A6948-4 was able to maintain higher rates of photosynthesis than the other clones at all light levels between 200 and 1200 μE m -2 s -1 . This study showed that the potential exists to breed for cuttivars that can maintain higher rates of photosynthesis and higher tuber yield under low light levels. (author)

  1. Host Status of Different Potato (Solanum tuberosum) Varieties and Hatching in Root Diffusates of Globodera ellingtonae.

    Science.gov (United States)

    Zasada, Inga A; Peetz, Amy; Wade, Nadine; Navarre, Roy A; Ingham, Russ E

    2013-09-01

    Globodera ellingtonae was detected in Oregon in 2008. In order to make decisions regarding the regulation of this nematode, knowledge of its biology is required. We determined the host status of a diversity of potato (Solanum tuberosum) varieties in soil-based experiments and identified hatching stimulants in in vitro hatching assays. 'Russet Burbank,' 'Desiree,' 'Modac,' 'Norland,' 'Umatilla,' and 'Yukon Gold' were good hosts (RF > 14) for G. ellingtonae. Potato varieties 'Maris Piper,' 'Atlantic,' and 'Satina,' all which contain the Ro1 gene that confers resistance to G. rostochiensis, were not hosts for G. ellingtonae. In in vitro hatching assays, G. ellingtonae hatched readily in the presence of diffusates from potato (PRD) and tomato (Solanum lycopersicum; TRD). Egg hatch occurred in an average of between 87% and 90% of exposed cysts, with an average of between 144 and 164 juveniles emerging per cyst, from PRD- and TRD-treated cysts, respectively. This nematode hatched rapidly in the presence of PRD and TRD, with at least 66% of total hatch occurring by day 3 of exposure. There was no dose-response of egg hatch to concentrations of PRD or TRD ranging from 1:5 to 1:100 diffusate to water. When G. ellingtonae was exposed to root diffusates from 21 different plants, hatch occurred in 0% to 70% of exposed cysts, with an average of between 0 to 27 juveniles emerging per cyst. When root diffusate-exposed cysts were subsequently transferred to PRD to test viability, root diffusates from arugula (Eruca sativa), sudangrass (Sorghum bicolor subsp. drummondii), and common vetch (Vicia sativa) continued to inhibit egg hatch compared with the other root diffusates or water in which hatch occurred readily (60 to 182 juveniles emerging per cyst). Previously known hatching stimulants of G. rostochiensis and G. pallida, sodium metavanadate, sodium orthovanadate, and sodium thiocyanate, stimulated some egg hatch. Although, Globodera ellingtonae hatched readily in PRD and TRD

  2. Postharvest application of organic and inorganic salts to control potato (Solanum tuberosum L.) storage soft rot: plant tissue-salt physicochemical interactions.

    Science.gov (United States)

    Yaganza, E S; Tweddell, R J; Arul, J

    2014-09-24

    Soft rot caused by Pectobacterium sp. is a devastating disease affecting stored potato tubers, and there is a lack of effective means of controlling this disease. In this study, 21 organic and inorganic salts were tested for their ability to control soft rot in potato tubers. In the preventive treatment, significant control of soft rot was observed with AlCl3 (≥66%) and Na2S2O3 (≥57%) and to a lesser extent with Al lactate and Na benzoate (≥34%) and K sorbate and Na propionate (≥27%). However, only a moderate control was achieved by curative treatment with AlCl3 and Na2S2O3 (42%) and sodium benzoate (≥33%). Overall, the in vitro inhibitory activity of salts was attenuated in the presence of plant tissue (in vivo) to different degrees. The inhibitory action of the salts in the preventive treatment, whether effective or otherwise, showed an inverse linear relationship with water ionization capacity (pK') of the salt ions, whereas in the curative treatment, only the effective salts showed this inverse linear relationship. Salt-plant tissue interactions appear to play a central role in the attenuated inhibitory activity of salts in potato tuber through reduction in the availability of the inhibitory ions for salt-bacteria interactions. This study demonstrates that AlCl3, Na2S2O3, and Na benzoate have potential in controlling potato tuber soft rot and provides a general basis for understanding of specific salt-tissue interactions.

  3. Potato (Solanum tuberosum L.) tuber ageing induces changes in the proteome and antioxidants associated with the sprouting pattern

    NARCIS (Netherlands)

    Delaplace, P.; Fauconnier, M.L.; Sergeant, K.; Dierick, J.F.; Oufir, M.; Wal, van der F.; America, A.H.P.; Renaut, J.; Hausman, J.F.; Jardin, du P.

    2009-01-01

    During post-harvest storage, potato tubers age as they undergo an evolution of their physiological state influencing their sprouting pattern. In the present study, physiological and biochemical approaches were combined to provide new insights on potato (Solanum tuberosum L. cv. Desiree) tuber

  4. Spontaneous and induced loss of chromosomes in slow-growing somatic hybrid calli of Solanum tuberosum and Nicotiana plumbaginifolia

    NARCIS (Netherlands)

    Tempelaar, MJ; Drenth - Diephuis, L.J.; SAAT, TAWM; Jacobsen, E.

    Rate and extent of spontaneous and induced chromosome loss have been determined at the callus level of somatic hybrids of mutants of Solanum tuberosum and Nicotiana plumbaginifolia. AEC (amino ethyl cystein) resistance in potato and Nitrate-Reductase deficiency in N. plumbaginifolia have been used

  5. Development of a real-time PCR method for the differential detection and quantification of four solanaceae in GMO analysis: potato (Solanum tuberosum), tomato (Solanum lycopersicum), eggplant (Solanum melongena), and pepper (Capsicum annuum).

    Science.gov (United States)

    Chaouachi, Maher; El Malki, Redouane; Berard, Aurélie; Romaniuk, Marcel; Laval, Valérie; Brunel, Dominique; Bertheau, Yves

    2008-03-26

    The labeling of products containing genetically modified organisms (GMO) is linked to their quantification since a threshold for the presence of fortuitous GMOs in food has been established. This threshold is calculated from a combination of two absolute quantification values: one for the specific GMO target and the second for an endogenous reference gene specific to the taxon. Thus, the development of reliable methods to quantify GMOs using endogenous reference genes in complex matrixes such as food and feed is needed. Plant identification can be difficult in the case of closely related taxa, which moreover are subject to introgression events. Based on the homology of beta-fructosidase sequences obtained from public databases, two couples of consensus primers were designed for the detection, quantification, and differentiation of four Solanaceae: potato (Solanum tuberosum), tomato (Solanum lycopersicum), pepper (Capsicum annuum), and eggplant (Solanum melongena). Sequence variability was studied first using lines and cultivars (intraspecies sequence variability), then using taxa involved in gene introgressions, and finally, using taxonomically close taxa (interspecies sequence variability). This study allowed us to design four highly specific TaqMan-MGB probes. A duplex real time PCR assay was developed for simultaneous quantification of tomato and potato. For eggplant and pepper, only simplex real time PCR tests were developed. The results demonstrated the high specificity and sensitivity of the assays. We therefore conclude that beta-fructosidase can be used as an endogenous reference gene for GMO analysis.

  6. Expression of a Petunia inflata pectin methyl esterase in Solanum tuberosum L. enhances stem elongation and modifies cation distribution.

    Science.gov (United States)

    Pilling, J; Willmitzer, L; Fisahn, J

    2000-02-01

    Transgenic potato (Solanum tuberosum L.) plants were constructed with a Petunia inflata-derived cDNA encoding a pectin methyl esterase (PME; EC 3.1.1.11) in sense orientation under the control of the cauliflower mosaic virus 35S promoter. The PME activity was elevated in leaves and tubers of the transgenic lines but slightly reduced in apical segments of stems from mature plants. Stem segments from the base of juvenile PME-overexpressing plants did not differ in PME activity from the control, whereas in apical parts PME was less active than in the wild-type. During the early stages of development stems of these transgenic plants elongated more rapidly than those of the wild-type. Further evidence that overexpression of a plant-derived PME has an impact on plant development is based on modifications of tuber yield, which was reduced in the transgenic lines. Cell walls from transgenic tubers showed significant differences in their cation-binding properties in comparison with the wild-type. In particular, cell walls displayed increased affinity for sodium and calcium, while potassium binding was constant. Furthermore, the total ion content of transgenic potatoes was modified. Indications of PME-mediated differences in the distribution of ions in transgenic plants were also obtained by monitoring relaxations of the membrane potential of roots subsequent to changes in the ionic composition of the bathing solution. However, no effects on the chemical structure of pectin from tuber cell walls could be detected.

  7. Evaluation of genetic stability in cryopreserved Solanum tuberosum

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-18

    Aug 18, 2008 ... and subsequent high plant regeneration are the basic requirements. The main ... empty sterile Petri dish exposed to a sterile air flow. The alginate .... The`se doctorale de l'universite´ de Rennes 1, France. Fabre J, Derreude J ...

  8. Pectobacterium polaris sp. nov., isolated from potato (Solanum tuberosum).

    Science.gov (United States)

    Dees, Merete Wiken; Lysøe, Erik; Rossmann, Simeon; Perminow, Juliana; Brurberg, May Bente

    2017-12-01

    The genus Pectobacterium, which belongs to the bacterial family Enterobacteriaceae, contains numerous species that cause soft rot diseases in a wide range of plants. The species Pectobacterium carotovorum is highly heterogeneous, indicating a need for re-evaluation and a better classification of the species. PacBio was used for sequencing of two soft-rot-causing bacterial strains (NIBIO1006 T and NIBIO1392), initially identified as P. carotovorumstrains by fatty acid analysis and sequencing of three housekeeping genes (dnaX, icdA and mdh). Their taxonomic relationship to other Pectobacterium species was determined and the distance from any described species within the genus Pectobacterium was less than 94 % average nucleotide identity (ANI). Based on ANI, phylogenetic data and genome-to-genome distance, strains NIBIO1006 T , NIBIO1392 and NCPPB3395 are suggested to represent a novel species of the genus Pectobacterium, for which the name Pectobacterium polaris sp. nov. is proposed. The type strain is NIBIO1006 T (=DSM 105255 T =NCPPB 4611 T ).

  9. Brilliant Green Dye Elimination from Water Using Psidium guajava Leaves and Solanum tuberosum Peels as Adsorbents in Environmentally Benign Way

    Directory of Open Access Journals (Sweden)

    Rabia Rehman

    2015-01-01

    Full Text Available The aim of this study is to check the feasibility of Psidium guajava (Guava leaves and peels of Solanum tuberosum (Potato as biosorbents in removal of Brilliant Green (BG in batch mode. Surface analysis of biosorbents was done by FT-IR and quantitatively analyzed by Boehm titration. The removal of dye was confirmed by UV-VIS spectroscopy. Isothermal modeling was studied by using Langmuir, Freundlich, and Temkin isotherms. Various isothermal parameters for adsorption of Brilliant Green such as qm=1.075 mg/g, 1.173 mg/g ΔG°=-3.397, and −2.397 KJ/mol were noted for Solanum tuberosum peels (PP and Psidium guajava leaves (GL, respectively. Similarly pH, moisture content, and various metals were quantitatively analyzed. Results showed that leaves of Psidium guajava were more effective for removal of Brilliant Green.

  10. A cell wall-bound adenosine nucleosidase is involved in the salvage of extracellular ATP in Solanum tuberosum.

    Science.gov (United States)

    Riewe, David; Grosman, Lukasz; Fernie, Alisdair R; Zauber, Henrik; Wucke, Cornelia; Geigenberger, Peter

    2008-10-01

    Extracellular ATP (eATP) has recently been demonstrated to play a crucial role in plant development and growth. To investigate the fate of eATP within the apoplast, we used intact potato (Solanum tuberosum) tuber slices as an experimental system enabling access to the apoplast without interference of cytosolic contamination. (i) Incubation of intact tuber slices with ATP led to the formation of ADP, AMP, adenosine, adenine and ribose, indicating operation of apyrase, 5'-nucleotidase and nucleosidase. (ii) Measurement of apyrase, 5'-nucleotidase and nucleosidase activities in fractionated tuber tissue confirmed the apoplastic localization for apyrase and phosphatase in potato and led to the identification of a novel cell wall-bound adenosine nucleosidase activity. (iii) When intact tuber slices were incubated with saturating concentrations of adenosine, the conversion of adenosine into adenine was much higher than adenosine import into the cell, suggesting a potential bypass of adenosine import. Consistent with this, import of radiolabeled adenine into tuber slices was inhibited when ATP, ADP or AMP were added to the slices. (iv) In wild-type plants, apyrase and adenosine nucleosidase activities were found to be co-regulated, indicating functional linkage of these enzymes in a shared pathway. (v) Moreover, adenosine nucleosidase activity was reduced in transgenic lines with strongly reduced apoplastic apyrase activity. When taken together, these results suggest that a complete ATP salvage pathway is present in the apoplast of plant cells.

  11. Comparison between Proteome and Transcriptome Response in Potato (Solanum tuberosum L.) Leaves Following Potato Virus Y (PVY) Infection.

    Science.gov (United States)

    Stare, Tjaša; Stare, Katja; Weckwerth, Wolfram; Wienkoop, Stefanie; Gruden, Kristina

    2017-07-06

    Plant diseases caused by viral infection are affecting all major crops. Being an obligate intracellular organisms, chemical control of these pathogens is so far not applied in the field except to control the insect vectors of the viruses. Understanding of molecular responses of plant immunity is therefore economically important, guiding the enforcement of crop resistance. To disentangle complex regulatory mechanisms of the plant immune responses, understanding system as a whole is a must. However, integrating data from different molecular analysis (transcriptomics, proteomics, metabolomics, smallRNA regulation etc.) is not straightforward. We evaluated the response of potato ( Solanum tuberosum L.) following the infection with potato virus Y (PVY). The response has been analyzed on two molecular levels, with microarray transcriptome analysis and mass spectroscopy-based proteomics. Within this report, we performed detailed analysis of the results on both levels and compared two different approaches for analysis of proteomic data (spectral count versus MaxQuant). To link the data on different molecular levels, each protein was mapped to the corresponding potato transcript according to StNIB paralogue grouping. Only 33% of the proteins mapped to microarray probes in a one-to-one relation and additionally many showed discordance in detected levels of proteins with corresponding transcripts. We discussed functional importance of true biological differences between both levels and showed that the reason for the discordance between transcript and protein abundance lies partly in complexity and structure of biological regulation of proteome and transcriptome and partly in technical issues contributing to it.

  12. Preferential colonization of Solanum tuberosum L. roots by the fungus Glomus intraradices in arable soil of a potato farming area.

    Science.gov (United States)

    Cesaro, Patrizia; van Tuinen, Diederik; Copetta, Andrea; Chatagnier, Odile; Berta, Graziella; Gianinazzi, Silvio; Lingua, Guido

    2008-09-01

    The symbiosis between plant roots and arbuscular mycorrhizal (AM) fungi has been shown to affect both the diversity and productivity of agricultural communities. In this study, we characterized the AM fungal communities of Solanum tuberosum L. (potato) roots and of the bulk soil in two nearby areas of northern Italy, in order to verify if land use practices had selected any particular AM fungus with specificity to potato plants. The AM fungal large-subunit (LSU) rRNA genes were subjected to nested PCR, cloning, sequencing, and phylogenetic analyses. One hundred eighty-three LSU rRNA sequences were analyzed, and eight monophyletic ribotypes, belonging to Glomus groups A and B, were identified. AM fungal communities differed between bulk soil and potato roots, as one AM fungal ribotype, corresponding to Glomus intraradices, was much more frequent in potato roots than in soils (accounting for more than 90% of sequences from potato samples and less than 10% of sequences from soil samples). A semiquantitative heminested PCR with specific primers was used to confirm and quantify the AM fungal abundance observed by cloning. Overall results concerning the biodiversity of AM fungal communities in roots and in bulk soils from the two studied areas suggested that potato roots were preferentially colonized by one AM fungal species, G. intraradices.

  13. Effect of cadmium on the physiological parameters and the subcellular cadmium localization in the potato (Solanum tuberosum L.).

    Science.gov (United States)

    Xu, Dongyu; Chen, Zhifan; Sun, Ke; Yan, Dong; Kang, Mingjie; Zhao, Ye

    2013-11-01

    The pollution of agricultural soils with cadmium (Cd) has become a serious problem worldwide. The potato (Solanum tuberosum L.) was used to investigate how different concentrations of Cd (1, 5, and 25mgkg(-1)) affected the physiological parameters and the subcellular distribution of Cd in the potato. The analyses were conducted using scanning electron microscopy coupled with energy dispersive X-ray (SEM-EDX). The results suggest that the leaf is the organ with the highest accumulation of Cd. The malondialdehyde (MDA) content increased and the chlorophyll content decreased in response to high level of Cd. The SEM-EDX microanalysis revealed that Cd was primarily deposited in the spongy and palisade tissues of the leaf. Furthermore, Cd was also detected in the cortex and the adjacent phloem and was observed inside the intercellular space, the interior surface of the plasma membrane, and on the surface of the elliptical starch granules in the tubers of the potato. Although low concentrations of Cd migrated from the root to the tuber, the accumulation of Cd in the tuber exceeded the standard for food security. Therefore, the planting of potato plants in farmland containing Cd should be seriously evaluated because Cd-containing potatoes might present high health risk to humans. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. Natural co-infection of Solanum tuberosum crops by the Potato yellow vein virus and potyvirus in Colombia

    Directory of Open Access Journals (Sweden)

    Angela Villamil-Garzón

    2014-08-01

    Full Text Available The Potato yellow vein virus (PYVV, a Crinivirus with an RNA tripartite genome, is the causal agent of the potato yellow vein disease, reported in Colombian since 1950, with yield reductions of up to 50%. Co-infection of two or more viruses is common in nature and can be associated with differences in virus accumulation and symptom expression. No evidence of mixed infection between PYVV and other viruses has been reported. In this study, eight plants showing yellowing PYVV symptoms: four Solanum tuberosum Group Phureja (P and four Group Andigena (A, were collected in Cundinamarca, Colombia to detect mixed infection in the isolates using next generation sequencing (NGS. The Potato virus Y (PVY complete genome (similar to N strain and the Potato virus V (PVV partial genomes were detected using NGS and re-confirmed by RT-PCR. Preliminary field screening in a large sample showed that PYVV and PVY co-infect potato plants with a prevalence of 21% within the P group and 23% within the A group. This is the first report of co-infection of PYVV and potyvirus in Colombia and with the use of NGS. Considering that potyviruses enhance symptom severity and/or yield reductions in mixed infections, our results may be relevant for disease diagnosis, breeding programs and tuber certification.

  15. Expresión diferencial durante la interacción Solanum tuberosum - Phytophthora infestans

    Directory of Open Access Journals (Sweden)

    Zulma Isabel Monsalve-Fonnegra

    2012-01-01

    Full Text Available Título en ingles: Differential expression during Solanum tuberosum- Phytophthora infestans interaction Resumen: La papa (Solanum tuberosum L. es el cuarto cultivo más importante a nivel mundial y es el producto agrícola con mayor demanda de fungicidas, insecticidas y fertilizantes químicos. Las pérdidas mundiales ocasionadas por Phytophthora infestans (Mont. de Bary en este cultivo, ascienden a 6,7 billones de dólares al año y su control químico genera un aumento en los costos, perjudica la salud humana y el ambiente. Todo esto justifica la búsqueda constante de mecanismos alternativos para el control de la enfermedad, entre ellos la obtención de variedades resistentes mediante cisgenesis usando genotipos silvestres. Como un aporte en este sentido, y dada la falta de conocimiento de lo que controla y constituye la diferencia entre una respuesta compatible e incompatible, en el presente estudio se compararon los perfiles de expresión génica obtenidos mediante Despliegue Diferencial de variedades resistentes y susceptibles durante su interacción con P. infestans. Los resultados evidenciaron diferencias en la expresión génica, tanto a distintos tiempos post-inoculación como en el tipo de cambio de expresión, incluyendo la presencia y ausencia de bandas diferenciales y el aumento o disminución en su intensidad. Al analizar las secuencias de fragmentos diferencialmente expresados, se encontró que algunos fragmentos sobre-expresados en las variedades susceptibles, tenían homología con secuencias que codifican para una serina-acetiltranferasa y para la subunidad β de la RNA polimerasa. Por su parte, fragmentos sobre-expresados en la variedad resistente, tenían homología con una secuencia codificante para un dominio transmembranal. Palabras claves: pastusa suprema;  diacol-capiro; parda pastusa; despliegue diferencial Abstract: Potato (Solanum tuberosum L. is the fourth most important crop worldwide; also, is the agriculture

  16. Genetic analysis of somaclonal variants and induced mutants of potato ( solanum tuberosum l.) cv. diamant using RAPD markers

    International Nuclear Information System (INIS)

    Afrasiab, H.; Iqbal, J.

    2011-01-01

    The objective of this work was to genetically analyze somaclonal variants and gamma induced mutants of potato ( Solanum tuberosum L.) cv. Diamant using RAPD-PCR technique. In the present work, callus was induced from nodes, inter nodes and leaf explants in MS medium supplemented with NAA (1.0 mg/l) and BAP (0.5 mg/l) and plants were regenerated from 14-20 weeks old calli. For gamma irradiation, ten-week old well proliferating calli were exposed to doses ranging from 5-50 Gy. All the four selected somaclonal variants and five gamma induced mutants were differentiated by banding patterns obtained from 22 primers that generated 140 polymorphic bands. The presence of polymorphic bands in variants and mutants suggest that genetic variation occurred in all the treatments as compared to control. Similarity and clustered analysis were conducted using Jaccard's coefficients and the un-weighted pair-group method using arithmetic averages. The results summarized in a dendrogram, show genetic diversity among the variants and mutants. The study shows that RAPD markers were efficient in discriminating somaclonal variants and induced mutants of potato. (author)

  17. The Transcriptome of the Reference Potato Genome Solanum tuberosum Group Phureja Clone DM1-3 516R44

    Science.gov (United States)

    Massa, Alicia N.; Childs, Kevin L.; Lin, Haining; Bryan, Glenn J.; Giuliano, Giovanni; Buell, C. Robin

    2011-01-01

    Advances in molecular breeding in potato have been limited by its complex biological system, which includes vegetative propagation, autotetraploidy, and extreme heterozygosity. The availability of the potato genome and accompanying gene complement with corresponding gene structure, location, and functional annotation are powerful resources for understanding this complex plant and advancing molecular breeding efforts. Here, we report a reference for the potato transcriptome using 32 tissues and growth conditions from the doubled monoploid Solanum tuberosum Group Phureja clone DM1-3 516R44 for which a genome sequence is available. Analysis of greater than 550 million RNA-Seq reads permitted the detection and quantification of expression levels of over 22,000 genes. Hierarchical clustering and principal component analyses captured the biological variability that accounts for gene expression differences among tissues suggesting tissue-specific gene expression, and genes with tissue or condition restricted expression. Using gene co-expression network analysis, we identified 18 gene modules that represent tissue-specific transcriptional networks of major potato organs and developmental stages. This information provides a powerful resource for potato research as well as studies on other members of the Solanaceae family. PMID:22046362

  18. Inorganic phosphorus along with biofertilizers improves profitability and sustainability in soybean (Glycine max–potato (Solanum tuberosum cropping system

    Directory of Open Access Journals (Sweden)

    Sushmita Munda

    2018-04-01

    Full Text Available Present study was conducted to assess role of phosphorus (P fertilization on economics, energy efficiency, P use indices and soil P balance in soybean [Glycine max (L. Merril]–potato (Solanum tuberosum L. cropping system during 2008–09 and 2009–10. Treatments in soybean as main plots consisted of two sources and two levels of phosphorus with or without biofertilizers [phosphorus solubilizing bacteria, PSB and arbuscular mycorrhizae, AM]. Three levels of P were applied to potato as subplots. System productivity was calculated in terms of soybean equivalent yield and found to be better with biofertilizers treated plots. When applied in combination with biofertilizers, 50% recommended dose of P (RDP as diammonium phosphate (DAP recorded B:C ratio at par with 100% RDP. Direct application of 100% RDP to potato resulted in significantly higher returns, enhancing the net returns. Application of biofertilizers alone increased the energy use efficiency over no biofertilizer application. Irrespective of source (DAP or rock phosphate treatments with biofertilizers had improved P use indices and apparent soil P balance even at 50% RDP. This indicates the role of biofertilizers in P solubilization and making it available to plant. Biofertilizers application can help cutting down the fertilizer P application in soybean–potato cropping system without any considerable reduction in yield and economic returns. Keywords: AM, B:C ratio, P use indices, PSB, Rock phosphate, Agronomic use efficiency

  19. Physico-chemical and sensory evaluation of potato (Solanum tuberosum L. after irradiation

    Directory of Open Access Journals (Sweden)

    IVANESA G.M. SOARES

    2016-06-01

    Full Text Available ABSTRACT This work evaluated the effects of ionizing radiation on the physico-chemical and sensory characteristics of the potato cultivar Ágata (Solanum tuberosum L., including budding and deterioration, with the end goal of increasing shelf life. For this, four groups of samples were harvested at the maturation stage. Three of them were separately exposed to a Co-60 source, receiving respective doses of 0.10, 0.15 and 2.00 kGy, while the non-irradiated group was kept as a control. All samples were stored for 35 days at 24 °C (± 2 and at 39% relative humidity. The following aspects were evaluated: budding, rot, loss of weight, texture, flesh color, moisture, external and internal appearance, aroma, soluble solids, titratable acidity, vitamin C, protein, starch and glucose. The results indicated that 0.15 kGy was the most effective dose to reduce sprouting and post-harvest losses, under the conditions studied.

  20. Phenetic relationships of nine varieties of potato (Solanum tuberosum L.) based on morphological characters

    Science.gov (United States)

    Hidayat, Topik; Barlian, Andri; Kusdianti, R.; Kirana, Rinda

    2017-05-01

    Potato (Solanum tuberosum L.; Solanaceae) is an important commodity in Indonesia as one of the main crop after rice. Recently some new varieties have been released, but their relationship have not been studied yet. The purpose of this research was to determine the relationship among nine varieties of potatoes. Phenetic analysis was conducted using 27 morphological character states, which was derived from stems, leaves, and tubers. The character states observed were scored, and further analyzed based on Unweighted Pair Group Method with Arithmetic Mean (UPGMA) method. The results showed a high diversity of morphological character states, of which 20 states were significantly different across the varieties. Phenogram indicated that the nine varieties of potato were classified into three main groups. While the first group was consisted of varieties of Cipanas, Granola, Atlantic, and Repita, the second group was housed of Manohara and GM 05. The third group was composed of Margahayu, Mb 17, and Maglia. This pattern of relationships can be used as one of the basis in the process of crossbreeding to assemble the new varieties. The crossbreeding will be better if it is made between distantly related varieties.

  1. Characteristics of the Inhibition of Potato (Solanum tuberosum) Invertase by an Endogenous Proteinaceous Inhibitor in Potatoes

    Science.gov (United States)

    Bracho, Geracimo E.; Whitaker, John R.

    1990-01-01

    Effect of several parameters on inhibition of potato (Solanum tuberosum) invertase by its endogenous proteinaceous inhibitor was determined using homogeneous preparations of both proteins. The inhibitor and invertase formed an inactive complex with an observed association rate constant at pH 4.70 and 37°C of 8.82 × 102 per molar per second and a dissociation rate constant of 3.3 × 10−3 per minute. The inhibitor appeared to bind to invertase in more than one step. Initial interaction (measured by loss of invertase activity) was rapid, relatively weak, readily reversible (Ki of 2 × 10−6 molar) and noncompetitive with substrate at pH 4.70. Initial interaction was probably followed by isomerization to a tighter (Ki of 6.23 × 10−8 molar) complex, which dissociated slowly with a half-time of 3.5 hour. Interaction between enzyme and inhibitor appeared to be of ionic character and essentially pH independent between pH 3.5 and 7.4. PMID:16667286

  2. Photocatalytic activity of biogenic silver nanoparticles synthesized using potato (Solanum tuberosum) infusion.

    Science.gov (United States)

    Roy, Kaushik; Sarkar, C K; Ghosh, C K

    2015-07-05

    In this study, we have reported a fast and eco-benign procedure to synthesis silver nanoparticle at room temperature using potato (Solanum tuberosum) infusion along with the study of its photocatalytic activity on methyl orange dye. After addition of potato infusion to silver nitrate solution, the color of the mixture changed indicating formation of silver nanoparticles. Time dependent UV-Vis spectra were obtained to study the rate of nanoparticle formation with time. Purity and crystallinity of the biogenic silver nanoparticles were examined by X-ray diffraction (XRD). Average size and morphology of the nanoparticles were characterized by dynamic light scattering (DLS) and transmission electron microscopy (TEM). Fourier transform infra-red spectroscopy (FTIR) was employed to detect functional bio-molecules responsible that contribute to the reduction and capping of biosynthesized Ag nanoparticles. Further, these synthesized nanoparticles were used to investigate their ability to degrade methyl orange dye under sunlight irradiation and the results showed effective photocatalytic property of these biogenic silver nanoparticles. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Solanum venturii, a suitable model system for virus-induced gene silencing studies in potato reveals StMKK6 as an important player in plant immunity

    NARCIS (Netherlands)

    Dobnik, David; Lazar, Ana; Stare, Tjaša; Gruden, Kristina; Vleeshouwers, Vivianne G.A.A.; Žel, Jana

    2016-01-01

    Background: Virus-induced gene silencing (VIGS) is an optimal tool for functional analysis of genes in plants, as the viral vector spreads throughout the plant and causes reduced expression of selected gene over the whole plant. Potato (Solanum tuberosum) is one of the most important food crops,

  4. Rattle tree (Albizia lebbeck Benth. effects on potato (Solanum tuberosum L. productivity on the Jos Plateau, Nigeria

    Directory of Open Access Journals (Sweden)

    Kareem Alasi Ibraheem

    2014-01-01

    Full Text Available Field experiment was conducted in the biotite-granite area (Alfisol of the Jos Plateau, Nigeria, consisting of five cropping seasons to determine the effects of the tree rows (under alley cropping and green manure of Albizia lebbeck Benth. (rattle tree on the yield / productivity of Solanum tuberosum L. (Irish potato. The experiment was a randomized complete block design comprising five treatments and three replicates. An early maturing potato variety (Bertita was employed, its pre-sprouted tubers were planted in the alleys (spaces between the tree rows of A. lebbeck two weeks after green manure was applied (5 and 10 t ha-1, pre and post experimental soil sample analyses and cultivation operations were carried out. Results indicated that the rattle tree had profound effect on the potato growth parameters (plant height, leaf count, collar girth (at P < 0.01 and yield indices (tuber count (P < 0.05 and tuber weight (P < 0.01 due to nutrients from the green manure and nitrogen fixation activities of the rattle tree. A. lebbeck green manure application at 10 t ha-1 in the alleys of A. lebbeck hedgerows emerged as the most effective treatment in terms of growth performance and optimal yield. Collar girth and leaf count of the potato accounted for 80.4 - 91.3% of the variation in yield (R2 = 0.804 - 0.913 with collar girth having the highest value (R2 =0.910 in rainy season (rain fed cropping, while leaf count had the highest value (R2=0.913 during the dry season (irrigated cropping.

  5. Does elevated CO2 ameliorate the impact of O3 on chlorophyll content and photosynthesis in potato (Solanum tuberosum)?

    Science.gov (United States)

    Donnelly, Alison; Craigon, Jim; Black, Colin R.; Colls, Jeremy J.; Landon, Geoff

    2001-04-01

    This study examined the impact of season-long exposure to elevated carbon dioxide (CO2) and ozone (O3), individually and in combination, on leaf chlorophyll content and gas exchange characteristics in potato (Solanum tuberosum L. cv. Bintje). Plants grown in open-top chambers were exposed to three CO2 (ambient, 550 and 680 µmol mol-1) and two O3 treatments (ambient and elevated; 25 and 65 nmol mol-1, 8 h day-1 means, respectively) between crop emergence and maturity; plants were also grown in unchambered field plots. Non-destructive measurements of chlorophyll content and visible foliar injury were made for all treatments at 2-week intervals between 43 and 95 days after emergence. Gas exchange measurements were made for all except the intermediate 550 µmol mol-1 CO2 treatment. Season-long exposure to elevated O3 under ambient CO2 reduced chlorophyll content and induced extensive visible foliar damage, but had little effect on net assimilation rate or stomatal conductance. Elevated CO2 had no significant effect on chlorophyll content, but greatly reduced the damaging impact of O3 on chlorophyll content and visible foliar damage. Light-saturated assimilation rates for leaves grown under elevated CO2 were consistently lower when measured under either elevated or ambient CO2 than in equivalent leaves grown under ambient CO2. Analysis of CO2 response curves revealed that CO2-saturated assimilation rate, maximum rates of carboxylation and electron transport and respiration decreased with time. CO2-saturated assimilation rate was reduced by elevated O3 during the early stages of the season, while respiration was significantly greater under elevated CO2 as the crop approached maturity. The physiological origins of these responses and their implications for the performance of potato in a changing climate are discussed.

  6. Effect of salt stress on growth, Na+ accumulation and proline metabolism in potato (Solanum tuberosum cultivars.

    Directory of Open Access Journals (Sweden)

    Rinse Jaarsma

    Full Text Available Potato (Solanum tuberosum is a major crop world-wide and the productivity of currently used cultivars is strongly reduced at high soil salt levels. We compared the response of six potato cultivars to increased root NaCl concentrations. Cuttings were grown hydroponically and treated with 0 mM, 60 mM and 180 mM NaCl for one week. Growth reduction on salt was strongest for the cultivars Mozart and Mona Lisa with a severe senescence response at 180 mM NaCl and Mozart barely survived the treatment. The cultivars Desiree and Russett Burbank were more tolerant showing no senescence after salt treatment. A clear difference in Na(+ homeostasis was observed between sensitive and tolerant cultivars. The salt sensitive cultivar Mozart combined low Na(+ levels in root and stem with the highest leaf Na(+ concentration of all cultivars, resulting in a high Na(+ shoot distribution index (SDI for Mozart as compared to Desiree. Overall, a positive correlation between salt tolerance and stem Na(+ accumulation was found and the SDI for Na(+ points to a role of stem Na(+ accumulation in tolerance. In stem tissue, Mozart accumulated more H2O2 and less proline compared to the tolerant cultivars. Analysis of the expression of proline biosynthesis genes in Mozart and Desiree showed a clear reduction in proline dehydrogenase (PDH expression in both cultivars and an increase in pyrroline-5-carboxylate synthetase 1 (P5CS1 gene expression in Desiree, but not in Mozart. Taken together, current day commercial cultivars show promising differences in salt tolerance and the results suggest that mechanisms of tolerance reside in the capacity of Na(+ accumulation in stem tissue, resulting in reduced Na(+ transport to the leaves.

  7. MEKANISME KETAHANAN KENTANG (SOLANUM TUBEROSUM TERHADAP NEMATODA SISTA KUNING (GLOBODERA ROSTOCHIENSIS

    Directory of Open Access Journals (Sweden)

    Dewi Fitriyanti, Mulyadi, dan Christanti Sumardiyono .

    2011-11-01

    Full Text Available Resistance mechanism of potato (Solanum tuberosum to golden cyst nematode (Globodera rostochiensis.  The research was conducted from June 2005 to May 2006 in Kepuhharjo, Cangkringan, Sleman, Yogyakarta. The aims of the research were to find the resistance status of 20 potato varieties, role of  chlorogenic acid and caffeic acid  in the resistance mechanism and histopathological differences between resistant and susceptible potato varieties to  G. rostochiensis. The results showed that two varieties were resistant to G. rostochiensis, i.e, Hertha and Manohara.  Thirteen varieties were moderately resistant, i.e; No.30, No.44, No. 5, No.19, Batang Hitam, Agria,  Desiree, Berolina, Atlantik, No.095, Cipanas, FLS and Colombus, and five varieties were susceptible, i.e; Kikondo, Granola, Erika, LBR, and Fries. The presence of chlorogenic acid and caffeic acid in Hertha (resistant variety and in Granola (susceptible variety were analized by TLC. In Hertha chlorogenic acid was detected at 4, 5, and 6 days after inoculation (DAI, whereas in Granola it was detected at 1 and 6 DAI. It was assumed that the presence of chlorogenic acid for 3 successively week in Hertha, caused it more resistant than Granola.  Cell lignification inhibited                       G. rostochiensis grow well inside the root tissue of Hertha, whereas in Granola only a few cell was lignified as indicated by less absorption of red colour (safranin in infected areas. Caffeic acid was not detected either in uninoculated or inoculated of both potato varieties.  It indicated that caffeic acid might not be naturally present in Hertha and Granola and nematode infection could not stimulate the production of this compound.

  8. Selection of reference genes for transcriptional analysis of edible tubers of potato (Solanum tuberosum L..

    Directory of Open Access Journals (Sweden)

    Roberta Fogliatto Mariot

    Full Text Available Potato (Solanum tuberosum yield has increased dramatically over the last 50 years and this has been achieved by a combination of improved agronomy and biotechnology efforts. Gene studies are taking place to improve new qualities and develop new cultivars. Reverse transcriptase quantitative polymerase chain reaction (RT-qPCR is a bench-marking analytical tool for gene expression analysis, but its accuracy is highly dependent on a reliable normalization strategy of an invariant reference genes. For this reason, the goal of this work was to select and validate reference genes for transcriptional analysis of edible tubers of potato. To do so, RT-qPCR primers were designed for ten genes with relatively stable expression in potato tubers as observed in RNA-Seq experiments. Primers were designed across exon boundaries to avoid genomic DNA contamination. Differences were observed in the ranking of candidate genes identified by geNorm, NormFinder and BestKeeper algorithms. The ranks determined by geNorm and NormFinder were very similar and for all samples the most stable candidates were C2, exocyst complex component sec3 (SEC3 and ATCUL3/ATCUL3A/CUL3/CUL3A (CUL3A. According to BestKeeper, the importin alpha and ubiquitin-associated/ts-n genes were the most stable. Three genes were selected as reference genes for potato edible tubers in RT-qPCR studies. The first one, called C2, was selected in common by NormFinder and geNorm, the second one is SEC3, selected by NormFinder, and the third one is CUL3A, selected by geNorm. Appropriate reference genes identified in this work will help to improve the accuracy of gene expression quantification analyses by taking into account differences that may be observed in RNA quality or reverse transcription efficiency across the samples.

  9. Karakteristik Edible Film dari Pati Kentang (Solanum Tuberosum L. dengan Penambahan Gliserol

    Directory of Open Access Journals (Sweden)

    Sjamsiah Sjamsiah

    2017-12-01

    Full Text Available Edible film is a thin layer that serve as the packaging or upholstery as well as food that can be eaten with a product. It is packaged and can be degraded by nature. Potato starch can be used as raw material in manufacturing edible film, in which the addition of glycerol is needed as a plasticizer that function to improve the elasticity of the edible film. The goal of the research is to know the influence of glycerol concentration variation against the characteristics of edible film of starch potatoes (Solanum tuberosum L. the parameters examined in this study i.e the physical test that includes a test of strong thickness, tensile test and present enlargement, test the solubility and organoleptic. To help figure out the data obtained in the real effect or not, is done using the SPSS Analysis Variant 1 direction or one-way ANOVA. Characteristics of edible film from potato starch with addition of glycerol with a concentration of 20%, 30% and 40% (v/v to the value of the thickness of consecutive 0,058 mm, 0,062 mm and 0,071mm. The value of the tensile strengh i.e 0,75 N/mm2, 0,69 N/mm2 and 0,35 N/mm2. The value obtained by elongation percent 4,96%, 9,04% and 9,51% where as the value of solubility is obtained that is 19%, 21,4% and 34,6%. Application of edible films from potato starch as the packaging on candy jelly can be acceptedas alternative packaging material for food.

  10. Genetic Linkage Mapping of Economically Important Traits in Cultivated Tetraploid Potato (Solanum tuberosum L.).

    Science.gov (United States)

    Massa, Alicia N; Manrique-Carpintero, Norma C; Coombs, Joseph J; Zarka, Daniel G; Boone, Anne E; Kirk, William W; Hackett, Christine A; Bryan, Glenn J; Douches, David S

    2015-09-14

    The objective of this study was to construct a single nucleotide polymorphism (SNP)-based genetic map at the cultivated tetraploid level to locate quantitative trait loci (QTL) contributing to economically important traits in potato (Solanum tuberosum L.). The 156 F1 progeny and parents of a cross (MSL603) between "Jacqueline Lee" and "MSG227-2" were genotyped using the Infinium 8303 Potato Array. Furthermore, the progeny and parents were evaluated for foliar late blight reaction to isolates of the US-8 genotype of Phytophthora infestans (Mont.) de Bary and vine maturity. Linkage analyses and QTL mapping were performed using a novel approach that incorporates allele dosage information. The resulting genetic maps contained 1972 SNP markers with an average density of 1.36 marker per cM. QTL mapping identified the major source of late blight resistance in "Jacqueline Lee." The best SNP marker mapped ~0.54 Mb from a resistance hotspot on the long arm of chromosome 9. For vine maturity, the major-effect QTL was located on chromosome 5 with allelic effects from both parents. A candidate SNP marker for this trait mapped ~0.25 Mb from the StCDF1 gene, which is a candidate gene for the maturity trait. The identification of markers for P. infestans resistance will enable the introgression of multiple sources of resistance through marker-assisted selection. Moreover, the discovery of a QTL for late blight resistance not linked to the QTL for vine maturity provides the opportunity to use marker-assisted selection for resistance independent of the selection for vine maturity classifications. Copyright © 2015 Massa et al.

  11. Selection of reference genes for transcriptional analysis of edible tubers of potato (Solanum tuberosum L.).

    Science.gov (United States)

    Mariot, Roberta Fogliatto; de Oliveira, Luisa Abruzzi; Voorhuijzen, Marleen M; Staats, Martijn; Hutten, Ronald C B; Van Dijk, Jeroen P; Kok, Esther; Frazzon, Jeverson

    2015-01-01

    Potato (Solanum tuberosum) yield has increased dramatically over the last 50 years and this has been achieved by a combination of improved agronomy and biotechnology efforts. Gene studies are taking place to improve new qualities and develop new cultivars. Reverse transcriptase quantitative polymerase chain reaction (RT-qPCR) is a bench-marking analytical tool for gene expression analysis, but its accuracy is highly dependent on a reliable normalization strategy of an invariant reference genes. For this reason, the goal of this work was to select and validate reference genes for transcriptional analysis of edible tubers of potato. To do so, RT-qPCR primers were designed for ten genes with relatively stable expression in potato tubers as observed in RNA-Seq experiments. Primers were designed across exon boundaries to avoid genomic DNA contamination. Differences were observed in the ranking of candidate genes identified by geNorm, NormFinder and BestKeeper algorithms. The ranks determined by geNorm and NormFinder were very similar and for all samples the most stable candidates were C2, exocyst complex component sec3 (SEC3) and ATCUL3/ATCUL3A/CUL3/CUL3A (CUL3A). According to BestKeeper, the importin alpha and ubiquitin-associated/ts-n genes were the most stable. Three genes were selected as reference genes for potato edible tubers in RT-qPCR studies. The first one, called C2, was selected in common by NormFinder and geNorm, the second one is SEC3, selected by NormFinder, and the third one is CUL3A, selected by geNorm. Appropriate reference genes identified in this work will help to improve the accuracy of gene expression quantification analyses by taking into account differences that may be observed in RNA quality or reverse transcription efficiency across the samples.

  12. Chlorogenic Acid Biosynthesis Appears Linked with Suberin Production in Potato Tuber (Solanum tuberosum).

    Science.gov (United States)

    Valiñas, Matías Ariel; Lanteri, María Luciana; ten Have, Arjen; Andreu, Adriana Balbina

    2015-05-20

    Potato (Solanum tuberosum L.) is a good source of dietary antioxidants. Chlorogenic acid (CGA) and caffeic acid (CA) are the most abundant phenolic acid antioxidants in potato and are formed by the phenylpropanoid pathway. A number of CGA biosynthetic routes that involve hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase (HQT) and/or hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (HCT) have been proposed, but little is known about their path in potato. CA production requires a caffeoyl shikimate esterase (CSE), and CA serves as a substrate of lignin precursor ferulic acid via the action of caffeic/5-hydroxyferulic acid O-methyltransferase (COMT I). CGA is precursor of caffeoyl-CoA and, via caffeoyl-CoA O-methyltransferase (CCoAOMT), of feruloyl-CoA. Feruloyl-CoA is required for lignin and suberin biosynthesis, crucial for tuber development. Here, metabolite and transcript levels of the mentioned and related enzymes, such as cinnamate 4-hydroxylase (C4H), were determined in the flesh and skin of fresh and stored tubers. Metabolite and transcript levels were higher in skin than in flesh, irrespective of storage. CGA and CA production appear to occur via p-coumaroyl-CoA, using HQT and CSE, respectively. HCT is likely involved in CGA remobilization toward suberin. The strong correlation between CGA and CA, the correspondence with C4H, HQT, CCoAOMT2, and CSE, and the negative correlation of HCT and COMT I in potato tubers suggest a major flux toward suberin.

  13. Effect of Salt Stress on Growth, Na+ Accumulation and Proline Metabolism in Potato (Solanum tuberosum) Cultivars

    Science.gov (United States)

    Jaarsma, Rinse; de Vries, Rozemarijn S. M.; de Boer, Albertus H.

    2013-01-01

    Potato (Solanum tuberosum) is a major crop world-wide and the productivity of currently used cultivars is strongly reduced at high soil salt levels. We compared the response of six potato cultivars to increased root NaCl concentrations. Cuttings were grown hydroponically and treated with 0 mM, 60 mM and 180 mM NaCl for one week. Growth reduction on salt was strongest for the cultivars Mozart and Mona Lisa with a severe senescence response at 180 mM NaCl and Mozart barely survived the treatment. The cultivars Desiree and Russett Burbank were more tolerant showing no senescence after salt treatment. A clear difference in Na+ homeostasis was observed between sensitive and tolerant cultivars. The salt sensitive cultivar Mozart combined low Na+ levels in root and stem with the highest leaf Na+ concentration of all cultivars, resulting in a high Na+ shoot distribution index (SDI) for Mozart as compared to Desiree. Overall, a positive correlation between salt tolerance and stem Na+ accumulation was found and the SDI for Na+ points to a role of stem Na+ accumulation in tolerance. In stem tissue, Mozart accumulated more H2O2 and less proline compared to the tolerant cultivars. Analysis of the expression of proline biosynthesis genes in Mozart and Desiree showed a clear reduction in proline dehydrogenase (PDH) expression in both cultivars and an increase in pyrroline-5-carboxylate synthetase 1 (P5CS1) gene expression in Desiree, but not in Mozart. Taken together, current day commercial cultivars show promising differences in salt tolerance and the results suggest that mechanisms of tolerance reside in the capacity of Na+ accumulation in stem tissue, resulting in reduced Na+ transport to the leaves. PMID:23533673

  14. Effect of Potato (Solanum tuberosum L.) Cropping Systems on Soil and Nutrient Losses Through Runoff in a Humic Nitisol, Kenya

    Science.gov (United States)

    Nyawade, Shadrack; Charles, Gachene; Karanja, Nancy; Elmar, Schulte-Geldermann

    2016-04-01

    Soil erosion has been identified as one of the major causes of soil productivity decline in the potato growing areas of East African Highlands. Potato establishes a protective soil cover only at about 45-60 days after planting and does not yield sufficient surface mulch upon harvest which leaves the soil bare at the critical times when rainfall intensities are usually high thus exposes soil to erosion. A field study was carried out using runoff plots during the short and long rainy seasons of 2014/15 respectively at the University of Nairobi Upper Kabete Farm, Kenya. The objectives were to assess the effect of soil surface roughness and potato cropping systems on soil loss and runoff, to determine the effect of erosion on nutrient enrichment ratio and to evaluate the soil organic matter fraction most susceptible to soil erosion. The treatments comprised of Bare Soil (T1); Potato + Garden Pea (Pisum sativa) (T2); Potato + Climbing Bean (Phaseolus vulgaris) (T3); Potato + Dolichos (Lablab purpureus) (T4) and Sole Potato (Solanum tuberosum L.) (T5). The amount of soil loss and runoff recorded in each event differed significantly between treatments (ppotato plots (T5), while mean cumulative runoff reduced by 8.5, 17.1 and 28.3 mm from T2, T3 and T4 respectively when compared with the sole potato plots (T5) indicating that T4 plots provided the most effective cover in reducing soil loss and runoff. Regression analyses revealed that both runoff and soil loss related significantly with surface roughness and percent cover (R2=0.83 and 0.73 respectively, ppotato cropping systems so as to minimize soil and nutrient losses due to erosion. Acknowledgement This study was part of the CIP-Sub Saharan Africa managed project-"Improved Soil Fertility Management for Sustainable Intensification in Potato Based Systems in Ethiopia and Kenya"-funded by the BMZ/GIZ International Agricultural Research for Development Fund.

  15. Potato (Solanum tuberosum L.) tuber ageing induces changes in the proteome and antioxidants associated with the sprouting pattern.

    Science.gov (United States)

    Delaplace, Pierre; Fauconnier, Marie-Laure; Sergeant, Kjell; Dierick, Jean-François; Oufir, Mouhssin; van der Wal, Froukje; America, Antoine H P; Renaut, Jenny; Hausman, Jean-François; du Jardin, Patrick

    2009-01-01

    During post-harvest storage, potato tubers age as they undergo an evolution of their physiological state influencing their sprouting pattern. In the present study, physiological and biochemical approaches were combined to provide new insights on potato (Solanum tuberosum L. cv. Désirée) tuber ageing. An increase in the physiological age index (PAI) value from 0.14 to 0.83 occurred during storage at 4 degrees C over 270 d. Using this reference frame, a proteomic approach was followed based on two-dimensional electrophoresis. In the experimental conditions of this study, a marked proteolysis of patatin occurred after the PAI reached a value of 0.6. In parallel, several glycolytic enzymes were up-regulated and cellular components influencing protein conformation and the response to stress were altered. The equilibrium between the 20S and 26S forms of the proteasome was modified, the 20S form that recycles oxidized proteins being up-regulated. Two proteins belonging to the cytoskeleton were also differentially expressed during ageing. As most of these changes are also observed in an oxidative stress context, an approach focused on antioxidant compounds and enzymes as well as oxidative damage on polyunsaturated fatty acids and proteins was conducted. All the changes observed during ageing seemed to allow the potato tubers to maintain their radical scavenging activity until the end of the storage period as no accumulation of oxidative damage was observed. These data are interpreted considering the impact of reactive oxygen species on the development and the behaviour of other plant systems undergoing ageing or senescence processes.

  16. [Allelic state of the molecular marker for the golden nematode (Globodera rostochiensis) resistance gene H1 among Ukrainian and world cultivars of potato (Solanum tuberosum ssp. tuberosum)].

    Science.gov (United States)

    Karelov, A V; Pilipenko, L A; Kozub, N A; Bondus, R A; Borzykh, A U; Sozinov, I A; Blium, Ia B; Sozinov, A A

    2013-01-01

    The purpose of our investigation was determination of allelic state of the H1 resistance gene against the pathotypes Ro1 and Ro4 of golden potato cyst nematode (Globodera rostochiensis) among Ukrainian and world potato (Solanum tuberosum ssp. tuberosum) cultivars. The allelic condition of the TG689 marker was determined by PCR with DNA samples isolated from tubers of potato and primers, one pair of which flanks the allele-specific region and the other one was used for the control of DNA quality. Among analyzed 77 potato cultivars the allele of marker associated with the H1-type resistance was found in 74% of Ukrainian and 90% foreign ones although some of those cultivars proved to be susceptible to the golden potato nematode in field. The obtained data confirm the presence of H1-resistance against golden nematode pathotypes Ro1 and Ro4 among the Ukrainian potato cultivars and efficiency of the used marker within the accuracy that has been declared by its authors.

  17. OBSERVAÇÕES SOBRE DEGENERESCÊNCIA E COMPORTAMENTO EM DIFERENTES ÉPOCAS DE PLANTIO DE QUATRO VARIEDADES DE BATATA (Solanum Tuberosum L. COMMENTS ON DEGENERATION AND BEHAVIOR AT DIFFERENT PLANTING DATES OF FOUR POTATO (Solanum tuberosum L. VARIETIES

    Directory of Open Access Journals (Sweden)

    Peter E. Sonnenberg

    2007-09-01

    Full Text Available

    As variedades de batata DELTA-A, HANSA, HYDRA e TONDRA foram plantadas em duas gerações, a primeira na seca e a segunda, nas águas de 1971, em Goiânia. Para o primeiro plantio, usaram-se batatas-sementes importadas, para o segundo, as filhas destas. HANSA, HYDRA e TONDRA produziram mais na segunda geração do que na primeira, devido às melhores condições da época chuvosa. A produção da DELTA-A praticamente não variou nas duas épocas. HANSA foi significantemente superior às outras, em produção total, nas duas épocas e em produção de tubérculos comerciáveis (acima de 33 mm, na época chuvosa. Neste período, seus tubérculos grandes, (acima de 40 mm apresentaram-se com superdesenvolvimento de lenticelas e manchados internamente, ficando comercialmente desvalorizados. A variedade HYDRA destacou-se das demais pela produção de batatas grandes, principalmente na seca. Mostrou-se, porém, muito suscetível à sarna comum, cujo ataque inutilizou grande parte de seus tubérculos. TONDRA foi a variedade que melhor se adaptou ao período chuvoso. Produziu duas vezes mais tubérculos comerciáveis e quase três vezes mais tubérculos grandes, que na seca.

    The four potato varieties DELTA-A, HANSA, HYDRA and TONDRA were tested in the dry and in the rainy season of 1971, in Goiânia. Imported certified seed potatoes were used for the first planting and the harvested tubers, for the second. All varieties, except DELTA-A, yielded more in the rainy than in the dry season. This difference was found to be caused by the better water supply during the rainy season. There was no significant influence of the season on the production of DELTA-A. HANSA produced in both seasons significantly more in total weight than the other varieties and more marketable potatoes (over 33 mm in the rainy season. But the large

  18. Sucrose and light effects on in vitro cultures of potato (Solanum tuberosum L.), chokecherry (Prunus virginiana L.) and Saskatoon berry (Amelanchier alnifolia Nutt.) during low temperature storage

    NARCIS (Netherlands)

    Pruski, K.; Kozai, T.; Lewis, T.; Astatkie, T.; Nowak, J.

    2000-01-01

    Cultures of potato (Solanum tuberosum) cv. Atlantic, chokecherry ( Prunus virginiana L.) cv. Garrington and saskatoon berry (Amelancher alnifolia Nutt.) cv. Northline grown in vitro for 3 weeks at 24/22 °C, 16-h photoperiod, 150 μmol m-2 s-1 photosynthetic photon flux density (PPFD) mixed

  19. Genome-wide QTL and bulked transcriptomic analysis reveals new candidate genes for the control of tuber carotenoid content in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Campbell, Raymond; Pont, Simon D A; Morris, Jenny A; McKenzie, Gaynor; Sharma, Sanjeev Kumar; Hedley, Pete E; Ramsay, Gavin; Bryan, Glenn J; Taylor, Mark A

    2014-09-01

    Genome-wide QTL analysis of potato tuber carotenoid content was investigated in populations of Solanum tuberosum Group Phureja that segregate for flesh colour, revealing a novel major QTL on chromosome 9. The carotenoid content of edible plant storage organs is a key nutritional and quality trait. Although the structural genes that encode the biosynthetic enzymes are well characterised, much less is known about the factors that determine overall storage organ content. In this study, genome-wide QTL mapping, in concert with an efficient 'genetical genomics' analysis using bulked samples, has been employed to investigate the genetic architecture of potato tuber carotenoid content. Two diploid populations of Solanum tuberosum Group Phureja were genotyped (AFLP, SSR and DArT markers) and analysed for their tuber carotenoid content over two growing seasons. Common to both populations were QTL that explained relatively small proportions of the variation in constituent carotenoids and a major QTL on chromosome 3 explaining up to 71 % of the variation in carotenoid content. In one of the populations (01H15), a second major carotenoid QTL was identified on chromosome 9, explaining up to 20 % of the phenotypic variation. Whereas the major chromosome 3 QTL was likely to be due to an allele of a gene encoding β-carotene hydroxylase, no known carotenoid biosynthetic genes are located in the vicinity of the chromosome 9 QTL. A unique expression profiling strategy using phenotypically distinct bulks comprised individuals with similar carotenoid content provided further support for the QTL mapping to chromosome 9. This study shows the potential of using the potato genome sequence to link genetic maps to data arising from eQTL approaches to enhance the discovery of candidate genes underlying QTLs.

  20. Farmyard Manure and Fertilizer Effects on Seed Potato (Solanum tuberosum L.) Yield in Green House Production

    Science.gov (United States)

    László, M.

    2009-04-01

    crescentes dosagens de 0 e 18.0 grama vaso-1 diminuiram a produção assima de 250% em médio da duas misturas. 12. Numero de tuberculos 0-20 mm e 20 mm- por planta com os manejos de 0 e 18.0 grama vaso-1 foi possível aumentar em media 200% sobre a mistura padrão. Os manejo de 18.0 grama de adubo vaso-1 já causaram importante diminuição em relação caso a absoluto controle. 13. Numero total de tuberculos por planta entre manejos foi melhor a dosagem de 7.2 grama vaso-1 adubo complexo 4N:14P:8K comparando da mistura padrão. Nos verificamos-se que a mistura padrão sempre deu menor rasultados do que as outras misturas (i.e.: 1 e 2). Entre as misturas 1 e 2 a melhor foi a número 2. (80% latossolo vermelho novo, 10% palha de arroz queimado, 10% esterco de curral). Com esta mistura e com relação a mistura padrão, foi possível aumentar o número de tuberculos 0-20 mm com 77%. No caso do adubação, verificamos que grande quantidades de adubo acima de 7.2 grama vaso-1, de modo rigoroso diminuiu a produção de batata-semente pré- básica. Este fato deve ser considerado para a eleição das dosagens de adubos. Deve-se indicar o caso de número de tuberculos acima 20 mm-, onde em relação mistura padrão foi possivel aumentar em média 73% os resultados. Reconhecimento: Esta pesquisa foi apoio da Empresa Brasileira de Pesquisa Agropecuaria- Centro Nacional de Pesquisas de Hortaliças, Brasília-DF e Centro Pesquisa de Solo e Agroquímica do Academia Húngara de Ciências, Budapest References Kádár I-Márton L.-Horváth S. 2000. Mineral fertilisation of potato (Solanum tuberosum L.) on calcareous chernozem soil. Plant Production. 49: 291-306. Kurnik E.-Németh T.-Márton L.-Radimszki L. 2001. Effects of a new environment friendly deep fertilization system on a limy chernozem soil parameters. Agrochemistry and Soil Science. Budapest. In press László M. 2000. Nutrition of potato (Solanum tuberosum L.) on Hungary on a chernozem soil. Acta Agronomica Óváriensis. 42: 81

  1. Subsurface irrigation of potato crop (Solanum tuberosum ssp. Andigena) in Suka Kollus with different drainage systems

    Science.gov (United States)

    Serrano-Coronel, Genaro; Chipana-Rivera, René; Fátima Moreno-Pérez, María; Roldán-Cañas, José

    2016-04-01

    Among the most important hydraulic structures of pre-Hispanic ancestral technology developed in the Andean region, we find the suka kollus, aymara word, called also waru waru, en quechua or raised fields, in English. They are raised platforms surrounded by water canals that irrigate subsurface, but also have the function of draining, to deal with floods because they are surrounding Lake Titicaca. They also have the property of generating a thermoregulatory effect to crops, depending on the configuration of the channels and platforms. Such agro-ecosystems are being abandoned, however, if properly addressed crop management and some drainage canals are replaced by underground drains for increased crop area could be very useful in enabling marginal soils affected by salts and / or excess water. For these reasons, the objective of this study was to evaluate the subsurface irrigation in the potato crop in suka kollus under a system of surface drainage, and mixed drainage (surface and subsurface). The study was conducted in marginal soils of Kallutaca area, located 30 km from the city of La Paz, Bolivia, at a height of 3892 m.a.s.l. The cultivation of the potato (Solanum tuberosum ssp. Andigena) was used. Four treatments were tested with different widths of the platforms: T1 (Control) with drainage through channels; T2 (replacing a channel by a drain); T3 (replacing two channels by two drains); T4 (replacing three channels by three drains). The flow of water into the soil from the water table was predominantly upward, except during periods of high rainfall. In terms of treatments, the flow in T1 was higher, mainly at weeks 8 to 11 after seedling emergence, coinciding with the phenological phases of flowering and at the beginning of the tuber ripening. It was followed by T3, T2 and T4 treatments, respectively. Tuber yield, if one considers that the channels detract arable land, was higher in the T3 treatment,16.4 Mg / ha, followed by T2 treatment, 15.2 Mg / ha, T1

  2. Andean potato cultivars (Solanum tuberosum L.) as a source of antioxidant and mineral micronutrients.

    Science.gov (United States)

    Andre, Christelle M; Ghislain, Marc; Bertin, Pierre; Oufir, Mouhssin; Herrera, María del Rosario; Hoffmann, Lucien; Hausman, Jean-François; Larondelle, Yvan; Evers, Danièle

    2007-01-24

    Potato tubers were evaluated as a source of antioxidants and minerals for the human diet. A genetically diverse sample of Solanum tuberosum L. cultivars native to the Andes of South America was obtained from a collection of nearly 1000 genotypes using microsatellite markers. This size-manageable collection of 74 landraces, representing at best the genetic diversity among potato germplasm, was analyzed for iron, zinc, calcium, total phenolic, total carotenoid, and total vitamin C contents. The hydrophilic antioxidant capacity of each genotype was also measured using the oxygen radical absorbance capacity (ORAC) assay. The iron content ranged from 29.87 to 157.96 microg g-1 of dry weight (DW), the zinc content from 12.6 to 28.83 microg g-1 of DW, and the calcium content from 271.09 to 1092.93 microg g-1 of DW. Total phenolic content varied between 1.12 and 12.37 mg of gallic acid equiv g-1 of DW, total carotenoid content between 2.83 and 36.21 microg g-1 of DW, and total vitamin C content between 217.70 and 689.47 microg g-1 of DW. The range of hydrophilic ORAC values was 28.25-250.67 micromol of Trolox equiv g-1 of DW. The hydrophilic antioxidant capacity and the total phenolic content were highly and positively correlated (r = 0.91). A strong relationship between iron and calcium contents was also found (r = 0.67). Principal component analysis on the studied nutritional contents of the core collection revealed that most potato genotypes were balanced in terms of antioxidant and mineral contents, but some of them could be distinguished by their high level in distinct micronutrients. Correlations between the micronutrient contents observed in the sample and the genetic distances assessed by microsatellites were weakly significant. However, this study demonstrated the wide variability of health-promoting micronutrient levels within the native potato germplasm as well as the significant contribution that distinct potato tubers may impart to the intake in dietary

  3. Carryover of perfluorooctanoic acid (PFOA) and perfluorooctane sulfonate (PFOS) from soil to plant and distribution to the different plant compartments studied in cultures of carrots (Daucus carota ssp. Sativus), potatoes (Solanum tuberosum), and cucumbers (Cucumis Sativus).

    Science.gov (United States)

    Lechner, Mareike; Knapp, Holger

    2011-10-26

    A vegetation study was carried out to investigate the carryover of Perfluorooctanoic Acid (PFOA) and Perfluorooctane Sulfonate (PFOS) from soil mixed with contaminated sewage sludge to potato, carrot, and cucumber plants. Analysis was done by liquid-extraction using acetonitrile with dispersive SPE cleanup and subsequent HPLC-MS/MS. In order to assess the transfer potential from soil, transfer factors (TF) were calculated for the different plant compartments: TF = [PFC](plant (wet substance))/[PFC](soil (dry weight)). The highest TF were found for the vegetative plant compartments with average values for PFOS below those for PFOA: cucumber, 0.17 (PFOS), 0.88 (PFOA); potato, 0.36 (PFOS), 0.40 (PFOA); carrot, 0.38 (PFOS), 0.53 (PFOA). Transfer of PFOA and PFOS into potato peelings (average values of TF: PFOA 0.03, PFOS 0.04) exceeded the carryover to the peeled tubers (PFOA 0.01, PFOS potatoes (TF < 0.01). For PFOA, it was higher (TF: 0.03).

  4. Influence of the time of application of 32P triple Superphosphate on the efficiency of the phosphate fertilization and the productivity of the potato (Solanum Tuberosum L.)

    International Nuclear Information System (INIS)

    Bastidas, O.G.; Alvarez, A.L.; Urquiaga, S.

    1986-01-01

    A study was performed on a soil derived from volcanic ash (Andic Humitropept), in Pasto (Narino), Colombia, to investigate the influence of additions of 100 and 200 Kg P 2 O 5 ha -1 , at two application times (planting and 30 days after emergence - DAE), on the fertilizer use efficiency and productivity of potato (Solanum tuberosum L.) cv. Pardo Pastusa. At planting the phosphorus was applied in a continuous row in the furrow, and at 30 DAE at one side of the plant row, and immediately covered with soil from both sides of the furrow. The fertilizer used was 32 P labelled triple superphosphate (143.59 μ Ci.g -1 p -1 . It was found that: a) the phosphorus fertilization significantly increased (P -1 ) and the accumulation (from 8 to 17.8 kg P ha -1 ) by the tubers, but there was no significant effect of the different rates or times of the fertilizer application; b) the accumulation of P by the plant accompanied the accumulation of plant dry matter; c) at 75 DAE the fraction of fertiliser P in the plant shoot in the treatment fertilized at 30 DAE (52.1%) was significantly higher than that fertilized at planting (21.8%), and this corresponded to a P fertilizer use efficiency of 2.4 and 0.82, respectively

  5. Reduction of the plastidial phosphorylase in potato (Solanum tuberosum L.) reveals impact on storage starch structure during growth at low temperature.

    Science.gov (United States)

    Orawetz, Tom; Malinova, Irina; Orzechowski, Slawomir; Fettke, Joerg

    2016-03-01

    Tubers of potato (Solanum tuberosum L.), one of the most important crops, are a prominent example for an efficient production of storage starch. Nevertheless, the synthesis of this storage starch is not completely understood. The plastidial phosphorylase (Pho1; EC 2.4.1.1) catalyzes the reversible transfer of glucosyl residues from glucose-1-phosphate to the non-reducing end of α-glucans with the release of orthophosphate. Thus, the enzyme is in principle able to act during starch synthesis. However, so far under normal growth conditions no alterations in tuber starch metabolism were observed. Based on analyses of other species and also from in vitro experiments with potato tuber slices it was supposed, that Pho1 has a stronger impact on starch metabolism, when plants grow under low temperature conditions. Therefore, we analyzed the starch content, granule size, as well as the internal structure of starch granules isolated from potato plants grown under low temperatures. Besides wild type, transgenic potato plants with a strong reduction in the Pho1 activity were analyzed. No significant alterations in starch content and granule size were detected. In contrast, when plants were cultivated at low temperatures the chain length distributions of the starch granules were altered. Thus, the granules contained more short glucan chains. That was not observed in the transgenic plants, revealing that Pho1 in wild type is involved in the formation of the short glucan chains, at least at low temperatures. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. Tissue Damage, Temperature, and pH Induced by Different Electrode Arrays on Potato Pieces (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Maraelys Morales González

    2018-04-01

    Full Text Available One of the most challenging problems of electrochemical therapy is the design and selection of suitable electrode array for cancer. The aim is to determine how two-dimensional spatial patterns of tissue damage, temperature, and pH induced in pieces of potato (Solanum tuberosum L., var. Mondial depend on electrode array with circular, elliptical, parabolic, and hyperbolic shape. The results show the similarity between the shapes of spatial patterns of tissue damage and electric field intensity, which, like temperature and pH take the same shape of electrode array. The adequate selection of suitable electrodes array requires an integrated analysis that involves, in a unified way, relevant information about the electrochemical process, which is essential to perform more efficiently way the therapeutic planning and the personalized therapy for patients with a cancerous tumor.

  7. A set of tetra-nucleotide core motif SSR markers for efficient identification of potato (Solanum tuberosum) cultivars.

    Science.gov (United States)

    Kishine, Masahiro; Tsutsumi, Katsuji; Kitta, Kazumi

    2017-12-01

    Simple sequence repeat (SSR) is a popular tool for individual fingerprinting. The long-core motif (e.g. tetra-, penta-, and hexa-nucleotide) simple sequence repeats (SSRs) are preferred because they make it easier to separate and distinguish neighbor alleles. In the present study, a new set of 8 tetra-nucleotide SSRs in potato ( Solanum tuberosum ) is reported. By using these 8 markers, 72 out of 76 cultivars obtained from Japan and the United States were clearly discriminated, while two pairs, both of which arose from natural variation, showed identical profiles. The combined probability of identity between two random cultivars for the set of 8 SSR markers was estimated to be 1.10 × 10 -8 , confirming the usefulness of the proposed SSR markers for fingerprinting analyses of potato.

  8. The Transcriptome of Compatible and Incompatible Interactions of Potato (Solanum tuberosum) with Phytophthora infestans Revealed by DeepSAGE Analysis

    DEFF Research Database (Denmark)

    Gyetvai, Gabor; Sønderkær, Mads; Göbel, Ulrike

    2012-01-01

    of the compatible and incompatible interaction were captured by DeepSAGE analysis of 44 biological samples comprising five genotypes, differing only by the presence or absence of the R1 transgene, three infection time points and three biological replicates. 30.859 unique 21 base pair sequence tags were obtained......Late blight, caused by the oomycete Phytophthora infestans, is the most important disease of potato (Solanum tuberosum). Understanding the molecular basis of resistance and susceptibility to late blight is therefore highly relevant for developing resistant cultivars, either by marker...... interactions over the infection time course and between compatible and incompatible genotypes. Transcriptional changes were more numerous in compatible than in incompatible interactions. In contrast to incompatible interactions, transcriptional changes in the compatible interaction were observed predominantly...

  9. Assessment of genetic diversity among Indian potato (Solanum tuberosum L.) collection using microsatellite and retrotransposon based marker systems.

    Science.gov (United States)

    Sharma, Vishakha; Nandineni, Madhusudan R

    2014-04-01

    Potato (Solanum tuberosum) is an important non-cereal crop throughout the world and is highly recommended for ensuring global food security. Owing to the complexities in genetics and inheritance pattern of potato, the conventional method of cross breeding for developing improved varieties has been difficult. Identification and tagging of desirable traits with informative molecular markers would aid in the development of improved varieties. Insertional polymorphism of copia-like and gypsy-like long terminal repeat retrotransposons (RTN) were investigated among 47 potato varieties from India using Inter-Retrotransposon Amplified Polymorphism (IRAP) and Retrotransposon Microsatellite Amplified Polymorphism (REMAP) marker techniques and were compared with the DNA profiles obtained with simple sequence repeats (SSRs). The genetic polymorphism, efficiency of polymorphism and effectiveness of marker systems were evaluated to assess the extent of genetic diversity among Indian potato varieties. A total of 139 polymorphic SSR alleles, 270 IRAP and 98 REMAP polymorphic bands, showing polymorphism of 100%, 87.9% and 68.5%, respectively, were used for detailed characterization of the genetic relationships among potato varieties by using cluster analysis and principal coordinate analysis (PCoA). IRAP analysis resulted in the highest number of polymorphic bands with an average of 15 polymorphic bands per assay unit when compared to the other two marker systems. Based on pair-wise comparison, the genetic similarity was calculated using Dice similarity coefficient. The SSRs showed a wide range in genetic similarity values (0.485-0.971) as compared to IRAP (0.69-0.911) and REMAP (0.713-0.947). A Mantel's matrix correspondence test showed a high positive correlation (r=0.6) between IRAP and REMAP, an intermediate value (r=0.58) for IRAP and SSR and the lowest value (r=0.17) for SSR and REMAP. Statistically significant cophenetic correlation coefficient values, of 0.961, 0.941 and 0

  10. Overexpression of StNF-YB3.1 reduces photosynthetic capacity and tuber production, and promotes ABA-mediated stomatal closure in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Xuanyuan, Guochao; Lu, Congming; Zhang, Ruofang; Jiang, Jiming

    2017-08-01

    Nuclear factor Y (NF-Y) is one of the most ubiquitous transcription factors (TFs), comprising NF-YA, NF-YB and NF-YC subunits, and has been identified and reported in various aspects of development for plants and animals. In this work, StNF-YB3.1, a putative potato NF-YB subunit encoding gene, was isolated from Solanum tuberosum by rapid amplification of cDNA ends (RACE). Overexpression of StNF-YB3.1 in potato (cv. Atlantic) resulted in accelerated onset of flowering, and significant increase in leaf chlorophyll content in field trials. However, transgenic potato plants overexpressing StNF-YB3.1 (OEYB3.1) showed significant decreases in photosynthetic rate and stomatal conductance both at tuber initiation and bulking stages. OEYB3.1 lines were associated with significantly fewer tuber numbers and yield reduction. Guard cell size and stomatal density were not changed in OEYB3.1 plants, whereas ABA-mediated stomatal closure was accelerated compared to that of wild type plants because of the up-regulation of genes for ABA signaling, such as StCPK10-like, StSnRK2.6/OST1-like, StSnRK2.7-like and StSLAC1-like. We speculate that the acceleration of stomatal closure was a possible reason for the significantly decreased stomatal conductance and photosynthetic rate. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Enhanced resistance to blister blight in transgenic tea (Camellia sinensis [L.] O. Kuntze) by overexpression of class I chitinase gene from potato (Solanum tuberosum).

    Science.gov (United States)

    Singh, H Ranjit; Deka, Manab; Das, Sudripta

    2015-07-01

    Tea is the second most consumed beverage in the world. A crop loss of up to 43 % has been reported due to blister blight disease of tea caused by a fungus, Exobasidium vexans. Thus, it directly affects the tea industry qualitatively and quantitatively. Solanum tuberosum class I chitinase gene (AF153195) is a plant pathogenesis-related gene. It was introduced into tea genome via Agrobacterium-mediated transformation with hygromycin phosphotransferase (hpt) gene conferring hygromycin resistance as plant selectable marker. A total of 41 hygromycin resistant plantlets were obtained, and PCR analysis established 12 plantlets confirming about the stable integration of transgene in the plant genome. Real-time PCR detected transgene expression in four transgenic plantlets (T28, C57, C9, and T31). Resistance to biotrophic fungal pathogen, E. vexans, was tested by detached leaf infection assay of greenhouse acclimated plantlets. An inhibitory activity against the fungal pathogen was evident from the detached leaves from the transformants compared with the control. Fungal lesion formed on control plantlet whereas the transgenic plantlets showed resistance to inoculated fungal pathogen by the formation of hypersensitivity reaction area. This result suggests that constitutive expression of the potato class I chitinase gene can be exploited to improve resistance to fungal pathogen, E. vexans, in economical perennial plantation crop like tea.

  12. A Medicago truncatula H+-pyrophosphatase gene, MtVP1, improves sucrose accumulation and anthocyanin biosynthesis in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Wang, J W; Wang, H Q; Xiang, W W; Chai, T Y

    2014-05-09

    We recently cloned MtVP1, a type I vacuolar-type H(+)-translocating inorganic pyrophosphatase from Medicago truncatula. In the present study, we investigated the cellular location and the function of this H(+)-PPase in Arabidopsis and potato (Solanum tuberosum L.). An MtVP1::enhanced green fluorescent protein fusion was constructed, which localized to the plasma membrane of onion epidermal cells. Transgenic Arabidopsis thaliana overexpressing MtVP1 had more robust root systems and redder shoots than wild-type (WT) plants under conditions of cold stress. Furthermore, overexpression of MtVP1 in potato accelerated the formation and growth of vegetative organs. The tuber buds and stem base of transgenic potatoes became redder than those of WT plants, but flowering was delayed by approximately half a month. Interestingly, anthocyanin biosynthesis was promoted in transgenic Arabidopsis seedlings and potato tuber buds. The sucrose concentration of transgenic potato tubers and tuber buds was enhanced compared with that of WT plants. Furthermore, sucrose concentration in tubers was higher than that in tuber buds. Although there was no direct evidence to support Fuglsang's hypothetical model regarding the effects of H(+)-PPase on sucrose phloem loading, we speculated that sucrose concentration was increased in tuber buds owing to the increased concentration in tubers. Therefore, overexpressed MtVP1 enhanced sucrose accumulation of source organs, which might enhance sucrose transport to sink organs, thus affecting anthocyanin biosynthesis.

  13. Nutrient Concentrations of Bush Bean (Phaseolus vulgaris L. and Potato (Solanum tuberosum L. Cultivated in Subarctic Soils Managed with Intercropping and Willow (Salix spp. Agroforestry

    Directory of Open Access Journals (Sweden)

    Meaghan J. Wilton

    2017-12-01

    Full Text Available To ease food insecurities in northern Canada, some remote communities started gardening initiatives to gain more access to locally grown foods. Bush beans (Phaseolus vulgaris L. and potatoes (Solanum tuberosum L. were assessed for N, P, K, Mg, and Ca concentrations of foliage as indicators of plant nutrition in a calcareous silty loam soil of northern Ontario James Bay lowlands. Crops were grown in sole cropping and intercropping configurations, with comparisons made between an open field and an agroforestry site enclosed with willow (Salix spp. trees. Foliage chemical analysis of the sites revealed an abundance of Ca, adequacies for Mg and N, and deficiencies in P and K. Intercropping bean and potato did not show significant crop–crop facilitation for nutrients. The agroforestry site showed to be a superior management practice for the James Bay lowland region, specifically for P. The agroforestry site had significantly greater P for bean plant (p = 0.024 and potato foliage (p = 0.002 compared to the open site. It is suspected that the presence of willows improve plant available P to bean and potatoes by tree root—crop root interactions and microclimate enhancements.

  14. Retrospective view of North American potato (Solanum tuberosum L.) breeding in the 20th and 21st centuries.

    Science.gov (United States)

    Hirsch, Candice N; Hirsch, Cory D; Felcher, Kimberly; Coombs, Joseph; Zarka, Dan; Van Deynze, Allen; De Jong, Walter; Veilleux, Richard E; Jansky, Shelley; Bethke, Paul; Douches, David S; Buell, C Robin

    2013-06-21

    Cultivated potato (Solanum tuberosum L.), a vegetatively propagated autotetraploid, has been bred for distinct market classes, including fresh market, pigmented, and processing varieties. Breeding efforts have relied on phenotypic selection of populations developed from intra- and intermarket class crosses and introgressions of wild and cultivated Solanum relatives. To retrospectively explore the effects of potato breeding at the genome level, we used 8303 single-nucleotide polymorphism markers to genotype a 250-line diversity panel composed of wild species, genetic stocks, and cultivated potato lines with release dates ranging from 1857 to 2011. Population structure analysis revealed four subpopulations within the panel, with cultivated potato lines grouping together and separate from wild species and genetic stocks. With pairwise kinship estimates clear separation between potato market classes was observed. Modern breeding efforts have scarcely changed the percentage of heterozygous loci or the frequency of homozygous, single-dose, and duplex loci on a genome level, despite concerted efforts by breeders. In contrast, clear selection in less than 50 years of breeding was observed for alleles in biosynthetic pathways important for market class-specific traits such as pigmentation and carbohydrate composition. Although improvement and diversification for distinct market classes was observed through whole-genome analysis of historic and current potato lines, an increased rate of gain from selection will be required to meet growing global food demands and challenges due to climate change. Understanding the genetic basis of diversification and trait improvement will allow for more rapid genome-guided improvement of potato in future breeding efforts.

  15. Comparación cuantitativa de ácido abscísico y citoquininas en la tuberización de Solanum tuberosum L. y Solanum phureja Juz. et Buk.

    OpenAIRE

    Ortiz Luz Yineth; Flórez Víctor Julio

    2008-01-01

    De las 30 variedades de papa cultivadas en Colombia tan solo 10 poseen importancia comercial. Entre otros factores, este número es limitado por la acción de hormonas endógenas que aceleran diferentes fases del proceso de tuberización, especialmente en las especies más precoces. En este trabajo fueron recolectadas muestras de tubérculos de diferentes especies de papa (Solanum tuberosum L. var. ICA-Única y Tuquerreña, y Solanum phureja

  16. Comparación cuantitativa de ácido abscísico y citoquininas en la tuberización de Solanum tuberosum L. y Solanum phureja Juz. et Buk.

    OpenAIRE

    Ortiz, Luz Yineth; Flórez, Víctor Julio

    2008-01-01

    De las 30 variedades de papa cultivadas en Colombia tan solo 10 poseen importancia comercial. Entre otros factores, este número es limitado por la acción de hormonas endógenas que aceleran diferentes fases del proceso de tuberización, especialmente en las especies más precoces. En este trabajo fueron recolectadas muestras de tubérculos de diferentes especies de papa (Solanum tuberosum L. var. ICA-Única y Tuquerreña, y Solanum phureja Juz. et Buk. var. Yema de Huevo), en los estadios fenológic...

  17. Comparación cuantitativa de ácido abscísico y citoquininas en la tuberización de solanum tuberosum l. y solanum phureja juz. et buk.

    OpenAIRE

    Ortiz, Luz Yineth; Flórez, Víctor Julio

    2010-01-01

    De las 30 variedades de papa cultivadas en Colombia tan solo 10 poseen importancia comercial. Entre otros factores, este número es limitado por la acción de hormonas endógenas que aceleran diferentes fases del proceso de tuberización, especialmente en las especies más precoces. En este trabajo fueron recolectadas muestras de tubérculos de diferentes especies de papa (Solanum tuberosum L. var. ICA-Única y Tuquerreña, y Solanum phureja Juz. et Buk. var. Yema de Huevo), en los estadios...

  18. In silico insights into protein-protein interactions and folding dynamics of the saposin-like domain of Solanum tuberosum aspartic protease.

    Directory of Open Access Journals (Sweden)

    Dref C De Moura

    Full Text Available The plant-specific insert is an approximately 100-residue domain found exclusively within the C-terminal lobe of some plant aspartic proteases. Structurally, this domain is a member of the saposin-like protein family, and is involved in plant pathogen defense as well as vacuolar targeting of the parent protease molecule. Similar to other members of the saposin-like protein family, most notably saposins A and C, the recently resolved crystal structure of potato (Solanum tuberosum plant-specific insert has been shown to exist in a substrate-bound open conformation in which the plant-specific insert oligomerizes to form homodimers. In addition to the open structure, a closed conformation also exists having the classic saposin fold of the saposin-like protein family as observed in the crystal structure of barley (Hordeum vulgare L. plant-specific insert. In the present study, the mechanisms of tertiary and quaternary conformation changes of potato plant-specific insert were investigated in silico as a function of pH. Umbrella sampling and determination of the free energy change of dissociation of the plant-specific insert homodimer revealed that increasing the pH of the system to near physiological levels reduced the free energy barrier to dissociation. Furthermore, principal component analysis was used to characterize conformational changes at both acidic and neutral pH. The results indicated that the plant-specific insert may adopt a tertiary structure similar to the characteristic saposin fold and suggest a potential new structural motif among saposin-like proteins. To our knowledge, this acidified PSI structure presents the first example of an alternative saposin-fold motif for any member of the large and diverse SAPLIP family.

  19. Efecto antioxidante y citoprotector del tocosh de Solanum tuberosum ‘papa’ en la mucosa gástrica de animales de experimentación

    Directory of Open Access Journals (Sweden)

    Miguel Hernán Sandoval Vegas

    2015-01-01

    Full Text Available El tocosh es un producto alimenticio obtenido por una técnica de conservación andina y que tiene propiedades nutritivas y terapéuticas. Objetivo: Demostrar la capacidad antioxidante y el efecto citoprotector del tocosh de Solanum tuberosum ‘papa’ en la mucosa gástrica de animales de experimentación. Diseño: Experimental. Institución: Centro de Investigación de Bioquímica y Nutrición, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Tocosh seco y molido administrado a ratas albinas. Intervenciones: A 6 grupos de ratas albinas machos (200 ± 50 g se les dividió en: (GI solución NaCl 0,9%, 10 mL/kg;(GII etanol al 70% a 10 mL/kg; (GIII, IV y V Tocosh equivalente a 900 mg/kg, 1 800 mg/kg y 2 700 mg/kg, respectivamente, y (GVI sucralfato 30 mg/kg. En todos los casos, una hora después se indujo injuria con etanol 70° a 10 mL/kg y por laparotomía abdominal se obtuvo el tejido gástrico. Principales medidas de resultados: Porcentaje de citoprotección gástrica en imagen digitalizada por image analysis software for plant disease quantification y capacidad antioxidante por lipoperoxidación método espectrofotométrico de la reacción de especies reactivas al ácido tiobarbitúrico (TBARS. Resultados: La marcha fitoquímica identificó compuestos fenólicos, alcaloides, triterpenoides y esteroides, azúcares reductores y aminoácidos libres como metabolitos secundarios. Las dosis de 2 700 mg/kg y 900 mg/kg resultaron en 0,72 y 1,81 nmol/g tejido de lipoperoxidación, respectivamente. La dosis de 1 800 mg/kg protegió un 97% del área de la mucosa gástrica, 2 700 mg/kg un 95% y la de 900 mg/kg, 88% (p<0,05. La dosis de 1 800 mg/kg exhibió mejor efecto citoprotector y la de 2 700 mg/kg mejor actividad antioxidante, comparada con sucralfato 30 mg/kg. Conclusiones: El tocosh de Solanum tuberosum ‘papa’ tuvo efecto citoprotector y actividad antioxidante.

  20. Comparative sequence analysis of the potato cyst nematode resistance locus H1 reveals a major lack of co-linearity between three haplotypes in potato (Solanum tuberosum ssp.).

    Science.gov (United States)

    Finkers-Tomczak, Anna; Bakker, Erin; de Boer, Jan; van der Vossen, Edwin; Achenbach, Ute; Golas, Tomasz; Suryaningrat, Suwardi; Smant, Geert; Bakker, Jaap; Goverse, Aska

    2011-02-01

    The H1 locus confers resistance to the potato cyst nematode Globodera rostochiensis pathotypes 1 and 4. It is positioned at the distal end of chromosome V of the diploid Solanum tuberosum genotype SH83-92-488 (SH) on an introgression segment derived from S. tuberosum ssp. andigena. Markers from a high-resolution genetic map of the H1 locus (Bakker et al. in Theor Appl Genet 109:146-152, 2004) were used to screen a BAC library to construct a physical map covering a 341-kb region of the resistant haplotype coming from SH. For comparison, physical maps were also generated of the two haplotypes from the diploid susceptible genotype RH89-039-16 (S. tuberosum ssp. tuberosum/S. phureja), spanning syntenic regions of 700 and 319 kb. Gene predictions on the genomic segments resulted in the identification of a large cluster consisting of variable numbers of the CC-NB-LRR type of R genes for each haplotype. Furthermore, the regions were interspersed with numerous transposable elements and genes coding for an extensin-like protein and an amino acid transporter. Comparative analysis revealed a major lack of gene order conservation in the sequences of the three closely related haplotypes. Our data provide insight in the evolutionary mechanisms shaping the H1 locus and will facilitate the map-based cloning of the H1 resistance gene.

  1. Efecto antioxidante y citoprotector del Solanum tuberosum (papa en la mucosa gástrica de animales de experimentación

    Directory of Open Access Journals (Sweden)

    Miguel Sandoval-Vegas

    2010-07-01

    Full Text Available Introducción: Existen alternativas terapéuticas con productos naturales oriundos usados de manera empírica en la población. Tal es el caso del zumo de papa (Solanum tuberosum usado para problemas de mucosa gástrica. Objetivos: Evaluar la capacidad antioxidante y el efecto citoprotector a la mucosa gástrica del zumo de papa (Solanum tuberosum. Diseño: Experimental. Institución: Centro de Investigación de Bioquímica y Nutrición de la Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima. Materiales biológicos: Solanum tuberosum, variedad Tomasa y ratas albinas machos. Métodos: Se administró vía oral post ayuno las fracciones de sobrenadante y sedimento del zumo de Solanum tuberosum. Una hora después se administró alcohol como injuria de mucosa gástrica. Por laparotomía abdominal se obtuvo el tejido gástrico. Se midió en la mucosa gástrica el estrés oxidativo por lipoperoxidación, la formación de moco por alcian blue y la protección midiendo la extensión del área lacerada en imagen digitalizada. Principales medidas de resultados: Capacidad antioxidante y efecto citoprotector a la mucosa gástrica. Resultados: El sobrenadante de la dosis 5 mL/ kg produjo mayor protección al estrés oxidativo; el precipitado en dosis 5 mL/kg presentó mayor producción de moco, sin superar al control. El precipitado 20 mL/kg produjo mayor citoprotección (73,8%. Conclusión: La fracción sobrenadante del zumo de la papa (Solanum tuberosum posee actividad de defensa antioxidante y la fracción del sedimento, mayor actividad citoprotectora de la mucosa gástrica.

  2. Evaluation of Oxadiargyl Efficiency on Weed Control of Potato (Solanum tuberosum L. at Different Growth Stages

    Directory of Open Access Journals (Sweden)

    E. Samadi Kalkhoran

    2017-01-01

    Full Text Available Introduction: Potato (Solanum tuberosum L. is one of the most important root crops in the world. Weed is biotic stress that reduces yield and quality of crops through competition. Chemical weed control seems indispensable and has proved efficient in controlling weeds. Metribuzin and Paraquat are registered herbicides for potato production in Iran which are using early in the growing season. Metribuzin and Paraquat are dual purpose herbicides and destruct photosystem sites of action (Metribuzin is photosystem Ⅱ inhibitor and Paraquat is photosystem Ⅰ inhibitor which are not control summer weeds. Oxadiargyl belongs to the oxidiazole chemical group and acts as a protoporphyrinogen oxidase inhibitor and primarily has been developed for general weed control in rice and sugar cane. It is commonly used in rice, potato, sunflower, onion, cabbage, chickpea, spanish and lettuce and lavender. Weed control obtained with oxadiargyl at rates above 0.30 kg a.i/ ha was comparable to the standard metribuzin at 1.0 kg a.i/ ha; Oxadiargyl was superior comparing to the standard on Solanum nigrum, a weed of common occurrence in potato plantations, and Panicum subalbidum. The objective of our research was to evaluate the efficacy of Oxadiargyl for weed control and determination of appropriate application time in potato fields. Materials and Methods: Trials were conducted in Ardabil Agriculture and Natural Resources Research Station during 2013. The factorial experiment with control (with and without weeding was performed based on randomized complete block design with three replications. Potato cultivar was Agria (common cultivar in Ardabil. The first factor was Oxadiargyl dosages with six levels (0.05, 0.1, 0.2, 0.4, 0.6 and 0.8 Lit a.i/ ha, and the second factor was time of application (at different potato growth stages; potato emergence, stoloning and tuber bulking, as well as two treatments (with and without weeding were considered as control. Tubers were hand

  3. Influence of Species of Vesicular-Arbuscular Mycorrhizal Fungi and Phosphorus Nutrition on Growth, Development, and Mineral Nutrition of Potato (Solanum tuberosum L.).

    Science.gov (United States)

    McArthur, DAJ.; Knowles, N. R.

    1993-07-01

    Growth, development, and mineral physiology of potato (Solanum tuberosum L.) plants in response to infection by three species of vesicular-arbuscular mycorrhizal (VAM) fungi and different levels of P nutrition were characterized. P deficiency in no-P and low-P (0.5 mM) nonmycorrhizal plants developed between 28 and 84 d after planting. By 84 d after planting, P deficiency decreased plant relative growth rate such that no-P and low-P plants had, respectively, 65 and 45% less dry mass and 76 and 55% less total P than plants grown with high P (2.5 mM). A severe reduction in leaf area was also evident, because P deficiency induced a restriction of lateral bud growth and leaf expansion and, also, decreased the relative plant allocation of dry matter to leaf growth. Root growth was less influenced by P deficiency than either leaf or stem growth. Moreover, P-deficient plants accumulated a higher proportion of total available P than high-P plants, indicating that P stress had enhanced root efficiency of P acquisition. Plant P deficiency did not alter the shoot concentration of N, K, Mg, or Fe; however, the total accumulation of these mineral nutrients in shoots of P-stressed plants was substantially less than that of high-P plants. P uptake by roots was enhanced by each of the VAM symbionts by 56 d after planting and at all levels of abiotic P supply. Species differed in their ability to colonize roots and similarly to produce a plant growth response. In this regard, Glomus intraradices (Schenck and Smith) enhanced plant growth the most, whereas Glomus dimorphicum (Boyetchko and Tewari) was least effective, and Glomus mosseae ([Nicol. and Gerd.] Gerd. and Trappe) produced an intermediate growth response. The partial alleviation of P deficiency in no-P and low-P plants by VAM fungi stimulated uptake of N, K, Mg, Fe, and Zn. VAM fungi enhanced shoot concentrations of P, N, and Mg by 28 d after planting and, through a general improvement of overall plant mineral nutrition

  4. Estudio de libertad de operación para una línea genéticamente modificada de papa (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Alejandro Chaparro-Giraldo

    2014-01-01

    Full Text Available Título en ingles: Study of freedom to operate for a genetically modified potato (Solanum tuberosum L. line Título corto: Libertad de operación para papa GM Resumen: Durante el desarrollo de los productos biotecnológicos son utilizados materiales y procesos, que pueden estar protegidos por derechos de propiedad intelectual. Para evitar problemas legales en su comercialización, se deben realizar estudios de libertad de operación. Este estudio se realizó sobre una línea genéticamente modificada (GM de papa (Solanum tuberosum L. derivada de la variedad Pastusa Suprema, que expresa el gene Cry1Ac de Bacillus thuringiensis, desarrollada por la Corporación de Ciencias Biológicas y la Universidad Nacional de Colombia, Sede Medellín. El punto de partida, fue la deconstrucción del producto, cuyo resultado fue la lista de materiales y procesos usados en el desarrollo del producto. Se buscaron en bases de datos nacionales e internacionales de acceso público, las solicitudes de patentes y patentes relacionadas. En el nivel internacional, se encontraron cuatro solicitudes de patentes y dieciocho patentes relacionadas, la mayoría de las cuales, no han sido solicitadas en Colombia. En el nivel nacional, se encontraron 13 solicitudes de patentes, que han caducado, han sido negadas, abandonadas, desistidas, o están en requerimiento. Se encontró que la variedad tiene registro comercial, pero no título de obtentor. También se examinaron documentos de las instituciones participantes, que contuvieran cláusulas sobre propiedad intelectual, y otros documentos de interés, como los acuerdos de transferencia de materiales (ATM. Se concluye que la libertad de operación puede estar afectada más por problemas detectados en los ATM y en la complejidad de los acuerdos interinstitucionales suscritos, que por los derechos de propiedad intelectual. Palabras clave: Derechos de propiedad intelectual, biotecnología, cultivos transgénicos. Abstract:

  5. Actinomicetos aislados del compost y su actividad antagonista a fitopatógenos de la papa (Solanum tuberosum spp. andigena Hawkes)

    OpenAIRE

    Pérez-Rojas, Fernanda; León-Quispe, Jorge; Galindo-Cabello, Nadia

    2015-01-01

    Una de las formas de control de fitopatógenos es a través del uso de microorganismos antagonistas. El compost, un producto orgánico es fuente de microorganismos capaces de producir metabolitos secundarios de interés agrícola. Se aislaron y evaluaron mediante cultivos in vitro la capacidad antagonista de 85 actinomicetos frente a fitopatógenos que afectan a Solanum tuberosum. De los aislados, 23.5% tuvieron actividad antagonista a Ralstonia solanacearum, 16.4% a Pectobacterium carotovorum, 43....

  6. Genome-wide analysis of the Solanum tuberosum (potato) trehalose-6-phosphate synthase (TPS) gene family: evolution and differential expression during development and stress.

    Science.gov (United States)

    Xu, Yingchun; Wang, Yanjie; Mattson, Neil; Yang, Liu; Jin, Qijiang

    2017-12-01

    Trehalose-6-phosphate synthase (TPS) serves important functions in plant desiccation tolerance and response to environmental stimuli. At present, a comprehensive analysis, i.e. functional classification, molecular evolution, and expression patterns of this gene family are still lacking in Solanum tuberosum (potato). In this study, a comprehensive analysis of the TPS gene family was conducted in potato. A total of eight putative potato TPS genes (StTPSs) were identified by searching the latest potato genome sequence. The amino acid identity among eight StTPSs varied from 59.91 to 89.54%. Analysis of d N /d S ratios suggested that regions in the TPP (trehalose-6-phosphate phosphatase) domains evolved faster than the TPS domains. Although the sequence of the eight StTPSs showed high similarity (2571-2796 bp), their gene length is highly differentiated (3189-8406 bp). Many of the regulatory elements possibly related to phytohormones, abiotic stress and development were identified in different TPS genes. Based on the phylogenetic tree constructed using TPS genes of potato, and four other Solanaceae plants, TPS genes could be categorized into 6 distinct groups. Analysis revealed that purifying selection most likely played a major role during the evolution of this family. Amino acid changes detected in specific branches of the phylogenetic tree suggests relaxed constraints might have contributed to functional divergence among groups. Moreover, StTPSs were found to exhibit tissue and treatment specific expression patterns upon analysis of transcriptome data, and performing qRT-PCR. This study provides a reference for genome-wide identification of the potato TPS gene family and sets a framework for further functional studies of this important gene family in development and stress response.

  7. Elaboración de galletas a base de harina de papa de la variedad Parda Pastusa (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Andrés Felipe Cerón Cardenas

    2014-04-01

    Full Text Available La papa (Solanum tuberosum se considera el cuarto cultivo más importante en el mundo y su consumo ha pasado de producto fresco a producto laborado en forma industrial. En el estudio se determinó el nivel máximo de sustitución de la harina de trigo por harina de papa de la variedad Parda Pastusa en la elaboración de galletas fermentadas dulces. Se utilizó un diseño completamente al azar, donde el factor de estudio fueron el nivel de sustitución, 0%, 30%, 40% y 50%, y las variables de respuesta: sensoriales (color, sabor, textura y aceptabilidad y químicas proximales (materia seca, proteína, ceniza y grasa. No se encontraron diferencias (P < 0.05 en color, textura y aceptación; mientras para la variable sabor fue diferente en los niveles 0% y 30% de sustitución. Para los niveles de sustitución se encontraron, respectivamente, reducciones en contenido de proteína en 7.42%, 17.40% y 23.62%, y de grasa en 25.65%, 42.59% y 55.87%; mientras que la materia seca aumentó 3.83%, 4.95% y 5.62% y el contenido de ceniza en 13.14%, 17.71% y 23.43%, respectivamente. Con la sustitución de 30% se produjeron galletas de buena aceptación mientras que niveles mayores no son recomendables.

  8. Caracterización de zonas sensibles a heladas en el cultivo de papa (Solanum Tuberosum en Boyacá

    Directory of Open Access Journals (Sweden)

    Álvaro Enrique Alvarado-Gaona

    2011-02-01

    Full Text Available La papa (Solanum tuberosum, como todas las plantas cultivadas, depende de factores atmosféricos; por tanto, las heladas se convierten en un factor limitante para su producción, lo que ha ocasionado que los agricultores opten por cultivar en zonas con alturas superiores a 3.000 msnm, para ampliar la frontera agrícola. En estos sitios, las heladas son más severas, además del daño irreversible a los ecosistemas estratégicos como los páramos ya que la aplicación excesiva de agroquímicos y el sistema de monocultivo hacen que los suelos pierdan sus propiedades y por tanto, la producción disminuye. Por esta razón, el Centro Virtual de la Cadena Agroalimentaria de la papa CEVIPAPA, en convenio con la Universidad Pedagógica y tecnológica de Colombia, UPTC desarrolló un trabajo de investigación con el propósito de reconocer áreas sensibles a heladas en el departamento de Boyacá. El trabajo se desarrolló en los municipios de Toca, Motavita, Cómbita, Úmbita,Ventaquemada, Chíquiza, Tunja, Siachoque, Soracá y Saboyá,donde se evaluó la problemática causada por las heladas en este cultivo; así mismo, se detectaron las zonas de mayor producción, identificando las veredas con mayor incidencia en cada uno de los municipios, con el fin de controlar y mitigar los efectos negativos en el cultivote dicho tubérculo.

  9. Impact of the nutrients N and K and soluble sugars on Diabrotica speciosa (Germar) (Coleoptera, Chrysomelidae) and Agrotis ipsilon (Hufnagel) (Lepidoptera, Noctuidae) populations in potato crops, Solanum tuberosum L. (Solanaceae); Impacto dos nutrientes N e K e de acucares soluveis sobre populacoes de Diabrotica speciosa (Germar) (Coleoptera, Chrysomelidae) e Agrotis ipsilon (Hufnagel) (Lepidoptera, Noctuidae) na cultura da batata, Solanum tuberosum L. (Solanaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Azeredo, Edson Henrique de [Universidade Federal Fluminense (UFF), Pinheiral, RJ (Brazil). Pro-Reitoria de Extensao], e-mail: edsonhenrique.azeredo@bol.com.br; Lima, Eduardo [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil). Inst. de Agronomia. Dept. de Solos; Cassino, Paulo Cesar Rodrigues [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil). Inst. de Biologia. Centro Integrado de Manejo de Pragas C.R.G.

    2004-03-15

    Impact of the nutrients N and K and soluble sugars on Diabrotica speciosa (Germar) (Coleoptera, Chrysomelidae) and Agrotis ipsilon (Huefnagel) (Lepidoptera, Noctuidae) populations in potato crops, Solanum tuberosum L. (Solanaceae). The occurrence of Diabrotica speciosa (Germar, 1824) and Agrotis ipsilon (Huefnagel, 1767) on the potato cultivars Achat and Monalisa, influenced by nitrogen and potassium dosage, and minimum quantity of soluble sugars, was studied. The following parameters were evaluated: concentration of mineral nutrient and sugar in green leaf, senescent leaf, leaf in abscission, stem, tubercle and total plant using extracts of infusion in ethanol 80%. The largest infestation of D. speciosa larvae was on Monalisa cultivar at 150 kg.ha{sup -1} of N + K with 27.03% at P< 0,05. It was observed that the effect of the dosage of N + K in the increment of the concentration of soluble sugars increased the damages in the tubercles and stems by A. ipsilon. The infestation by these species increased to 58.82% on the Monalisa cultivar, when the nitrogen dosage increased from zero to 150 kg.ha{sup -1}, in the absence of potassium. On the other hand, high dosage of K reduced the damages by A. ipsilon on Monalisa cultivar. However, it did not influence the storage of soluble sugar. The results indicated that in Achat cultivar the accumulated soluble sugar was reduced, probably sensitized by elevation of potassic fertilization dosing, differing from Monalisa cultivar, in which the influence was by nitrogen dosing. (author)

  10. SNPs in genes functional in starch-sugar interconversion associate with natural variation of tuber starch and sugar content of potato (Solanum tuberosum L.).

    Science.gov (United States)

    Schreiber, Lena; Nader-Nieto, Anna Camila; Schönhals, Elske Maria; Walkemeier, Birgit; Gebhardt, Christiane

    2014-07-31

    Starch accumulation and breakdown are vital processes in plant storage organs such as seeds, roots, and tubers. In tubers of potato (Solanum tuberosum L.) a small fraction of starch is converted into the reducing sugars glucose and fructose. Reducing sugars accumulate in response to cold temperatures. Even small quantities of reducing sugars affect negatively the quality of processed products such as chips and French fries. Tuber starch and sugar content are inversely correlated complex traits that are controlled by multiple genetic and environmental factors. Based on in silico annotation of the potato genome sequence, 123 loci are involved in starch-sugar interconversion, approximately half of which have been previously cloned and characterized. By means of candidate gene association mapping, we identified single-nucleotide polymorphisms (SNPs) in eight genes known to have key functions in starch-sugar interconversion, which were diagnostic for increased tuber starch and/or decreased sugar content and vice versa. Most positive or negative effects of SNPs on tuber-reducing sugar content were reproducible in two different collections of potato cultivars. The diagnostic SNP markers are useful for breeding applications. An allele of the plastidic starch phosphorylase PHO1a associated with increased tuber starch content was cloned as full-length cDNA and characterized. The PHO1a-HA allele has several amino acid changes, one of which is unique among all known starch/glycogen phosphorylases. This mutation might cause reduced enzyme activity due to impaired formation of the active dimers, thereby limiting starch breakdown. Copyright © 2014 Schreiber et al.

  11. Visualisation of plastid outgrowths in potato (Solanum tuberosum L.) tubers by carboxyfluorescein diacetate staining.

    Science.gov (United States)

    Borucki, Wojciech; Bederska, Magdalena; Sujkowska-Rybkowska, Marzena

    2015-05-01

    We describe two types of plastid outgrowths visualised in potato tubers after carboxyfluorescein diacetate staining. Probable esterase activity of the outgrowths has been demonstrated for the first time ever. Plastid outgrowths were observed in the phelloderm and storage parenchyma cells of red potato (S. tuberosum L. cv. Rosalinde) tubers after administration of carboxyfluorescein diacetate stain. Endogenous esterases cleaved off acetic groups to release membrane-unpermeable green fluorescing carboxyfluorescein which accumulated differentially in particular cell compartments. The intensive green fluorescence of carboxyfluorescein exhibited highly branched stromules (stroma-filled plastid tubular projections of the plastid envelope) and allowed distinguishing them within cytoplasmic strands of the phelloderm cells. Stromules (1) were directed towards the nucleus or (2) penetrated the whole cells through the cytoplasmic bands of highly vacuolated phelloderm cells. Those directed towards the nucleus were flattened and adhered to the nuclear envelope. Stromule-like interconnections between two parts of the same plastids (isthmuses) were also observed. We also documented the formation of another type of the stroma-filled plastid outgrowths, referred to here as protrusions, which differed from previously defined stromules in both morphology and esterase activity. Unlike stromules, the protrusions were found to be associated with developmental processes leading to starch accumulation in the storage parenchyma cells. These results strongly suggest that stromules and protrusions exhibit esterase activity. This has been demonstrated for the first time. Morphological and biochemical features as well as possible functions of stromules and protrusions are discussed below.

  12. The chloroplast and mitochondrial DNA type are correlated with the nuclear composition of somatic hybrid calli of Solanum tuberosum and Nicotiana plumbaginifolia.

    Science.gov (United States)

    Wolters, A M; Koornneef, M; Gilissen, L J

    1993-09-01

    This paper describes the analysis of chloroplast (cp) DNA and mitochondrial (mt) DNA in 21 somatic hybrid calli of Solanum tuberosum and Nicotiana plumbaginifolia by means of Southern-blot hybridization. Each of these calli contained only one type of cpDNA; 14 had the N. plumbaginifolia (Np) type and seven the S. tuberosum (St) type. N. plumbaginifolia cpDNA was present in hybrids previously shown to contain predominantly N. plumbaginifolia chromosomes whereas hybrids in which S. tuberosum chromosomes predominated possessed cpDNA from potato. We have analyzed the mtDNA of these 21 somatic hybrid calli using four restriction enzyme/probe combinations. Most fusion products had only, or mostly, mtDNA fragments from the parent that predominated in the nucleus. The hybrids containing mtDNA fragments from only one parent (and new fragments) also possessed chloroplasts from the same species. The results suggest the existence of a strong nucleo-cytoplasmic incongruity which affects the genome composition of somatic hybrids between distantly related species.

  13. Efecto de la concentración de almidones resistentes de la papa común (Solanum tuberosum) y criolla (Solanum phureja) sobre la digestibilidad de nutrientes, energía metabolizable e integridad del tracto gastrointestinal de pollos de engorde

    OpenAIRE

    Rodríguez Aguilar, Daniel Eduardo

    2013-01-01

    El almidón resistente retrogradado (AR3) de las variedades Pastusa (Solanum tuberosum grupo andigena) y Guaneña (Solanum tuberosum grupo phureja) fue evaluado como aditivo funcional con características similares a la fibra dietaria. En un primer experimento se comparó con manano oligosacáridos (MOS) a tres niveles de inclusión (0.5%, 1.0% y 1.5%) y un control sin suplementar, donde 600 pollos machos Ross de un día de edad fueron repartidos aleatoriamente a 10 tratamientos ex...

  14. Guatemalan potato moth Tecia solanivora distinguish odour profiles from qualitatively different potatoes Solanum tuberosum L.

    Science.gov (United States)

    Karlsson, Miriam Frida; Birgersson, Göran; Witzgall, Peter; Lekfeldt, Jonas Duus Stevens; Nimal Punyasiri, P A; Bengtsson, Marie

    2013-01-01

    Guatemalan potato moth, Tecia solanivora, lay eggs in the soil nearby potato Solanum spp. and larvae feed on the tubers. We investigated the oviposition behaviour of T. solanivora females and the survival of larval offspring on healthy vs. stressed, i.e. light exposed and/or damaged potato tubers. In choice tests, females laid significantly more eggs in response to potato odour of healthy tubers and female oviposition preference correlated with higher larval survival. Survival of larvae was negatively correlated with the tuber content of the steroid glycoalkaloids α-solanine and α-chaconine: healthy potatoes contained lower amounts than stressed tubers, ranging from 25 to 500 μg g⁻¹ and from 30 to 600 μg g⁻¹, respectively. Analysis of volatile compounds emitted by potato tubers revealed that stressed tubers could clearly be distinguished from healthy tubers by the composition of their volatile profiles. Compounds that contributed to this difference were e.g. decanal, nonanal, isopropyl myristate, phenylacetaldehyde, benzothiazole, heptadecane, octadecane, myristicin, E,E-α-farnesene and verbenone. Oviposition assays, when female moths were not in contact with the tubers, clearly demonstrated that volatiles guide the females to lay fewer eggs on stressed tubers that are of inferior quality for the larvae. We propose that volatiles, such as sesquiterpenes and aldehydes, mediate oviposition behaviour and are correlated with biosynthetically related, non-volatile compounds, such as steroidal glycoalkaloids, which influence larval survival. We conclude that the oviposition response and larval survival of T. solanivora on healthy vs. stressed tubers supports the preference performance hypothesis for insect herbivores. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Growth, yield and quality attributes of a tropical potato variety (Solanum tuberosum L. cv Kufri chandramukhi) under ambient and elevated carbon dioxide and ozone and their interactions.

    Science.gov (United States)

    Kumari, Sumita; Agrawal, Madhoolika

    2014-03-01

    The present study was designed to study the growth and yield responses of a tropical potato variety (Solanum tuberosum L. cv. Kufri chandramukhi) to different levels of carbon dioxide (382 and 570ppm) and ozone (50 and 70ppb) in combinations using open top chambers (OTCs). Plants were exposed to three ozone levels in combination with ambient CO2 and two ozone levels at elevated CO2. Significant increments in leaf area and total biomass were observed under elevated CO2 in combination with ambient O3 (ECO2+AO3) and elevated O3 (ECO2+EO3), compared to the plants grown under ambient concentrations (ACO2+AO3). Yield measured as fresh weight of potato also increased significantly under ECO2+AO3 and ECO2+EO3. Yield, however, reduced under ambient (ACO2+AO3) and elevated ozone (ACO2+EO3) compared to ACO2 (filtered chamber). Number, fresh and dry weights of tubers of size 35-50mm and>50mm used for direct consumption and industrial purposes, respectively increased maximally under ECO2+AO3. Ambient as well as elevated levels of O3 negatively affected the growth parameters and yield mainly due to reductions in number and weight of tubers of sizes >35mm. The quality of potato tubers was also modified under different treatments. Starch content increased and K, Zn and Fe concentrations decreased under ECO2+AO3 and ECO2+EO3 compared to ACO2+AO3. Starch content reduced under ACO2+AO3 and ACO2+EO3 treatments compared to ACO2. These results clearly suggest that elevated CO2 has provided complete protection to ambient O3 as the potato yield was higher under ECO2+AO3 compared to ACO2. However, ambient CO2 is not enough to protect the plants under ambient O3 levels. Elevated CO2 also provided protection against elevated O3 by improving the yield. Quality of tubers is modified by both CO2 and O3, which have serious implications on human health at present and in future. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Variation of Growth and Disease Characters Between Clones of Potato (Solanum tuberosum L.)

    DEFF Research Database (Denmark)

    Nielsen, Steen Lykke; Bång, H; Kotkas, K

    2007-01-01

    The occurrence and magnitude of variation of selected characters in clones derived from meristem tips of four potato cultivars in field trials in three countries was assessed. Recorded were: the number of plants per plot; maturity of plants; skin and flesh colour; tuber deformity; time of emergence......; flowering; number of stems and tubers per plant; tuber size, yield and dry matter percentage; and the occurrence of common scab. Far more significant differences between clones than could be expected by chance were found for the last eight characters. Most of the significant differences for number of stems...... per plant, number of tubers, yield and tuber size distribution were found in six clones of three cultivars and were repeated at different locations and in different years. It is concluded that significant clone differences exist and are repeated at independent locations over the years...

  17. A major QTL and an SSR marker associated with glycoalkaloid content in potato tubers from Solanum tuberosum × S. sparsipilum located at chromosome I

    DEFF Research Database (Denmark)

    Sørensen, Kirsten Kørup; Kirk, Hanne Grethe; Olsson, Kerstin

    2008-01-01

    tubers and identify markers that link tightly to this trait. In this study, tubers of a dihaploid BC1 population, originating from a cross between 90-HAF-01 (S. tuberosum 1) and 90-HAG-15 (S. tuberosum 2 × S. sparsipilum), were evaluated for content of α-solanine and α-chaconine (total glycoalkaloid, TGA...... and the HAF parent. Quantitative trait loci for glycoalkaloid production in foliage of different Solanum species have previously been mapped to this chromosome. In the present research, QTLs for α-solanine and α-chaconine content were mapped to the same location as for TGA content. Similar results were...

  18. Occurrence of Tomato spotted wilt virus in Stevia rebaudiana and Solanum tuberosum in Northern Greece

    NARCIS (Netherlands)

    Chatzivassiliou, E.K.; Peters, D.; Lolas, P.

    2007-01-01

    Tomato spotted wilt virus (TSWV) (genus Tospovirus, family Bunyaviridae) was first reported in Greece during 1972 (3) and currently is widespread in the central and northern part of the country infecting several cultivated and wild plant species (1,2). In June 2006, virus-like symptoms similar to

  19. biotechnological studies on the irradiated potato (solanum tuberosum) with gamma rays

    International Nuclear Information System (INIS)

    Hassan, I.O.I.

    2011-01-01

    Bacterial wilt or brown rot disease caused by Ralstonia solanacearum causes extensive annual losses of different crops especially potato crop. It is considered as one of the limiting factors for potato production and exportation in Egypt. Therefore, the main purposes of this study were to investigate the effect of gamma rays on two potato cultivars (Diamant and Spunta). And, to obtain new genotypes of potato resistant to bacterial wilt disease. This study was carried out in the field and Biotechnology laboratory of the Plant Res. Dept., Nuclear Res. Center, Inshas, Egypt and Genetics Dept., Faculty of Agricultural., Cairo Univ., during 2008-2011. In the field experiment, dry tubers of potato cultivars were irradiated by different doses of gamma rays (20, 30 and 40 Gy) to study the effect of gamma rays on the vegetative and yield traits. The results showed that there are no significant differences between cultivars for all studied traits except a number of tubers per plant trait. Also, there are only highly significant and significant differences between treatments for weight of tubers per plant and number of tubers per plant traits, respectively. However, there are only significant differences between the interactions of cultivars and treatments for plant height and weight of tubers per plant traits. Six genotypes were selected from M 1 V 2 generation depending on high yield for RAPD analysis to determine their genetic variability from its parents at molecular level using 11 primers. The results of RAPD analysis showed that 11 primers generated 56 distinct bands of which 31 (55.4%) were considered as polymorphic. The similarity indices of six genotypes of potato and its parents ranged from 70 to 91%. The highest genetic similarity 91% was found between D20 genotype and its parent D0 (Diamant control). On the other hand, the lowest genetic similarity 70% was found between S30, S40 genotypes and its parent S0 (Spunta control). In the artificial infection experiment

  20. Efecto de la temperatura sobre la transferencia de agua durante la deshidratación osmótica de papa (Solanum tuberosum L.)

    OpenAIRE

    Silva Paz, Reynaldo Justino; Della Rocca, Patricia A.; Tisocco, Osvaldo D.; Mascheroni, Rodolfo Horacio

    2016-01-01

    El principal objetivo de este trabajo fue estudiar la cinética de deshidratación osmótica de papa (Solanum Tuberosum L.). Se comparó el ajuste de los datos experimentales con el modelo cinético fenomenológico y con el modelo de Azuara. Para ello, en cubos de 1 cm de arista se evaluó el efecto de la temperatura (30 ºC, 40 ºC y 50 ºC) sobre los coeficiente de difusión efectiva del agua y sólidos. Se determinó la pérdida de peso de agua y la ganancia de sólidos. Las mayores pérdidas de agua se o...

  1. Méthodes de mesure de l’âge physiologique des tubercules semences de pomme de terre (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    du Jardin P.

    2008-01-01

    Full Text Available Assessment methods of physiological age of potato seed tuber (Solanum tuberosum L.. The study of potato tuber ageing possesses both fundamental and applied interests. Because of potential economical impacts, numerous attempts have been made to develop reliable biophysical, physiological or biochemical markers of physiological age of seed tubers intended for vegetative multiplication. At the present time, biophysical markers do not meet this objective, the obtained results being contradictory or not very transposable. Some physiological markers seem well-suited but they are not predictive. The biochemical studies often focus on potato tuber developmental process or are undertaken without accurate physiological reference frame. After defining the main concepts, this study synthesizes and critically evaluates the different methods used to assess physiological age. An integrated research strategy based on existing data is finally proposed to study potato tuber ageing.

  2. Evaluation of Indigenous Potato Challisha (Solanum tuberosum L. Cv. Challisha Somaclonals Tolerance to Salinity In Vitro

    Directory of Open Access Journals (Sweden)

    Md. Sanaullah Biswas

    2017-04-01

    Full Text Available Potato is one of the most important food crops in the world. It is generally sensitive to salinity and likes to grow in neutral soil. On the other hand, salinity is increasing alarmingly in the ever changing climatic conditions. Thus, the selection of salt tolerant potato cultivars is necessary to keep pace the production of potato. To select salt tolerant cultivars, here we attempt to compare the salinity level between indigenous and modern cultivars. In vitro selection of local and modern potato cultivars were investigated with five levels of NaCl (0, 30, 60, 90 and 120 mM. The indigenous potato Challisha and modern cultivars Diamant and Felsina were used as plant materials. Significant differences were noticed among the cultivars in response to different levels of NaCl. Plant growth and root development were gradually reduced with increased concentration of NaCl. All three cultivars were survived well with exhibiting different growth status up to 60 mM NaCl, but they performed poorly at 120 mM of NaCl. Cultivar Challisha performed better regarding shoot length, root length, the number of nodes per plantlet and the fresh weight per plant up to 90 mM of NaCl. Thus, we can conclude that local indigenous variety Challisha is salt tolerant comparing with the modern cultivated varieties.

  3. Protein profiling in potato (Solanum tuberosum L.) leaf tissues by differential centrifugation.

    Science.gov (United States)

    Lim, Sanghyun; Chisholm, Kenneth; Coffin, Robert H; Peters, Rick D; Al-Mughrabi, Khalil I; Wang-Pruski, Gefu; Pinto, Devanand M

    2012-04-06

    Foliar diseases, such as late blight, result in serious threats to potato production. As such, potato leaf tissue becomes an important substrate to study biological processes, such as plant defense responses to infection. Nonetheless, the potato leaf proteome remains poorly characterized. Here, we report protein profiling of potato leaf tissues using a modified differential centrifugation approach to separate the leaf tissues into cell wall and cytoplasmic fractions. This method helps to increase the number of identified proteins, including targeted putative cell wall proteins. The method allowed for the identification of 1484 nonredundant potato leaf proteins, of which 364 and 447 were reproducibly identified proteins in the cell wall and cytoplasmic fractions, respectively. Reproducibly identified proteins corresponded to over 70% of proteins identified in each replicate. A diverse range of proteins was identified based on their theoretical pI values, molecular masses, functional classification, and biological processes. Such a protein extraction method is effective for the establishment of a highly qualified proteome profile.

  4. Cereal cystatins delay sprouting and nutrient loss in tubers of potato, Solanum tuberosum.

    Science.gov (United States)

    Munger, Aurélie; Simon, Marie-Aube; Khalf, Moustafa; Goulet, Marie-Claire; Michaud, Dominique

    2015-12-21

    Recent studies have reported agronomically useful ectopic effects for recombinant protease inhibitors expressed in leaves of transgenic plants, including improved tolerance to abiotic stress conditions and partial resistance to necrotrophic pathogens. Here we assessed the effects of these proteins on the post-dormancy sprouting of storage organs, using as a model potato tubers expressing cysteine protease inhibitors of the cystatin protein superfamily. Sprout emergence and distribution, soluble proteins, starch and soluble sugars were monitored in tubers of cereal cystatin-expressing clones stored for several months at 4 °C. Cystatin expression had a strong repressing effect on sprout growth, associated with an apparent loss of apical dominance and an increased number of small buds at the skin surface. Soluble protein content remained high for up to 48 weeks in cystatin-expressing tubers compared to control (untransformed) tubers, likely explained by a significant stabilization of the major storage protein patatin, decreased hydrolysis of the endogenous protease inhibitor multicystatin and low cystatin-sensitive cysteine protease activity in tuber tissue. Starch content decreased after several months in cystatin-expressing tubers but remained higher than in control tubers, unlike sucrose showing a slower accumulation in the transgenics. Plantlet emergence, storage protein processing and height of growing plants showed similar time-course patterns for control and transgenic tubers, except for a systematic delay of 2 or 3 d in the latter group likely due to limited sprout size at sowing. Our data point overall to the onset of metabolic interference effects for cereal cystatins in sprouting potato tubers. They suggest, in practice, the potential of endogenous cysteine proteases as relevant targets for the development of potato varieties with longer storage capabilities.

  5. Nematofauna asociada a la rizosfera de papas (Solanum tuberosum cultivadas en la zona productora del Cofre de Perote, Veracruz, México Nematode fauna associated with the rhizosphere of potato crop (Solanum tuberosum grown in the region of Cofre de Perote, Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Damaris Desgarennes

    2009-12-01

    Full Text Available Se determinaron y clasificaron en grupos tróficos las especies de nematodos asociados a la rizosfera de Solanum tuberosum en suelos altamente infectados por el nematodo dorado de la papa (Globodera rostochiensis en un ciclo de cultivo, en la zona productora del Cofre de Perote, Veracruz, México. Se identificaron 7 géneros (Aphelenchoides, Aphelenchus, Crassolabium, Mesodorylaimus, Plectus y Steinernema y 8 especies (Aporcelaimellus obtusicaudatus, Ecumenicus monohystera, Acrobeles mariannae, Acrobeles singulus, Acrobeloides nanus, Cruznema tripartitum, Eucephalobus oxyuroides, y Globodera rostochiensis en asociación con la rizosfera de papas cultivadas. Crassolabium sp. y E. monohystera se registran por primera vez para México.Nematode species associated with the rhizosphere of Solanum tuberosum were identified and classified into trophic groups from soils highly infected by the golden potato cyst nematode (Globodera rostochiensis in a single crop cycle in the producing zone on the Cofre de Perote, Veracruz, Mexico. Seven genera (Aphelenchoides, Aphelenchus, Crassolabium, Mesodorylaimus, Plectus and Steinernema and 8 species (Aporcelaimellus obtusicaudatus, Ecumenicus monohystera, Acrobeles mariannae, Acrobeles singulus, Acrobeloides nanus, Cruznema tripartitum, Eucephalobus oxyuroides, and Globodera rostochiensis were found in association with the rhizosphere of cultivated potatoes. Crassolabium sp. and E. monohystera are recorded for the first time in México.

  6. Effect of Different Plastic mulch on Growth and Yield of Potato (Solanum tuberosum

    Directory of Open Access Journals (Sweden)

    khosro parvizi

    2018-02-01

    Full Text Available Introduction: The advantages of plastic mulches have been known in production of agricultural crops. Their capability have been demonstrated to help nutrition uptake, precocity and yield of fruit trees, and decreasing of aphid population as viruses pest vectors. It is also demonstrated some advantages of plastic mulch on some traits in potato such as increasing growth rate, yield and number of medium tuber size. Also, the effects of combined use of straw, chopped and polyethylene as well as different levels of irrigation (60, 80, 100, 120% water requirement on yield and water use efficiency in potato have been investigated. In previous studies, it is concentrated on the effect of the special type of plastic on growing aspect of potato and there is no comparative assessment between different types of the mulches. So that in this research we evaluated the responses between types of plastic mulches. Material and Methods: this research was conducted under field conditions. A factorial experiment was designed based on randomized complete block design with three replications. The experimental treatments consisted of mulch in five levels (clear, white, black, double layer and control (without mulch and two cultivars (Agria and Sante. Each plot was designed in 4 m2. For every plot, ridges were divided into complicated double rows with 50 × 150 centimeters wide. Irrigation tapes were placed between every duplicated row. Water requirement was calculated through corrected evapotranspiration (ETo by Penman-Monteith equation with considering 90% water use efficiency. During the growing season some characteristics such as requirement time to 80% emergence, tuberization time, plant height in flowering time, number of stems and leaf area have been measured. Harvesting time was recorded along with measurement of tuber weights. Total yield was measured by random selection of one m2 in each plot. Harvested tubers were separated based on three sizes; edible tuber

  7. Agronomical indicators for determination of potato (Solanum tuberosum L. tolerance to drought

    Directory of Open Access Journals (Sweden)

    Alfredo Morales Rodríguez

    2016-01-01

    Full Text Available Lately, water shortage has caused 50% losses in potato yields in several Central American countries. Knowledge and use of more tolerant potato varieties are a critical element to increase production and yields under stressing conditions. The experiments were developed at the Center for Tropical Crops Research (INIVIT, between December 2014, and March 2015. Ten plots were planted, including different varieties. Half of them (5 were not irrigated for 20 days, starting on the 50th day after plantation (drought stress period. Irrigation was resumed on the 70th day. The Stress Susceptibility Index (SSI, Stress Tolerance Index (STI, Tolerance Index (TOL, Mean Productivity (MP, and Yield Stability Index (YSI. The Atlas and Maranca varieties had the lowest values for SSI (0.67 and 0.61, respectively, and the highest values for STI (0.79 and 0.81, respectively. The highest MP (19.92 t/ha was achieved by Atlas. The highest YSI values were observed in Maranca and Atlas (81.07 and 79.29, respectively.

  8. Caracterización de la respuesta fisiológica de tres variedades de papa (Solanum tuberosum L.) bajo condiciones de estrés por déficit hídrico

    OpenAIRE

    Rodriguez Pérez, Loyla

    2015-01-01

    En esta tesis se evalúo la respuesta fisiológica, bioquímica y de fenología de tres variedades colombianas de papa (Solanum tuberosum L.) sometidas a déficit hídrico y rehidratación. La hipótesis planteada fue que con base en el comportamiento de las variedades en las zonas de producción, las tres variedades de Solanum tuberosum L. presentarían respuesta diferencial a un período de déficit hídrico por suspensión del riego. El objetivo de este estudio fue determinar el comportam...

  9. Agro-transformation and evaluation of resistance to Phytophthora infestansin Solanum tuberosumL. variety Désirée

    Directory of Open Access Journals (Sweden)

    Jeanette Orbegozo

    2014-03-01

    Full Text Available The Oomycete Phytophthora infestans (Mont. de Bary, the causal agent of the disease known as late blight, is primarily responsible for the decreased in production performance and potato crops worldwide. The integration of the complete Rgenes sequences in the potato genome using Agro-transformation appears an alternative to be considered in the fight against this pathogen. The Rpi-blb2 gene (Rgene from the wild species Solanum bulbocastanumDunal shows a broad resistance to isolates ofP. infestans,making it an important candidate for plant breeding studies. This paper reports the integration of the Rpi-blb2gene into potato var. Désirée genome by Agrobacterium tumefaciens- mediated transformation system, the molecular characterization of 29 events transformed and whole plant infection with isolate POX67 of P. infestansfrom Peru. Désirée events [Rpi-blb2] 4 and Désirée [Rpi-blb2] 30, showed a substantial resistance to P. infestansinfection confirming complete transfer of the Rpi-blb2gene from a wild species to a cultivated species by genetic transformation.

  10. Characterization of chromosome instability in interspecific somatic hybrids obtained by X-ray fusion between potato (Solanum tuberosum L.) and S. brevidens Phil

    International Nuclear Information System (INIS)

    Fehér, A.; Preiszner, J.; Litkey, Z.; Csanádi, G; Dudits, D.

    1992-01-01

    Asymmetric somatic hybrids between Solanum tuberosum L. and S. brevidens Phil. have been obtained via the fusion of protoplasts from potato leaves and from cell suspension culture of S. brevidens. The wild Solanum species served as donor after irradiation of its protoplasts with a lethal X-ray dose (200 Gy). Selection of the putative hybrids was based on the kanamycin-resistance marker gene previously introduced into the genome of Solanum brevidens by Agrobacterium-mediated gene transfer. Thirteen out of the 45 selected clones exhibited reduced morphogenic potential. The morphological abnormalities of the regenerated plantlets were gradually eliminated during the extended in vitro culture period. Cytological investigations revealed that the number of chromosomes in the cultured S. brevidens cells used as protoplast source ranged between 28-40 instead of the basic 2n=24 value. There was a high degree of aneuploidy in all of the investigated hybrid clones, and at least 12 extra chromosomes were observed in addition to the potato chromosomes (2n=48). Interand intraclonal variation and segregation during vegetative propagation indicated the genetic instability of the hybrids, which can be ascribed to the pre-existing and X-ray irradiation-induced chromosomal abnormalities in the donor S. brevidens cells. The detection of centromeric chromosome fragments and long, poly-constrictional chromosomes in cytological preparations as well as non-parental bands in Southern hybridizations with restriction fragment length polymorphism (RFLP) markers revealed extensive chromosome rearrangements in most of the regenerated clones. On the basis of the limited number of RFLP probes used, preferential loss of S. brevidens specific markers with a non-random elimination pattern could be detected in hybrid regenerants

  11. Propuesta de un sistema de transformación de plantas de papa (Solanum tuberosum sp. andigena var. Pastusa suprema mediado por Agrobacterium tumefaciens

    Directory of Open Access Journals (Sweden)

    López Alfredo

    2007-06-01

    Full Text Available

    Se ha demostrado que la transformación de papa (Solanum tuberosum mediada por Agrobacterium tumefaciens es dependiente del genotipo y que la mayoría de protocolos de transformación reportados son ineficientes al aplicarlos en la subespecie andigena. En esta propuesta se manejaron los procesos iniciales de mejoramiento genético de la nueva variedad colombiana de papa Pastusa suprema (Solanum tuberosum sp. andigena que es altamente androestéril, característica de gran importancia para los organismos modificados genéticamente. Esta variedad resultó de la hibridación interespecífica de tres especies de papa (Solanum stoloniferum, Solanum phureja var. Yema de huevo y Solanum tuberosum sp. andigena var. Parda pastusa. Se transformaron explantes internodales mediante el vector pCambia2301 que posee un gen reportero de la β-glucoronidasa y un gen de resistencia a la kanamicina. Se obtuvo un porcentaje de transformación inicial de 31 ± 2,5%, que se expresó mediante formación de callo sobre medios de selección y una frecuencia final con base en el ensayo GUS de 30%. Este es el primer reporte de transformación de un híbrido interespecífico de tres especies diferentes.

  12. Climate Change and Potassium Effects Under Different N-Fertilization Input on Potato (Solanum tuberosum L.) Yield in a Long Term Field Experiment

    Science.gov (United States)

    László, Márton, ,, Dr.

    2010-05-01

    achieved with poor N, P, K and Mg nutrient supply even with a normal quantity and distribution of rainfall. Yield was influenced by rainfall to a greater extent (Table 4) than by 150 kg ha-1 potassium combinations (NK, NPK, NPKMg). Drought and over rainfall negative effects were decreased by increasing N- doses with combinations of potassium, phosphorous and magnesium from 13 to 32% (Table 5 and 6). With the help of regression analysis it was found the polynomial correlation between rainfall and yield could be observed in the case of NK (Y'=381.65-2.95x+0.0056x2, n=72, R2=0.95), NPK (Y'=390.87-3.07x+0.0060x2, n=72, R2=0.96) and NPKMg (Y'=390.45-3.06x+0.0059x2, n=72, R2=0.96) nutrition systems. The optimum yield ranges between 17-20 t ha-1 at 280-330 mm of rainfall. From 1962 to 1979 the weather was highly variable, with particularly frequent droughts and over rainfall resulting in yield losses of 13 to 32 percentin in this period. Thus it is important to analyse the consequences of possible future climate change on crop in Hungary. REFERENCES A.E. Johnston. 2000. Some aspects of nitrogen use efficiency in arable agriculture. K. Scogs-o. Lantbr. Akad. Tidskr. 139: 8. Kádár, I-Márton, L.-Horváth, S. 2000. Mineral fertilisation of potato (Solanum tuberosum L.) on calcareous chernozem soil. Plant Production. 49: 291-306. László, M. 2000. Nutrition of potato (Solanum tuberosum L.) on Hungary on a chernozem soil. Acta Agronomica Óváriensis. 42: 81-93. László, M. 2001a. Climate change and N, P, K, Mg fertilization effects on potato (Solanum tuberosum L.) yield and quality. EAPR. Hamburg. In press László, M. 2001b. Year and N- fertilizer effect on winter rye (Secale cereale L.) yield in a long term field experiment. XLIII. Georgikon Days. University of Veszprém. Keszthely László, M.-Imre, K.-Jose, E.M. 2000a. Effects of Crotalaria juncea L. and Crotalaria spectabilis ROTH. on soil fertility and soil conservation in Hungary. Acta Agronomica Óváriensis. 42: 99

  13. Variedades de batatinha (Solanum tuberosum L.. I - Comportamento de 12 variedades procedentes da Holanda, Alemanha e Suécia Behavior of twelve potato varieties from European sources

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1956-01-01

    Full Text Available No presente trabalho são relatadas experiências com 12 variedades de batatinha (Solanum tuberosum L., recebidas da Holanda (Prinslander, Irene, Froma e Barima, Alemanha (Merkur, Sabina, Linda e Concordia e Suécia Konsuragis, Eigenheimer, Voran e Jätte-Bintje. Essas experiências, em número de seis, das quais três no chamado período "da sêca" (março-julho e três no "das águas" (setembro-janeiro, foram executadas nas localidades de Campinas, Louveira o Capão Bonito, no Estado de São Paulo. Ficou evidenciado o seguinte: a dado o bom estado de brotação dos tubérculos, as porcentagens de falhas no plantio "da sêca" foram baixas; já no plantio "das águas", as variedades de brotação lenta, como "Voran" e "Sabina", falharam muito; b "Prinslander" e "Konsuragis" resistiram bem à sêca prolongada, e "Barima" o "Linda" mostraram ser muito sensíveis; c "Linda", "Voran" e "Merkur", principalmente a primeira destas, apresentaram boa resistência a Phytophthora infestans, e "Jätte-Bintje" foi muito suscetível; "Voran", "Irene", "Prinslander" e "Barima" não ofereceram resistência a Alternaria solani; d "Merkur" e "Konsuragis" foram as mais produtivas para as duas épocas de plantio, sendo que "nas águas", "Eigenheimer", "Barima", "Concordia" e Jätte-Bintje", também produziram bem. Outros aspectos relacionados com variedades foram estudados.Twelve potato varieties imported from Holland (Prinslander, Irene, Froma, and Barima, Germany (Merkur, Sabina, Linda, and Concordia, and Sweden (Konsuragis, Eigenheimer, Voran, and Jätte-Bintje were compared in six experiments carried out at three different localities in the state of São Paulo (Campinas, Louveira, and Capão Bonito. The experiments were planted twice a year, once during the so-called dry season (March lo July, and another time during the rainy season (September to March. The following results were obtained: a plantings made in the dry season had a good stand, whereas this was

  14. Sustainable Agriculture and Climate Change: Producing Potatoes (Solanum tuberosum L. and Bush Beans (Phaseolus vulgaris L. for Improved Food Security and Resilience in a Canadian Subarctic First Nations Community

    Directory of Open Access Journals (Sweden)

    Christine D. Barbeau

    2015-05-01

    Full Text Available Aboriginal people in Canada experience disproportionately high rates of diet-related illnesses, such as obesity and diabetes. Food insecurity has been identified as a contributing factor to these illnesses along with a loss of traditional lifestyle. Current food systems within northern subarctic and arctic regions of Canada rely heavily on imported foods that are expensive (when available, and are environmentally unsustainable. A warming subarctic and arctic climate present challenges, but also offers the opportunity for local agricultural production that can increase food security and promote a more sustainable food system. In this study the feasibility of sustainably growing potatoes (Solanum tuberosum L. utilizing agroforestry practices to enhance food security in remote subarctic communities is explored through a case study in Fort Albany First Nation in northern Ontario, Canada. Potato crops were grown over a two-year period and rotated into plots that had been planted with green bush beans (Phaseolus vulgaris L.. Results showed that potatoes and bush beans could be grown successfully in the subarctic without the use of greenhouses with yields comparable to more conventional high-input agricultural methods. In subarctic Canada, sustainable local food production can help to promote social capital, healthier lifestyles, and food security.

  15. Impact of the nutrients N and K and soluble sugars on Diabrotica speciosa (Germar) (Coleoptera, Chrysomelidae) and Agrotis ipsilon (Hufnagel) (Lepidoptera, Noctuidae) populations in potato crops, Solanum tuberosum L. (Solanaceae)

    International Nuclear Information System (INIS)

    Azeredo, Edson Henrique de; Lima, Eduardo; Cassino, Paulo Cesar Rodrigues

    2004-01-01

    Impact of the nutrients N and K and soluble sugars on Diabrotica speciosa (Germar) (Coleoptera, Chrysomelidae) and Agrotis ipsilon (Huefnagel) (Lepidoptera, Noctuidae) populations in potato crops, Solanum tuberosum L. (Solanaceae). The occurrence of Diabrotica speciosa (Germar, 1824) and Agrotis ipsilon (Huefnagel, 1767) on the potato cultivars Achat and Monalisa, influenced by nitrogen and potassium dosage, and minimum quantity of soluble sugars, was studied. The following parameters were evaluated: concentration of mineral nutrient and sugar in green leaf, senescent leaf, leaf in abscission, stem, tubercle and total plant using extracts of infusion in ethanol 80%. The largest infestation of D. speciosa larvae was on Monalisa cultivar at 150 kg.ha -1 of N + K with 27.03% at P -1 , in the absence of potassium. On the other hand, high dosage of K reduced the damages by A. ipsilon on Monalisa cultivar. However, it did not influence the storage of soluble sugar. The results indicated that in Achat cultivar the accumulated soluble sugar was reduced, probably sensitized by elevation of potassic fertilization dosing, differing from Monalisa cultivar, in which the influence was by nitrogen dosing. (author)

  16. Detección de Ca Liberibacter solanacearum y fitoplasmas en cultivo de papa (Solanum tuberosum L. en el Valle de Toluca

    Directory of Open Access Journals (Sweden)

    Ana Tarin Gutiérrez-Ibáñez

    2013-01-01

    Full Text Available Título en ingles: Detection of Ca Liberibacter solanacearum and phytoplasma in potato crop (Solanum tuberosum L. in Toluca Valley Título corto: Detección de Ca Liberibacter solanacearum y fitoplasmas Resumen En México y Centro América se han detectado tubérculos de papa con manchado interno. Recientemente en Texas EUA a esta enfermedad se le ha denominado “Zebra Chip” (ZC o rayado de la papa, los síntomas foliares se asemejan al síndrome denominado “Punta Morada de la Papa” (PMP o enfermedad del “amarillamiento por psilidos” la cual es asociada con la presencia de “Candidatus Liberibacter solanacearum”. El objetivo de esta investigación fue detectar la presencia de esta bacteria y de fitoplasmas en plantas de papa que presentaban la coloración purpura de los foliolos. Durante el ciclo primavera – verano 2011 y 2012 se hizo un muestreo en los municipios de Tenango del Valle, Zinacantepec, Villa de Allende y San José del Rincón, del Estado de México. La detección de ambos patógenos se realizó mediante la reacción en cadena de la polimerasa (PCR con los iniciadores específicos para fitoplasmas: P1/P7, R16mF2/R16mR1 y para Ca Liberibacter solanacearum: OA2/Oi2c, resultando el 35,8% de las plantas positivas para fitoplasmas y el 11,6% para la bacteria. Los resultados indican  que en algunas regiones productoras de papa del Estado de México,  los dos presuntos agentes causales del síndrome de  PMP, fitoplasmas y Ca. Liberibacter solanacearum, pueden estar asociados. Palabras clave: Candidatus Liberibacter solanacearum; Fitoplasma; punta morada. Abstract In Mexico and Central America have been detected stained potato tubers with internal browning; recently in Texas, USA, this disease has been called "Zebra Chip" (ZC or striped potato, foliar symptoms resemble the syndrome called "Potato Purple Top" (PPT or "psyllid yellows" disease which is associated with the presence of "Candidatus liberibacter solanacearum

  17. Agronomic and environmental studies of potato (Solanum tuberosum L.) and analysis of its value chain in Zimbabwe

    NARCIS (Netherlands)

    Svubure, O.

    2015-01-01

    Keywords: Irish potato, food security, stakeholder analysis, sustainability indicators, Cool Farm Tool-Potato, yield gap, resource use efficiency, LINTUL-POTATO model, Zimbabwe.

    Oniward Svubure (2015). Agronomic and environmental studies of potato (Solanum

  18. Assessment of Paclobutrazol’s Time and Concentration of Foliar Application on Production and Germination of Potato (Solanum tuberosum L. Mini-tube

    Directory of Open Access Journals (Sweden)

    B Saadatian

    2018-02-01

    Full Text Available Introduction Health and quality of potato (Solanum tuberosum L. seeds are important in the potato seed production technology. Moreover, the basic seed materials must be free of pathogens. Therefore tissue culture techniques are used at this stage in the laboratory to produce disease free seeds. Mini-tubers can be produced after acclimatization from plantlets as tissue culture which are planted at high densities in the greenhouse in beds or containers using different substrate mixtures, or even in hydroponic culture. Foliar application of growth regulators is a way to increase potato mini-tuber production. Growth regulators influence on potato mini-tuber dormancy. Triazoles, a family which Paclobutrazol belongs to them, have both fungitoxic and plant growth regulatory effects. In addition, they can also protect plants against various stresses. Therefore, the triazoles have been characterized as plant multi-protestants. Paclobutrazol changes the relationship between source and sink and by this way, affects plant production. Also, it can inhibit giberellic acid biosynthesis. Some morphological changes observed in paclobutrazol-treated plants include the inhibition of plant growth, decreased inter-nodal elongation and increased root to shoot ratios. Time of paclobutrazol foliar application is an important factor which changes plant characters (Lim et al., 2004. This study implemented to evaluate foliar application of paclobutrazol concentrations at different time on production and mini-tuber dormancy. Materials and Methods The factorial experiment based on randomized complete block design with four replications was conducted at the faculty of agriculture’s research greenhouse, Ferdowsi University of Mashhad, Iran, in 2013. Plantlets of Agria cv. produced from nodal tissue culture in Murashinge and Skoog (MS medium. After 25 days, plantlets of free disease and uniform exported to plastic pots with 12 cm diameter and 30 cm height. Perlite, cocopite

  19. Combination of the auxins NAA, IBA, and IAA with GA3 improves the commercial seed-tuber production of potato (Solanum tuberosum L.) under in vitro conditions.

    Science.gov (United States)

    Kumlay, Ahmet Metin

    2014-01-01

    The study compared the effects of 1.0 × MS medium containing various concentrations of α-naphthaleneacetic acid (NAA), indole-3-acetic acid (IAA), and indole-3-butyric acid (IBA), alone or in combination with gibberellic acid (GA3) in micropropagation of three potato (Solanum tuberosum L.) cultivars Pasinler, Granola, and Caspar using binodal stem cuttings. The results testified improved regeneration on 1.0 × MS medium containing variants of NAA, IAA, and IBA plus GA3 on all cultivars. The minimum days to shoot induction on three cultivars ranged 4.25-5 d on 1.0 × MS medium containing 0.25 mg L(-1) GA3 + 1 mg L(-1) NAA. The longest shoots (11.8 cm), maximum number of nodes (13.50), and maximum number of leaves (11.00) were recorded on cv. Caspar on 1.0 × MS medium containing 1 mg L(-1) NAA + 0.25 mg L(-1) GA3. The minimum time to root induction (12.25 d) was noted on cv. Pasinler on the same medium. All of the regenerated shoots could be easily rooted. The results showed that the combined effect of various concentrations of NAA, IAA, and IBA plus GA3 was more pronounced compared to the auxins used alone. The results of this research are of significant importance for potato breeders.

  20. Evaluación de diferentes combinaciones fitohormonales en la regeneración de Solanum tuberosum (Solanaceae Var. Pastusa Suprema a partir de explantes internodales

    Directory of Open Access Journals (Sweden)

    Jenny Paola Jiménez Barreto

    2009-07-01

    Full Text Available La regeneración de plantas mediante el cultivo de tejidos es un importante componente de la biotecnología que es requerido para procesos tales como la obtención de plantas transgénicas. Se estableció un sistema eficiente de regeneración para la especie Solanum tuberosum L. var. Pastusa Suprema, susceptible de ser transformada genéticamente. Se evaluó el efecto de las fitohormonas zeatina ribósido (ZR, ácido naftalénacetico (ANA y ácido gibérelico (AG3, utilizadas en combinaciones específicas, sobre la inducción de callo, la regeneración y el número de brotes producidos por explante. La presencia de ANA demostró ser esencial en la respuesta callogénica y regenerativa de los explantes. Se encontró que la adición de 3,0 mg/L de ZR, 0,02 mg/L de ANA y 1,0 mg/L de AG3 sobre un medio básico M-S, es una formulación hormonal adecuada para inducir el proceso de organogénesis indirecta sobre la variedad de papa Pastusa Suprema; produce callogénesis y regeneración en porcentajes superiores al 90%, con un promedio de seis regenerantes por explante.

  1. The effect of in vitro mycorrhization on growth characteristics, changes in endogenous hormones and performance of microplants in potato (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Khosro PARVIZI

    2015-12-01

    Full Text Available Potato (Solanum tuberosum L. plantlets were inoculated in vitro with an arbuscular mycorrhizal fungus (Glomus intraradices and their growth response, performance and endogenous hormonal status evaluated. A factorial experiment based on a completely randomized design consisting of two potato cultivars (Agria and Sante and four culture media was conducted with four replications. The culture media included non-inoculated Murashige and Skoog (MS medium (control, inoculated MS medium, inoculated half-strength MS medium and inoculated MS medium without vitamins and sugar. To do inoculation, germinated spores of fungus were transferred to the root zone of plantlets. Colonization percentage, total chlorophyll content, internodes and stolon length, shoot diameter, shoot and root fresh and dry weight, leaf area and the level of three endogenous hormones (total auxins, gibberellins and cytokinins were determined. In addition, mini-tuber production was assayed quantitatively and qualitatively. Results demonstrated that the effect of two factors on all characteristics including mini-tuber production was different significantly. Interaction between cultivar and inoculation systems was significantly associated with endogen auxins as well as all range of mini-tuber production. The inoculated MS medium showed the better results, but it did not have significant difference to half-strength MS in terms of plantlet performance and growing parameters. Responses of both cultivars to inoculation were very conspicuous in the production of endogen hormones. Higher endogen hormone levels were associated with elevated growth parameters, greater biomass production and better plantlet performance.

  2. Purification of a novel chitin-binding lectin with antimicrobial and antibiofilm activities from a bangladeshi cultivar of potato (Solanum tuberosum).

    Science.gov (United States)

    Hasan, Imtiaj; Ozeki, Yasuhiro; Kabir, Syed Rashel

    2014-04-01

    A new chitin-binding lectin was purified from a Bangladeshi cultivar 'Deshi' of potato (Solanum tuberosum L.) through anion-exchange and affinity chromatographies using a chitin column. Sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) showed the molecular mass of the lectin as 20,000 Daltons. This molecular mass was almost half of the molecular masses of chitin-binding lectins derived from other potatoes. The lectin showed both bactericidal and growth-inhibiting activities against Gram-positive (Listeria monocytogenes) and Gram-negative (Escherichia coli, Salmonella enteritidis and Shigella boydii) pathogenic bacteria. It also showed antifungal activity against Rhizopus spp., Penicillium spp. and Aspergillus niger. Biofilm produced by the bacterium Pseudomonas aeruginosa was dose-dependently reduced by 5-20% in 24 h after administration of the lectin, which was attributed to the glycan-binding property of the lectin having affinity to GlcNAc polymers. It was the first observation that any potato lectin prevented biofilm formation by P. aeruginosa and, therefore, could have possible applications in clinical microbiology and biomedical science.

  3. Infestation of potato (Solanum tuberosum L.) by the peach-potato aphid (Myzus persicae Sulzer) alters cellular redox status and is influenced by ascorbate.

    Science.gov (United States)

    Kerchev, Pavel I; Fenton, Brian; Foyer, Christine H; Hancock, Robert D

    2012-02-01

    The peach-potato aphid (Myzus persicae Sulzer) is a major pest of potato (Solanum tuberosum L.) but the molecular characterization of this interaction particularly with regard to oxidants and antioxidants remains to be undertaken. Aphid colonies reared on potato leaves containing high ascorbate were twice the size of those grown on leaves with low ascorbate. Infestation-dependent decreases in the abundance of key transcripts such as chloroplastic FeSOD, peroxisomal catalase 2, PR1 and JAZ1 preceded detectable leaf H(2)O(2) or polyphenol accumulation. The leaf glutathione pool was increased 48 h after infestation, but the amount of ascorbate was unchanged. The ascorbate/dehydroacorbate (DHA) ratio was lower at 48 h but the ratio of reduced glutathione (GSH) to oxidized glutathione (GSSG) was unchanged. While DHA reductase and GSSG reductase activities were unaffected by aphid feeding, non-specific peroxidase activities were enhanced 48 h following aphid infestation. Brown ethanol-insoluble deposits were observed close to leaf veins following aphid infestation. Taken together, the results demonstrate that high ascorbate favours aphid colony expansion and that perturbations in the leaf antioxidant system are intrinsic to the potato leaf response to aphids. Moreover, these changes together with the induction of hormone-related transcripts precede the deposition of defence-associated oxidized polyphenols along the stylet track. © 2011 Blackwell Publishing Ltd.

  4. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development.

    Science.gov (United States)

    Gao, Junpeng; Cao, Xiaoli; Shi, Shandang; Ma, Yuling; Wang, Kai; Liu, Shengjie; Chen, Dan; Chen, Qin; Ma, Haoli

    2016-03-04

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Comprehensive genome-wide analysis of Glutathione S-transferase gene family in potato (Solanum tuberosum L.) and their expression profiling in various anatomical tissues and perturbation conditions.

    Science.gov (United States)

    Islam, Md Shiful; Choudhury, Mouraj; Majlish, Al-Nahian Khan; Islam, Tahmina; Ghosh, Ajit

    2018-01-10

    Glutathione S-transferases (GSTs) are ubiquitous enzymes which play versatile functions including cellular detoxification and stress tolerance. In this study, a comprehensive genome-wide identification of GST gene family was carried out in potato (Solanum tuberosum L.). The result demonstrated the presence of at least 90 GST genes in potato which is greater than any other reported species. According to the phylogenetic analyses of Arabidopsis, rice and potato GST members, GSTs could be subdivided into ten different classes and each class is found to be highly conserved. The largest class of potato GST family is tau with 66 members, followed by phi and lambda. The chromosomal localization analysis revealed the highly uneven distribution of StGST genes across the potato genome. Transcript profiling of 55 StGST genes showed the tissue-specific expression for most of the members. Moreover, expression of StGST genes were mainly repressed in response to abiotic stresses, while largely induced in response to biotic and hormonal elicitations. Further analysis of StGST gene's promoter identified the presence of various stress responsive cis-regulatory elements. Moreover, one of the highly stress responsive StGST members, StGSTU46, showed strong affinity towards flurazole with lowest binding energy of -7.6kcal/mol that could be used as antidote to protect crop against herbicides. These findings will facilitate the further functional and evolutionary characterization of GST genes in potato. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Comparación cuantitativa de ácido abscísico y citoquininas en la tuberización de Solanum tuberosum L. y Solanum phureja Juz. et Buk.

    Directory of Open Access Journals (Sweden)

    Ortiz Luz Yineth

    2008-04-01

    Full Text Available

    De las 30 variedades de papa cultivadas en Colombia tan solo 10 poseen importancia comercial. Entre otros factores, este número es limitado por la acción de hormonas endógenas que aceleran diferentes fases del proceso de tuberización, especialmente en las especies más precoces. En este trabajo fueron recolectadas muestras de tubérculos de diferentes especies de papa (Solanum tuberosum L. var. ICA-Única y Tuquerreña, y Solanum phureja Juz. et Buk. var. Yema de Huevo, en los estadios fenológicos de desarrollo 03, 10 y 40. Posteriormente, las concentraciones de ácido abscísico (ABA presentes en la fracción ácida y de citoquininas presentes en la fracción orgánica de los extractos fueron determinadas a través de Cromatografía Líquida de Alta Eficiencia. Los resultados en las variedades estudiadas relacionan la precocidad de la tuberización con la ausencia de ABA y los periodos de mayor latencia con su presencia; por otro lado, las concentraciones de citoquininas fueron evidentes en las variedades con mayor precocidad. Es decir, en S. phureja Juz. et Buk. var. Yema de Huevo se encontraron concentraciones bajas de ABA y altas de citoquininas; mientras que en ICA-Única y, en especial, en Tuquerreña, variedades con periodos de latencia mayor, las concentraciones de ABA fueron altas y las de citoquininas menos significativas.

  7. Control biológico del Tizón Tardío Phytophthora infestans en papa Solanum tuberosum a través de consorcios microbianos formados por hongos nativos del género Trichoderma sp.

    OpenAIRE

    Bustamante Gavilanes, Adriana Elizabeth

    2015-01-01

    Esta investigación evalúo la eficiencia de consorcios microbianos formados por hongos nativos del género Trichoderma sp. como biocontroladores del tizón tardío Phytophthora infestans en papa Solanum tuberosum. En las pruebas de antagonismo las cepas del género Trichoderma sp. inhibieron en promedio entre 83% y 87% al patógeno. En base a los resultados obtenidos en el ensayo de campo mostró que el tratamiento T3: Trichoderma harzianum+ Trichoderma sp. + Trichoderma atroviride es más efectivo ...

  8. Detección Serológica y Molecular del Virus PVY N y su variante PVY NTN en Papa (Solanum tuberosum L.) y Hospedantes Alternos en Tapalpa, México

    OpenAIRE

    Hernández-de la Cruz, Miguel; Gómez-Leyva, Juan Florencio; López-Muraira, Irma Guadalupe; Dimas-Estrada, María Susana; Andrade-González, Isaac; Ireta-Moreno, Javier

    2007-01-01

    Se realizó un muestreo en cultivos de papa (Solanum tuberosum) para semilla en la zona productora de Tapalpa, Jalisco, México, así como de maleza e insectos asociados al cultivo con el objetivo de determinar la presencia del virus PVY N y su variante PVY NTN. Mediante técnicas serológicas y moleculares se analizaron 41 variedades de papa, 19 de Tapalpa, y 22 provenientes de Toluca, Estado de México. Con la técnica de DAS-ELISA, la variedad Malinche de Tapalpa fue positiva a PVY N, mientras qu...

  9. Combination of the Auxins NAA, IBA, and IAA with GA3 Improves the Commercial Seed-Tuber Production of Potato (Solanum tuberosum L.) under In Vitro Conditions

    Science.gov (United States)

    Kumlay, Ahmet Metin

    2014-01-01

    The study compared the effects of 1.0 × MS medium containing various concentrations of α-naphthaleneacetic acid (NAA), indole-3-acetic acid (IAA), and indole-3-butyric acid (IBA), alone or in combination with gibberellic acid (GA3) in micropropagation of three potato (Solanum tuberosum L.) cultivars Pasinler, Granola, and Caspar using binodal stem cuttings. The results testified improved regeneration on 1.0 × MS medium containing variants of NAA, IAA, and IBA plus GA3 on all cultivars. The minimum days to shoot induction on three cultivars ranged 4.25–5 d on 1.0 × MS medium containing 0.25 mg L−1  GA3 + 1 mg L−1 NAA. The longest shoots (11.8 cm), maximum number of nodes (13.50), and maximum number of leaves (11.00) were recorded on cv. Caspar on 1.0 × MS medium containing 1 mg L−1  NAA + 0.25 mg L−1 GA3. The minimum time to root induction (12.25 d) was noted on cv. Pasinler on the same medium. All of the regenerated shoots could be easily rooted. The results showed that the combined effect of various concentrations of NAA, IAA, and IBA plus GA3 was more pronounced compared to the auxins used alone. The results of this research are of significant importance for potato breeders. PMID:25028654

  10. Producción de polihidroxialcanoatos por bacterias halófilas nativas utilizando almidón de cáscaras de Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    César Guzmán

    2017-01-01

    Full Text Available The aim of this study was to determine the concentration of starch Solanum tuberosum L. “potato” peels for the production of polyhydroxyalkanoates, PHA, from native halophilic bacteria as an alternative to reduce production costs of these biopolymers, possible replacements for petrochemical plastics. The bacteria were isolated of water samples of eight saline Lamba yeque region and were enriched in HM 1 broth at 30 °C with 5, 10, 15, 20, 25 and 30 g 100 mL - 1 NaCl. Dilutions were performed subsequently, aliquots were taken and plated on HM 1 agar, 203 isolates of halophilic bacteria were obtained, they were grown in HM 2 broth with 10 g.L - 1 glucose as carbon source and the 38.92% of the isolates showed PHA granules stained by Sudan Black B. Twenty bacteria with PHA granules in 65 – 75% over carried to fermentation, reaching between 0.174 to 0.889 g . g - 1 of yield Y (p / x. Three isolates were selected with the highest values among which Halomonas sp M4C1 grew and synthesized PHA in HM 2 broth with 5, 10, 15 and 20 g . L - 1 of starch as carbon source, reaching 0.019; 0.016; 0.007 y 0.006 g . L - 1 of PHA, with 0.177; 0.111; 0.056 an d 0.066 g . L - 1 of biomass after 20, 40, 24 and 16 hours respectively. The highest yield of 0.144 g . g - 1 corresponded to 10 g . L - 1 of starch demonstrating that this concentration is feasible PHA production by native halophilic bacteria.

  11. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development

    International Nuclear Information System (INIS)

    Gao, Junpeng; Cao, Xiaoli; Shi, Shandang; Ma, Yuling; Wang, Kai; Liu, Shengjie; Chen, Dan; Chen, Qin; Ma, Haoli

    2016-01-01

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. - Highlights: • A systematic analysis of the potato AUX/IAA gene family were performed. • StIAA genes were related to auxin perception and signal transduction. • Candidate StIAA genes likely related to tuber initiation and expansion were screened.

  12. Development of diagnostic markers for use in breeding potatoes resistant to Globodera pallida pathotype Pa2/3 using germplasm derived from Solanum tuberosum ssp. andigena CPC 2802.

    Science.gov (United States)

    Moloney, Claire; Griffin, Denis; Jones, Peter W; Bryan, Glenn J; McLean, Karen; Bradshaw, John E; Milbourne, Dan

    2010-02-01

    Quantitative resistance to Globodera pallida pathotype Pa2/3, originally derived from Solanum tuberosum ssp. andigena Commonwealth Potato Collection (CPC) accession 2802, is present in several potato cultivars and advanced breeding lines. One genetic component of this resistance, a large effect quantitative trait locus (QTL) on linkage group IV (which we have renamed GpaIV(adg)(s)) has previously been mapped in the tetraploid breeding line 12601ab1. In this study, we show that GpaIV(adg)(s) is also present in a breeding line called C1992/31 via genetic mapping in an F(1) population produced by crossing C1992/31 with the G. pallida susceptible cultivar Record. C1992/31 is relatively divergent from 12601ab1, confirming that GpaIV(adg)(s) is an ideal target for marker-assisted selection in currently available germplasm. To generate markers exhibiting diagnostic potential for GpaIV(adg)(s), three bacterial artificial chromosome clones were isolated from the QTL region, sequenced, and used to develop 15 primer sets generating single-copy amplicons, which were examined for polymorphisms exhibiting linkage to GpaIV(adg)(s) in C1992/31. Eight such polymorphisms were found. Subsequently, one insertion/deletion polymorphism, three single nucleotide polymorphisms and a specific allele of the microsatellite marker STM3016 were shown to exhibit diagnostic potential for the QTL in a panel of 37 potato genotypes, 12 with and 25 without accession CPC2082 in their pedigrees. STM3016 and one of the SNP polymorphisms, C237(119), were assayed in 178 potato genotypes, arising from crosses between C1992/31 and 16 G. pallida susceptible genotypes, undergoing selection in a commercial breeding programme. The results suggest that the diagnostic markers would most effectively be employed in MAS-based approaches to pyramid different resistance loci to develop cultivars exhibiting strong, durable resistance to G. pallida pathotype Pa2/3.

  13. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Junpeng [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Innovation Experimental College, Northwest A& F University, Yangling, Shaanxi 712100 (China); Cao, Xiaoli; Shi, Shandang [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Ma, Yuling [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Innovation Experimental College, Northwest A& F University, Yangling, Shaanxi 712100 (China); Wang, Kai; Liu, Shengjie [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Chen, Dan [School of Life Sciences and Technology, Xidian University, Xi' an, Shaanxi 710071 (China); Chen, Qin [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Ma, Haoli, E-mail: mahaoli@nwsuaf.edu.cn [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China)

    2016-03-04

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. - Highlights: • A systematic analysis of the potato AUX/IAA gene family were performed. • StIAA genes were related to auxin perception and signal transduction. • Candidate StIAA genes likely related to tuber initiation and expansion were screened.

  14. Two carbon fluxes to reserve starch in potato (Solanum tuberosum L.) tuber cells are closely interconnected but differently modulated by temperature.

    Science.gov (United States)

    Fettke, Joerg; Leifels, Lydia; Brust, Henrike; Herbst, Karoline; Steup, Martin

    2012-05-01

    Parenchyma cells from tubers of Solanum tuberosum L. convert several externally supplied sugars to starch but the rates vary largely. Conversion of glucose 1-phosphate to starch is exceptionally efficient. In this communication, tuber slices were incubated with either of four solutions containing equimolar [U-¹⁴C]glucose 1-phosphate, [U-¹⁴C]sucrose, [U-¹⁴C]glucose 1-phosphate plus unlabelled equimolar sucrose or [U-¹⁴C]sucrose plus unlabelled equimolar glucose 1-phosphate. C¹⁴-incorporation into starch was monitored. In slices from freshly harvested tubers each unlabelled compound strongly enhanced ¹⁴C incorporation into starch indicating closely interacting paths of starch biosynthesis. However, enhancement disappeared when the tubers were stored. The two paths (and, consequently, the mutual enhancement effect) differ in temperature dependence. At lower temperatures, the glucose 1-phosphate-dependent path is functional, reaching maximal activity at approximately 20 °C but the flux of the sucrose-dependent route strongly increases above 20 °C. Results are confirmed by in vitro experiments using [U-¹⁴C]glucose 1-phosphate or adenosine-[U-¹⁴C]glucose and by quantitative zymograms of starch synthase or phosphorylase activity. In mutants almost completely lacking the plastidial phosphorylase isozyme(s), the glucose 1-phosphate-dependent path is largely impeded. Irrespective of the size of the granules, glucose 1-phosphate-dependent incorporation per granule surface area is essentially equal. Furthermore, within the granules no preference of distinct glucosyl acceptor sites was detectable. Thus, the path is integrated into the entire granule biosynthesis. In vitro C¹⁴C-incorporation into starch granules mediated by the recombinant plastidial phosphorylase isozyme clearly differed from the in situ results. Taken together, the data clearly demonstrate that two closely but flexibly interacting general paths of starch biosynthesis are functional

  15. Characterization of StABF1, a stress-responsive bZIP transcription factor from Solanum tuberosum L. that is phosphorylated by StCDPK2 in vitro.

    Science.gov (United States)

    Muñiz García, María Noelia; Giammaria, Verónica; Grandellis, Carolina; Téllez-Iñón, María Teresa; Ulloa, Rita María; Capiati, Daniela Andrea

    2012-04-01

    ABF/AREB bZIP transcription factors mediate plant abiotic stress responses by regulating the expression of stress-related genes. These proteins bind to the abscisic acid (ABA)-responsive element (ABRE), which is the major cis-acting regulatory sequence in ABA-dependent gene expression. In an effort to understand the molecular mechanisms of abiotic stress resistance in cultivated potato (Solanum tuberosum L.), we have cloned and characterized an ABF/AREB-like transcription factor from potato, named StABF1. The predicted protein shares 45-57% identity with A. thaliana ABFs proteins and 96% identity with the S. lycopersicum SlAREB1 and presents all of the distinctive features of ABF/AREB transcription factors. Furthermore, StABF1 is able to bind to the ABRE in vitro. StABF1 gene is induced in response to ABA, drought, salt stress and cold, suggesting that it might be a key regulator of ABA-dependent stress signaling pathways in cultivated potato. StABF1 is phosphorylated in response to ABA and salt stress in a calcium-dependent manner, and we have identified a potato CDPK isoform (StCDPK2) that phosphorylates StABF1 in vitro. Interestingly, StABF1 expression is increased during tuber development and by tuber-inducing conditions (high sucrose/nitrogen ratio) in leaves. We also found that StABF1 calcium-dependent phosphorylation is stimulated by tuber-inducing conditions and inhibited by gibberellic acid, which inhibits tuberization.

  16. ( Solanum spp. ) and spider plant ( Cleome gynandra )

    African Journals Online (AJOL)

    Vitamin C is an important micronutrient because of its antioxidant and health promoting properties. With the introduction and commercialization of improved African indigenous plants, few studies have examined the impact of leaf age or the nutrient status of the plants by fertilizer. This study sought to determine amounts of ...

  17. Análisis de la interacción genotipo por ambiente en papa (Solanum tuberosum spp. andigena, a través de una metodología no paramétrica Analysis of genotype by environment interaction in potato (Solanum tuberosum spp. andigena by a non-parametric methodology

    Directory of Open Access Journals (Sweden)

    Cortes José M.

    2000-12-01

    Full Text Available El Programa de Mejoramiento en Papa, liderado por la Universidad Nacional de Colombia, estableció nueve pruebas regionales durante los años 1998 y 1999, para la evaluación de 20 genotipos promisorios de Solanum tuberosum subsp. andigena. Para el análisis e interpretación de la interacción genotipo por ambiente, se utilizó la metodología no paramétrica propuesta por Nassar et al. (1994, en la cual se usa un estadístico que reúne la selección por rendimiento y estabilidad fenotípica. Para la obtención de los índices
    de rendimiento-estabilidad, se implementó una MACRO en el
    programa SAS, la cual permite trabajar con datos desbalanceados, tanto por repeticiones, como por genotipos. Además, se desarrolló una metodología que permitió el análisis multivariado, utilizando, como base el estadístico de rendimiento-estabilidad, lo cual facilita el análisis del rendimiento cuando éste se divida en varias categorías, como el es caso del cultivo de papa. Los resultados, aquí, presentados muestran cómo las ventajas del uso de
    metodologías no paramétricas, no son compensadas cuando la mayor importancia del análisis de la interacción genotipo por ambiente es la selección de genotipos promisorios próximos a ser entregados al agricultor.The Potato Breeding Program, which belongs to the National
    University ofColombia, carried out nine regional trials during 1998 and 1999 for the evaluation of20 promissory genotypes of Solanum tuberosum ssp. andigena. The non-pararnetric methodology proposed by Nassar el al. (1994 which it is based on a statistic that link yield and phenotypic stability was used. In order to analyzer the data set, a MACRO program in the SAS System was developed which allowed working with unbalance data for both repetitions and genotypes. It was also developed a multivariate analysis methodology, based on the yield-stability index, which permitted to analyze the yield when it is partitioning in

  18. DETERMINACIÓN DEL EFECTO DE DIFERENTES NIVELES DE FERTILIZACIÓN EN PAPA (SOLANUM TUBEROSUM SSP. ANDIGENA DIACOL CAPIRO EN UN SUELO CON PROPIEDADES ÁNDICAS DE SANTA ROSA DE OSOS, COLOMBIA DETERMINATION OF THE EFFECT OF DIFFERENT LEVELS OF FERTILIZATION IN POTATO (SOLANUM TUBEROSUM SSP. ANDIGENA DIACOL CAPIRO IN A SOIL WITH PROPERTIES ANDICAS OF SANTA ROSA DE OSOS, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Jairo Yovani Rios Quinchoa

    2010-06-01

    Full Text Available La fertilización es una labor que cumple con la necesidad de suplementar a la planta, los nutrientes no satisfechos por el suelo en su condición de fertilidad natural. Por muchas décadas se han utilizado dosis deficientes que conducen a bajas producciones, y en ocasiones dosis excesivas de fertilizantes químicos que pueden generar problemas ambientales. La fertilización con nutrientes secundarios (Ca, Mg, S y el micronutriente B, han sido poco estudiadas en el cultivo de papa, razón por la cual se evaluó, en el Centro Agropecuario Paysandú de la Universidad Nacional de Colombia (Medellín, el efecto de diferentes dosis de estos nutrientes en un cultivo de papa (Solanum tuberosum spp. Andigena de la variedad DIACOL Capiro en un suelo con propiedades ándicas de Santa Rosa de Osos. Se utilizaron dosis bajas, moderadas y altas de NPK, Ca, Mg, B y S, y se encontró una respuesta positiva en rendimiento a las aplicaciones crecientes de NPK (500, 1.500 y 3000 kg ha-1, también se presentaron diferencias significativas en peso de los tubérculos de primera y segunda categoría, mientras que los tubérculos de tercera y cuarta categoría no presentaron diferencias significativas. Las interacciones entre Ca, Mg, B y S no tuvieron efecto apreciable sobre el rendimiento de los tubérculos, ya que en la mayoría de los casos solo se observaron los efectos simples de dichos elementos.The fertilization is a work that fulfills the supplementary to the plant nutritional necessities that are not satisfied by the soil, in its condition of natural fertility. For many decades faulty doses has been used that take to low productions, and in occasions excessive doses of chemical fertilizers that lead to environmental problems. The fertilization with nutritious secondary (Ca, Mg, S and the micronutrient B, has been little studied in potato crop in Colombia; for this reason, we evaluated, in the Centro de Investigacion e Innovación Agropecuaria y Forestal

  19. Efeito do Solo do Materias Organicos E do Adubo Formula 4N:14P:8K Para Producao DA Batata (Solanum tuberosum L.) Semente Pre-Basica no Casa de Vegetacao

    Science.gov (United States)

    László, Márton

    2010-05-01

    hard effect (57%). Our results are shown that it was possible developing of the seed potato production under tropical greenhouse conditions by optimalised soil-organic matter-fertilizer system. This datas should be as indicators to sustainable field potato advisory systems. Keywords: potato (Solanum tuberosum L.), greenhouse, latossolo vermelho soil, farmyard manure, burnt rice straw, 4N:14P:8K fertilizer, sustainability, yield RESUMO A batata é atualmente uma das hortaliças de maior importância no Brasíl. Nos conduzirémos os três experimentos para aumentár-se do produção e produtividade da batata (Solanum tuberosum L.) semente pré- básica no casa de vegetação da Brazília-DF, no Empresa Brasileira de Pesquisa Agropecuaria- Centro Nacional de Pesquisas de Hortaliças no 1990. Os três experimentos (latossolo vermelho novo x esterco de curral x palha de arroz queimado, latossolo vermelho novo x adubo 4:14:8 NPK, latossolo vermelho novo x esterco de curral x palha de arroz queimado x adubo 4:14:8 NPK) no casa de vegetação foram conduzidos com total 29 combinações, no 5-5-3 repetições com total parcelas de 116. Os resultados foram submetidos a analise de variáncia, ANOVA e MANOVA. Nossos principal resultados estam apresentándo abaixo. 1. A mistura de 80% latossolo vermelho novo, 10% palha de arroz queimado e 10% de esterco de curral, apresentou os maiores valores para numero de tuberculos com 0-20 mm, peso total de tuberculos com 0-20 mm e peso total de tuberculos por vaso. 2. Há um efeito grande crescente das doses de 4N:14P:8K nos caracteres observados. 3. Analise-se do latossolo vermelho novo x esterco de curral x palha de arroz queimado x adubo 4:14:8 NPK experimento os resultados apresentárám-se que entre nas misturas também foi melhor a 80% latossolo vermelho novo, 10% palha de arroz queimado, 10% esterco de curral. Examinando-se 15 fatores, entre 11 casos afirmou-se a mistura como para melhor que a outra mistura. Nossos resultados

  20. Solanum tuberosum y Solanum commersonii, sobre-expresando el gen ScCBFI, mejoraron su tolerancia a sequía en condiciones de cultivo in vitro

    OpenAIRE

    Pino, María Teresa; Ávila, Andrea; Molina, Andrea; Jeknic, Zoran; Chen, Tony H.H

    2013-01-01

    Cultivated potato crops are sensitive to drought stress, reducing yield and tuber quality when the soil water potential drops to -0.3 MPa. However, drought not only affects plant growth and physiological activity, but this stress also induces biochemical and molecular changes in the cellular gene expression profile. triggering genes that play a direct role in plant protection and gene regulation. The genes involved in regulation include C-repeat Binding Factors/Dehydration responsive element ...

  1. Interspecific somatic hybrid plants between eggplant (Solanum melongena) and Solanum torvum.

    Science.gov (United States)

    Guri, A; Sink, K C

    1988-10-01

    Mesophyll protoplasts of eggplant (cv Black Beauty) and of Solanum torvum (both 2n=2x=24) were fused using a modification of the Menczel and Wolfe PEG/DMSO procedure. Protoplasts post-fusion were plated at 1 × 10(5)/ml in modified KM medium, which inhibited division of S. torvum protoplasts. One week prior to shoot regeneration, ten individual calluses had a unique light-green background and were verified as cell hybrids by the presence of the dimer isozyme patterns for phosphoglucoisomerase (PGI) and glutamate oxaloacetate transaminase (GOT). Hybridity was also confirmed at the plant stage by DNA-DNA hybridization to a pea 45S ribosomal RNA gene probe. The ten somatic hybrid plants were established in the greenhouse and exhibited intermediate morphological characteristics such as leaf size and shape, flower size, shape, color and plant stature. Their chromosome number ranged from 46-48 (expected 2n=4x=48) and pollen viability was 5%-70%. In vitro shoots taken from the ten hybrid plants exhibited resistance to a verticillium wilt extract. Total DNA from the ten hybrids was restricted and hybridized with a 5.9 kb Oenothera chloroplast cytochrome f gene probe, a 2.4 kb EcoRI clone encoding mitochondrial cytochrome oxidase subunit II from maize and a 22.1 kb Sal I mitochondrial clone from Nicotiana sylvestris. Southern blot hybridization patterns showed that eight of ten somatic hybrids contained the eggplant cpDNA, while two plants contained the cpDNA hybridization patterns of both parents. The mtDNA analysis revealed the presence of novel bands, loss of some specific parental bands and mixture of specific bands from both parents in the restriction hybridization profiles of the hybrids.

  2. Modeling the influence of raindrop size on the wash-off losses of copper-based fungicides sprayed on potato (Solanum tuberosum L.) leaves.

    Science.gov (United States)

    Pérez-Rodríguez, Paula; Paradelo, Marcos; Rodríguez-Salgado, Isabel; Fernández-Calviño, David; López-Periago, José Eugenio

    2013-01-01

    Modeling the pesticide wash-off by raindrops is important for predicting pesticide losses and the subsequent transport of pesticides to soil and in soil run-off. Three foliar-applied copper-based fungicide formulations, specifically the Bordeaux mixture (BM), copper oxychloride (CO), and a mixture of copper oxychloride and propylene glycol (CO-PG), were tested on potato (Solanum tuberosum L.) leaves using a laboratory raindrop simulator. The losses in the wash-off were quantified as both copper in-solution loss and copper as particles detached by the raindrops. The efficiency of the raindrop impact on the wash-off was modeled using a stochastic model based on the pesticide release by raindrops. In addition, the influence of the raindrop size, drop falling height, and fungicide dose was analyzed using a full factorial experimental design. The average losses per dose after 14 mm of dripped water for a crop with a leaf area index equal to 1 were 0.08 kg Cu ha(-1) (BM), 0.3 kg Cu ha(-1) (CO) and 0.47 kg Cu ha(-1) (CO-PG). The stochastic model was able to simulate the time course of the wash-off losses and to estimate the losses of both Cu in solution and as particles by the raindrop impacts. For the Cu-oxychloride fungicides, the majority of the Cu was lost as particles that detached from the potato leaves. The percentage of Cu lost increased with the decreasing raindrop size in the three fungicides for the same amount of dripped water. This result suggested that the impact energy is not a limiting factor in the particle detachment rate of high doses. The dosage of the fungicide was the most influential factor in the losses of Cu for the three formulations studied. The results allowed us to quantify the factors that should be considered when estimating the losses by the wash-off of copper-based fungicides and the inputs of copper to the soil by raindrop wash-off.

  3. Evaluación de cinco genotipos promisorios de papa Solanum tuberosum sp. andigena según desempeño agronómico y calidad industrial

    Directory of Open Access Journals (Sweden)

    Martínez Nancy M.

    2005-06-01

    Full Text Available

    Con base en variables cualitativas y cuantitativas se llevó a cabo la evaluación de cinco genotipos promisorios de papa Solanum tuberosum sp. andigena pertenecientes a la Corporación Colombiana de Investigación Agropecuaria –CORPOICA– y de la variedad Diacol Capiro, en siete localidades del país. Los resultados se analizaron por métodos univariados y multivariados para conocer las características que discriminaban a los materiales. En el análisis multivariado de componentes principales, los primeros cuatro componentes representan el 95,22% de la variación total. Las variables de mayor influencia fueron época de maduración, época de emergencia, peso total de los tubérculos por parcela, peso de los tubérculos de tamaño primera, peso de los tubérculos de tamaño cero, peso de los tubérculos de tamaño cuarta, gravedad específica y materia seca. Se detectó que existe interacción significativa entre genotipo y ambiente para las variables de rendimiento en frito y calidad industrial, las cuales, según el análisis de estabilidad fenotípica de Kang (1991, permitieron seleccionar los clones 2, 7 y 14 como los más rendidores y estables según las características peso total de los tubérculos por parcela, materia seca y rendimiento en frito. Considerando el índice de rendimiento y la estabilidad fenotípica combinadas, el clon 7 se recomienda como el material más promisorio.

  4. Extensive Variation in Fried Chip Color and Tuber Composition in Cold-Stored Tubers of Wild Potato (Solanum) Germplasm

    Science.gov (United States)

    Cold-induced sweetening and browning in the Maillard reaction have driven extensive research in the areas of plant physiology, biochemistry, and food science in Solanum tuberosum. To date, research in these areas excluded wild relatives of potato. This is the first assessment of cold-stored tuber c...

  5. Growth and stress response in Arabidopsis thaliana, Nicotiana benthamiana, Glycine max, Solanum tuberosum and Brassica napus cultivated under polychromatic LEDs

    Czech Academy of Sciences Publication Activity Database

    Janda, Martin; Navrátil, Oldřich; Haisel, Daniel; Jindřichová, Barbora; Fousek, Jan; Burketová, Lenka; Čeřovská, Noemi; Moravec, Tomáš

    2015-01-01

    Roč. 11, MAY 3 (2015) ISSN 1746-4811 R&D Projects: GA ČR GA13-26798S; GA ČR(CZ) GAP501/12/1942; GA ČR(CZ) GAP501/12/1761; GA ČR(CZ) GA15-10768S Institutional support: RVO:61389030 Keywords : LED * Fluorescent tubes * Plant physiology Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 3.449, year: 2015

  6. PENGARUH KONSENTRASI GIBERELIN TERHADAP PRODUKSI BIBIT KENTANG (SOLANUM TUBEROSUM L. CV. GRANOLA UKURAN M (31 - 60 GRAM

    Directory of Open Access Journals (Sweden)

    Ni Luh Arpiwi

    2007-06-01

    Full Text Available The aim of the research was to increase the production of seed potato size 31 - 60 grams by applying gibberellic acid (GA3. Seeds that passed their dormancy period were dipped in gibberellic acid solutions (10, 15 and 20 mg/L for 15 minutes a day before planting. Control seeds were dipped in water. Seeds were then air dried for 24 hours. Seeds were planted in plots with length, width and height of 150 x 100 x 30 cm respectively with planting space 20 cm and planting depth 15 cm. The design was randomized block with four replications. The results showed that gibberellic acid enhanced shoot emergence. Gibberellic acid increased stem number, tuber number and yield per plant. Tuber number and yield of size M (31 ? 60 g increased, whereas tuber number and yield of size LL decreased drastically. The optimum concentration of gibberellin for these increases was 15 mg/L. Plant height was not influenced by gibberellic acid.

  7. Functional characterization of a p-coumaroyl quinate/shikimate 3’-hydroxylase from potato (Solanum tuberosum)

    Science.gov (United States)

    Chlorogenic acid (CGA) plays an important role in protecting plants against pathogens and promoting human health. Although CGA accumulates to high levels in potato tubers, the key enzyme p-coumaroyl quinate/shikimate 3’-hydroxylase (C3’H) for CGA biosynthesis has not been isolated or characterized i...

  8. Effect of Acinetobacter sp on metalaxyl degradation and metabolite profile of potato seedlings (Solanum tuberosum L. alpha variety.

    Directory of Open Access Journals (Sweden)

    Fabiola G Zuno-Floriano

    Full Text Available One of the most serious diseases in potato cultivars is caused by the pathogen Phytophthora infestans, which affects leaves, stems and tubers. Metalaxyl is a fungicide that protects potato plants from Phytophthora infestans. In Mexico, farmers apply metalaxyl 35 times during the cycle of potato production and the last application is typically 15 days before harvest. There are no records related to the presence of metalaxyl in potato tubers in Mexico. In the present study, we evaluated the effect of Acinetobacter sp on metalaxyl degradation in potato seedlings. The effect of bacteria and metalaxyl on the growth of potato seedlings was also evaluated. A metabolite profile analysis was conducted to determine potential molecular biomarkers produced by potato seedlings in the presence of Acinetobacter sp and metalaxyl. Metalaxyl did not affect the growth of potato seedlings. However, Acinetobacter sp strongly affected the growth of inoculated seedlings, as confirmed by plant length and plant fresh weights which were lower in inoculated potato seedlings (40% and 27%, respectively compared to the controls. Acinetobacter sp also affected root formation. Inoculated potato seedlings showed a decrease in root formation compared to the controls. LC-MS/MS analysis of metalaxyl residues in potato seedlings suggests that Acinetobacter sp did not degrade metalaxyl. GC-TOF-MS platform was used in metabolic profiling studies. Statistical data analysis and metabolic pathway analysis allowed suggesting the alteration of metabolic pathways by both Acinetobacter sp infection and metalaxyl treatment. Several hundred metabolites were detected, 137 metabolites were identified and 15 metabolic markers were suggested based on statistical change significance found with PLS-DA analysis. These results are important for better understanding the interactions of putative endophytic bacteria and pesticides on plants and their possible effects on plant metabolism.

  9. Obtención de plantas sanas de papa, Solanum tuberosum L. Variedad salentuna. A través de las técnicas de termoterapia y cultivo de meristemas in vitro.

    Directory of Open Access Journals (Sweden)

    Marulanda Aguirre Adriana

    2001-09-01

    Full Text Available Se obtuvieron plantas Super Elite de papa (Solanum tuberosum L., de la variedad regional Salentuna, catalogada como papa filia, implementando las técnicas de termoterapia, cultivo in vitro de meristemas y multiplicación acelerada. Se limpió esta variedad del complejo de enfermedades que la afectaban, para entregarle a los productores un material sano que los motive a regresar al campo con una alternativa de producción de mayor calidad y rentabilidad. La falta de semilla sana es una necesidad sentida por los agricultores del departamento de Caldas, pues hace más de treinta años que no se renueva el material vegetal y no existen programas de producción de semilla certificad de esta variedad en el país.

  10. Transgenic potato (Solanum tuberosum) tubers synthesize the full spectrum of inulin molecules naturally occurring in globe artichoke (Cynara scolymus) roots

    Science.gov (United States)

    Hellwege, Elke M.; Czapla, Sylvia; Jahnke, Anuschka; Willmitzer, Lothar; Heyer, Arnd G.

    2000-01-01

    The ability to synthesize high molecular weight inulin was transferred to potato plants via constitutive expression of the 1-SST (sucrose:sucrose 1-fructosyltransferase) and the 1-FFT (fructan: fructan 1-fructosyltransferase) genes of globe artichoke (Cynara scolymus). The fructan pattern of tubers from transgenic potato plants represents the full spectrum of inulin molecules present in artichoke roots as shown by high-performance anion exchange chromatography, as well as size exclusion chromatography. These results demonstrate in planta that the enzymes sucrose:sucrose 1-fructosyltransferase and fructan:fructan 1-fructosyltransferase are sufficient to synthesize inulin molecules of all chain lengths naturally occurring in a given plant species. Inulin made up 5% of the dry weight of transgenic tubers, and a low level of fructan production also was observed in fully expanded leaves. Although inulin accumulation did not influence the sucrose concentration in leaves or tubers, a reduction in starch content occurred in transgenic tubers, indicating that inulin synthesis did not increase the storage capacity of the tubers. PMID:10890908

  11. In vitro organogenesis of potato (Solanum tuberosum L. cultivar Atlantic for the genetic transformationOrganogênese in vitro de batata (Solanum tuberosum L. cultivar Atlantic visando transformação genética

    Directory of Open Access Journals (Sweden)

    Rodrigo Kelson Silva Rezende

    2013-06-01

    Full Text Available The obtaining of commercial cultivars of potato with resistance to the phytopatogen is a very promising alternative that the genetic engineering can provide, through the introduction of exogenous genes for the genetic transformation. In order to establish an efficient system of transformation, it is crucial first to optimize in vitro organogenesis protocol. This work aimed to establish an efficient protocol for the genetic transformation of potato cv. Atlantic. The efficiency of the in vitro organogenesis is influenced by the explant type and by the kind and concentrations of growth regulators used. Shoot segments of potato cv. Atlantic present better organogenesis capacity than leaf explants. It is recommended to use the woody plant medium (WPM supplied with 1,0 mg L-1 of naphthalene acetic acid (NAA + 5,0 mg L-1 of zeatin riboside (ZEA, to obtain shoots from shoot segments, and the carbenicilin (Cb added to this medium increased this formation. For the process to enlarge shoots, this same antibiotic when added to the WPM medium in growing concentrations (100; 250; 500 mg L-1 promoted a decrease in the height of plants, number of shoots and length of roots. After the co-cultivation of shoots segments with Agrobacterium tumefaciens these concentrations of Cb are not efficient in the elimination of the bacteria, which commits the organogenesis. However, it is possible to establish a protocol of in vitro organogenesis of potato cv. Atlantic starting from shoots segments not co-cultivated. These results will be useful for futures experiments of genetic transformation with this and another commercials cultivars of potato.A obtenção de cultivares comerciais de batata com resistência a fitopatógenos é uma alternativa muito promissora que a engenharia genética pode proporcionar, através da introdução de genes exógenos visando transformação genética. Para tal, torna-se imprescindível estabelecer um sistema eficiente de transformação, e

  12. Biotransformation of 2-(4-methoxybenzyl)cyclopentanone by Solanum aviculare and Rheum palmatum plant cells

    Czech Academy of Sciences Publication Activity Database

    Soudek, Petr; Wimmer, Zdeněk; Vaněk, Tomáš

    2014-01-01

    Roč. 12, 3-4 (2014), s. 213-216 ISSN 1459-0255 R&D Projects: GA MŠk LH12162 Institutional support: RVO:61389030 Keywords : Solanum aviculare * Rheum palmatum * plant cell culture Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.435, year: 2012 http://world-food.net/ biotransformation -of-2-4-methoxybenzylcyclopentanone-by-solanum-aviculare-and-rheum-palmatum-plant-cells/

  13. Efeito da fertilização fosfatada na culturada batata (solanum tuberosum l. no planalto do huambo (Angola Effects of phosphorus fertilization on potato (solanum tuberosum l. crop production, in huambo country (Angola

    Directory of Open Access Journals (Sweden)

    Imaculada da Conceição Henriques

    2010-12-01

    Full Text Available Relatam-se ensaios realizados, no ano agrícola 2004/5, em blocos completos casualizados, para estudo do efeito na produção de doses de fertilização fosfatada da cultivar de batata-semente importada ‘Romano’ e da cultivar regional ‘Tchigembo’, plantadas em duas datas (Outubro e Fevereiro da época das chuvas e numa terceira data (Junho, na época seca, praticada em regadio. Os ensaios foram repetidos em três locais da Província do Huambo - Bailundo, Chianga e Calenga - distanciados de cerca de 50 km. Avaliaram-se os efeitos, na produção total e comercial de tubérculos (diâmetro > 25 mm, de diferentes doses de fósforo, na forma de superfosfato simples (24% de P2O5, tendo-se aplicado uniformemente ureia (300 kg ha-1 de N, fraccionada em três aplicações. As doses de fósforo ensaiadas foram 0, 50, 100, 200, 400 e 800 kg ha-1 de P2O5, comparadas com uma testemunha sem qualquer aplicação de fertilizante, azotado ou fosfatado. As modalidades de fertilização azotada receberam, uniformemente 300 de azoto. A dose que maior benefício económico originou, sem desperdício de químicos para o meio ambiente, foi a de 200 kg ha-1 de P2O5.Several trials were carried out to compare total and commercial potato yield of the imported cultivar ‘Romano’ and the regional cultivar ‘Tchigembo’, planted in two dates on rain season (October and February and in a third date (June, in dry season, with irrigation. The trials were repeated in three locations of the Huambo country - Bailundo, Chianga and Calenga. The effects on total and commercial (tubers diameter > 25 mm potato yields of different amounts of phosphorus, applied with single superphosphate (24% of P2O5 were evaluated. Treatments were: control (any type of soil fertilization null, 50, 100, 200, 400, and 800 kg ha-1 of P2O5. Phosphorus treatments received also 300 kg ha-1 of nitrogen (urea applied uniformly, in three times. The greatest economic benefice for both potato

  14. Development of technique on the induction and selection of in vitro mutant lines (Potato, Solanum tuberosum L.)

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Jang Ryoel; Lee, Yeong Il; Song, Hee Seop; Kim, Jae Seong; Sin, In Cheol; Lee, Sang Jae; Lee, Ki Un; Lim, Yong Taek [Korea Atomic Energy Res. Inst., Taejon (Korea, Republic of)

    1993-09-01

    For the development of the technique on the plant tissue culture and application of nuclear technique in the in vitro mutation breeding, present research laid emphasis on the development of techniques of potato tissue culture, and on the induction and selection of radiation mutation. Another culture for haploid induction, optimum radiation dosage for cybrid formation of potato and mutation induction from in vitro cultured microtuber and plantlets were investigated for modelling the technique on the induction and selection of in vitro mutant lines. Inheritance stability of the selected mutants were also studied in field condition. In vitro system of micropropagation and selection of mutation was summarized.

  15. Development of technique on the induction and selection of in vitro mutant lines (Potato, Solanum tuberosum L.)

    International Nuclear Information System (INIS)

    Yoo, Jang Ryoel; Lee, Yeong Il; Song, Hee Seop; Kim, Jae Seong; Sin, In Cheol; Lee, Sang Jae; Lee, Ki Un; Lim, Yong Taek

    1993-09-01

    For the development of the technique on the plant tissue culture and application of nuclear technique in the in vitro mutation breeding, present research laid emphasis on the development of techniques of potato tissue culture, and on the induction and selection of radiation mutation. Another culture for haploid induction, optimum radiation dosage for cybrid formation of potato and mutation induction from in vitro cultured microtuber and plantlets were investigated for modelling the technique on the induction and selection of in vitro mutant lines. Inheritance stability of the selected mutants were also studied in field condition. In vitro system of micropropagation and selection of mutation was summarized

  16. Evaluation of Trace Elements in Potatoes (Solanum tuberosum) from a Suburban Area of Naples, Italy: The "Triangle of Death".

    Science.gov (United States)

    Roma, Antonella De; Abete, Maria Cesarina; Brizio, Paola; Picazio, Giuseppe; Caiazzo, Marcello; D'auria, Jacopo Luigi; Esposito, Mauro

    2017-07-01

    Human exposure to contaminated food is a general health concern worldwide; it is necessary to evaluate food safety with respect to contaminants present in the edible parts of major food crops. This study evaluated the concentrations of 17 trace elements (As, Be, Cd, Co, Cr, Cu, Fe, Mn, Mo, Ni, Pb, Sb, Se, Sn, Tl, V, and Zn) from 51 potato plantations in the Campania region, inside the area known as the "Triangle of Death," with inductively coupled plasma mass spectrometry analysis. Results confirm that the potatoes collected from the suburban area of Naples contained concentrations of trace elements below the safe limits prescribed by the Food and Agriculture Organization of the United Nations and the World Health Organization. The concentrations of elements were similar to those reported for potatoes grown in other countries. Monitoring the content of toxic and potentially toxic elements is one of the most important aspects of food quality assurance. The environmental persistence of metals may result in the accumulation of significant levels of these contaminants in plants. They are absorbed to different extents, depending on their source, soil and climatic factors, plant genotype, and agrotechnical conditions, thereby entering the food chain and representing a risk to human health.

  17. Genome-wide organization and expression profiling of the NAC transcription factor family in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Singh, Anil Kumar; Sharma, Vishal; Pal, Awadhesh Kumar; Acharya, Vishal; Ahuja, Paramvir Singh

    2013-08-01

    NAC [no apical meristem (NAM), Arabidopsis thaliana transcription activation factor [ATAF1/2] and cup-shaped cotyledon (CUC2)] proteins belong to one of the largest plant-specific transcription factor (TF) families and play important roles in plant development processes, response to biotic and abiotic cues and hormone signalling. Our genome-wide analysis identified 110 StNAC genes in potato encoding for 136 proteins, including 14 membrane-bound TFs. The physical map positions of StNAC genes on 12 potato chromosomes were non-random, and 40 genes were found to be distributed in 16 clusters. The StNAC proteins were phylogenetically clustered into 12 subgroups. Phylogenetic analysis of StNACs along with their Arabidopsis and rice counterparts divided these proteins into 18 subgroups. Our comparative analysis has also identified 36 putative TNAC proteins, which appear to be restricted to Solanaceae family. In silico expression analysis, using Illumina RNA-seq transcriptome data, revealed tissue-specific, biotic, abiotic stress and hormone-responsive expression profile of StNAC genes. Several StNAC genes, including StNAC072 and StNAC101that are orthologs of known stress-responsive Arabidopsis RESPONSIVE TO DEHYDRATION 26 (RD26) were identified as highly abiotic stress responsive. Quantitative real-time polymerase chain reaction analysis largely corroborated the expression profile of StNAC genes as revealed by the RNA-seq data. Taken together, this analysis indicates towards putative functions of several StNAC TFs, which will provide blue-print for their functional characterization and utilization in potato improvement.

  18. REGENERACION Y SENSIBILIDAD A MANOSA EN ENTRENUDOS DE PAPA (Solanum tuberosum spp. andígena Var Diacol Capiro.

    Directory of Open Access Journals (Sweden)

    MARY LUZ YAYA-LANCHEROS

    2009-01-01

    Full Text Available RESUMEN Se estableció un sistema de organogénesis indirecta para la obtención de brotes múltiples a partir de segmentos internodales de la variedad Diacol Capiro. La ubicación de explantes en medio Murashige y Skoog (MS suplementado con 2 mg/l de zeatina ribosido (ZR, 0,02 mg/l de ácido naftalenácetico (ANA y 0,02 mg/l de ácido giberélico (AG3, permite la obtención de plántulas entre la séptima y novena semana con una efectividad del 80-100%. Mediante ubicación de explantes previamente cocultivados con la cepa LBA4404 de Agrobacterium tumefaciens que contiene el plásmido recombinante pNOV022, se verificó la utilidad del medio para procesos de transformación, obteniéndose tasas hasta del 100% de regeneración. Finalmente, con el objetivo de determinar el uso potencial de la manosa como agente selectivo en procesos de transformación, se evaluó el efecto de diferentes concentraciones de manosa sobre la viabilidad y capacidad regenerativa de explantes. Palabras clave: organogénesis indirecta, selección positiva, plantas transgénicas, Agrobacterium tumefaciens. ABSTRACT A system of indirect organogenesis for the multiple buds production from internode stem sections in Diacol Capiro variety was established. Explants on Murashige & Skoog (MS medium with zeatine riboside (ZR 2 mg/l, naftalenacetic acid (NAA 0.02 mg/l and giberelic acid (GA3 0.02 mg/l, produced plants ranging between 7 to 9 weeks with 80-100% effectiveness. In the same medium, explants infected with Agrobacterium LBA4404 strain which carries recombinant plasmid pNOV022, produced regeneration rates reached 100%, thus, the medium utility for trnsformation processes was verified. Finally, to determine the potential use of the mannose as selective agent in transformation processes, the effect of different mannose concentrations on explant viability and regenerative capacity was evaluated. Key words: Indirect organogenesis, positive selection, transgenic plants

  19. The changes of the polyphenol content and antioxidant activity in potato tubers (Solanum tuberosum L. due to nitrogen fertilization

    Directory of Open Access Journals (Sweden)

    Diana Hrabovská

    2013-11-01

    Full Text Available 96 Normal 0 false false false CS JA X-NONE Cultivar is one of the most important internal factors affecting polyphenol concentration in the plants. However, influence of the grown locality, climate conditions and way of cultivation belong to important external factors. In our experiment the influence of different nitrogen doses (0 - 40 - 80 - 120 - 160 - 240 kg N.ha-1 applied in the form of Vermikompost on the total polyphenol content and derived total antioxidant activity in cv. Sorento were investigated. While in the 1st - 5th variants the determined polyphenol content in dry mater of potato tubers decreased from 399.2 to 70.40 mg.kg-1, in the 6th variant that was twice higher in comparison to the 5th variants (135.6 mg.kg-1. The statistically significant differences in values of total polyphenol content between variants (polynomial function of 2nd degree were confirmed. The study also confirmed a strong statistical correlation between the content of polyphenols and the content of antioxidant activity has been confirmed (sign. F: 3.24E-10. The highest value of antioxidant activity was observed in the first variant. From the first to the fifth variant (7.62 - 4.84%, the value of antioxidant activity was decreasing and in the sixth variant this value increased to 6.31%.

  20. Solanum tuberosum and Lycopersicon esculentum Leaf Extracts and Single Metabolites Affect Development and Reproduction of Drosophila melanogaster.

    Science.gov (United States)

    Ventrella, Emanuela; Adamski, Zbigniew; Chudzińska, Ewa; Miądowicz-Kobielska, Mariola; Marciniak, Paweł; Büyükgüzel, Ender; Büyükgüzel, Kemal; Erdem, Meltem; Falabella, Patrizia; Scrano, Laura; Bufo, Sabino Aurelio

    2016-01-01

    Glycoalkaloids are secondary metabolites commonly found in Solanaceae plants. They have anti-bacterial, anti-fungal and insecticidal activities. In the present study we examine the effects of potato and tomato leaf extracts and their main components, the glycoalkaloids α-solanine, α-chaconine and α-tomatine, on development and reproduction of Drosophila melanogaster wild-type flies at different stages. Parental generation was exposed to five different concentrations of tested substances. The effects were examined also on the next, non-exposed generation. In the first (exposed) generation, addition of each extract reduced the number of organisms reaching the pupal and imaginal stages. Parent insects exposed to extracts and metabolites individually applied showed faster development. However, the effect was weaker in case of single metabolites than in case of exposure to extracts. An increase of developmental rate was also observed in the next, non-exposed generation. The imagoes of both generations exposed to extracts and pure metabolites showed some anomalies in body size and malformations, such as deformed wings and abdomens, smaller black abdominal zone. Our results further support the current idea that Solanaceae can be an impressive source of molecules, which could efficaciously be used in crop protection, as natural extract or in formulation of single pure metabolites in sustainable agriculture.

  1. Solanum tuberosum and Lycopersicon esculentum Leaf Extracts and Single Metabolites Affect Development and Reproduction of Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Emanuela Ventrella

    Full Text Available Glycoalkaloids are secondary metabolites commonly found in Solanaceae plants. They have anti-bacterial, anti-fungal and insecticidal activities. In the present study we examine the effects of potato and tomato leaf extracts and their main components, the glycoalkaloids α-solanine, α-chaconine and α-tomatine, on development and reproduction of Drosophila melanogaster wild-type flies at different stages. Parental generation was exposed to five different concentrations of tested substances. The effects were examined also on the next, non-exposed generation. In the first (exposed generation, addition of each extract reduced the number of organisms reaching the pupal and imaginal stages. Parent insects exposed to extracts and metabolites individually applied showed faster development. However, the effect was weaker in case of single metabolites than in case of exposure to extracts. An increase of developmental rate was also observed in the next, non-exposed generation. The imagoes of both generations exposed to extracts and pure metabolites showed some anomalies in body size and malformations, such as deformed wings and abdomens, smaller black abdominal zone. Our results further support the current idea that Solanaceae can be an impressive source of molecules, which could efficaciously be used in crop protection, as natural extract or in formulation of single pure metabolites in sustainable agriculture.

  2. Cloning and functional characterization of a p-coumaroyl quinate/shikimate 3'-hydroxylase from potato (Solanum tuberosum).

    Science.gov (United States)

    Knollenberg, Benjamin J; Liu, Jingjing; Yu, Shu; Lin, Hong; Tian, Li

    2018-02-05

    Chlorogenic acid (CGA) plays an important role in protecting plants against pathogens and promoting human health. Although CGA accumulates to high levels in potato tubers, the key enzyme p-coumaroyl quinate/shikimate 3'-hydroxylase (C3'H) for CGA biosynthesis has not been isolated and functionally characterized in potato. In this work, we cloned StC3'H from potato and showed that it catalyzed the formation of caffeoylshikimate and CGA (caffeoylquinate) from p-coumaroyl shikimate and p-coumaroyl quinate, respectively, but was inactive towards p-coumaric acid in in vitro enzyme assays. When the expression of StC3'H proteins was blocked through antisense (AS) inhibition under the control of a tuber-specific patatin promoter, moderate changes in tuber yield as well as phenolic metabolites in the core tuber tissue were observed for several AS lines. On the other hand, the AS and control potato lines exhibited similar responses to a bacterial pathogen Pectobacterium carotovorum. These results suggest that StC3'H is implicated in phenolic metabolism in potato. They also suggest that CGA accumulation in the core tissue of potato tubers is an intricately controlled process and that additional C3'H activity may also be involved in CGA biosynthesis in potato. Copyright © 2018 Elsevier Inc. All rights reserved.

  3. The differential gene expression of key enzyme in the gibberellin pathway in the potato (solanum tuberosum) mutant

    International Nuclear Information System (INIS)

    Shi, J.B.; Ye, G.J.; Yang, Y.Z.; Wang, F.; Zhou, Y; Wang, J.

    2016-01-01

    In the present study, the expression patterns of the key genes in the gibberellin synthesis pathway in the potato dwarf mutant M4P-9 were detected using quantitative real-time PCR. Using Actin as an internal control, CPS1, KS, KO, GA20ox1, and GA2ox1, genes for key gibberellin synthesis enzymes, were evaluated, along with a gibberellin receptor gene. The standard curves were obtained from dilutions of PCR product; the correlation coefficient for Actin was 0.995, and those for the target genes varied from 0.994 to 1.000. The expression patterns of gibberellin pathway genes in different growth stages and tissues were calculated according to the method of Pfaffl. These genes showed expression patterns that varied based on growth stage and tissue type. The higher expression levels of CPS1 and GA2ox1 in roots, the lower expression levels of GA20ox1 in roots during tuber formation stage; as well as the increased expression of GA20ox1 and GA2ox1 genes in stems during the tuber formation stage, likely play key roles in the plant height phenotype in M4P-9 mutant materials. This article provides a basis for researching the mechanism of gibberellin synthesis in potato. (author)

  4. Effect of multi-nutrient complex fertilizers on growth and tuber yield of very early potato (Solanum tuberosum L. cultivars

    Directory of Open Access Journals (Sweden)

    Wanda Wadas

    2013-10-01

    Full Text Available The aim of the study was to compare the effect of multi-nutrient complex fertilizers (HydroComplex, Nitrophoska Blue Special and Viking 13 from the nitrophoska group, and Polimag S from the amophoska group and single-nutrient fertilizers on the growth and tuber yield of very early potato cultivars (‘Aster’, ‘Fresco’, ‘Gloria’. The field experiment was carried out on podzolic soil in mid-eastern Poland during 2005–2007. The study showed a greater beneficial effect of HydroComplex and Nitrophoska Blue Special on the growth of very early potato cultivars than that of Viking 13 and Polimag S. The application of HydroComplex and Nitrophoska Blue Special resulted in greater above-ground plant biomass and assimilation leaf area compared with single-nutrient fertilizers; the leaf area index (LAI was higher by 0.28 and 0.32, respectively. The differences were smaller and not statistically confirmed with the use of Polimag S and Viking 13. When the multi-nutrient complex fertilizers were applied, leaf weight ratio (LWR, leaf area ratio (LAR and specific leaf area (SLA were similar to the single-nutrient fertilizers. Of the multi-nutrient complex fertilizers, only Nitrophoska Blue Special resulted in higher tuber yield, on average by 2.40 t × ha-1, compared with the single-nutrient fertilizers. The studied cultivars showed a similar response to applied fertilizers. LAI for ‘Gloria’ was higher than for ‘Aster’ and ‘Fresco’, with smaller LAR found in ‘Gloria’. LWR for ‘Fresco’ was smaller than for ‘Aster’ and ‘Gloria’, with higher SLA found in ‘Fresco’. The tuber yield of ‘Aster” (24.04 t × ha-1 was higher on average by 3 t × ha-1 than for ‘Fresco’ and ‘Gloria’.

  5. The Effect of Climate Change on Potato (Solanum tuberosum L. Production in Feridonshahr Region of Isfahan I- Growth and Development

    Directory of Open Access Journals (Sweden)

    zohrab adavi

    2018-02-01

    Full Text Available Introduction The historical trend of Iran annual average temperature of shows a 0.05 °C.year-1 increase which indicates that future emissions of greenhouse gases will continue to increase temperature and consequently cause to climatic change in the country. This change in environment will have a serious impact on different growth and development processes of crops. Increasing temperature could affect physiological processes like photosynthesis, respiration and partitioning of photo-assimilates. The negative impacts of climate change on potato production are reported in the literature. The present study was conducted to quantify the potential impacts of climate change on phenology, growth and tuber yield of potato. Materials and Methods The climate projections of Hadley Centre Coupled Model version 3 (HadCM3, France and Institute of Pierre Simon Laplace (IPCM4, United Kingdom, was used to simulate the future conditions based on A2, B1 and A1B SRES (Special Report on Emissions Scenarios scenario at three time periods including 2015-2045 (2030, 2046-2075 (2060 and 2076-2105 (2090with a baseline of 1988-2012 (2012. For each period, the year shown in the parenthesis was considered as target year. The SUBSTOR-Potato model, one of the sixteen models embedded within the DSSAT (v4.5 program, was used to simulate the baseline and future yield and growth characteristics of potato. The model was calibrated and validated during 2012 and 2013 with two different farm experiments. In these experiments, the effects of different amounts of nitrogen fertilizer on yield and morphological traits of three potato cultivars were investigated. Six levels of nitrogen fertilizer (0, 50, 100, 200, 300 and 400 kg urea. ha-1 and three commonly planted potato cultivars in the region (Arinda, Santeh and Agria as early, medium and late maturity varieties, respectively were studied as a factorial arrangement based on a randomized complete block design with three replications

  6. Somatic hybrid plants between Lycopersicon esculentum and Solanum lycopersicoides.

    Science.gov (United States)

    Handley, L W; Nickels, R L; Cameron, M W; Moore, P P; Sink, K C

    1986-02-01

    Leaf mesophyll protoplasts of Lycopersicon esculentum (2n=2x=24) were fused with suspension culture-derived protoplasts of Solanum lycopersicoides (2n=2x=24) and intergeneric somatic hybrid plants were regenerated following selective conditions. A two phase selection system was based on the inability of S. lycopersicoides protoplasts to divide in culture in modified medium 8E and the partial inhibition of L. esculentum protoplasts by the PEG/DMSO fusion solution. At the p-calli stage, putative hybrids were visually selected based on their hybrid vigor and lime-green coloration in contrast to slower growing parental calli characterized by a watery, whitish-brown coloration. Early identification of the eight hybrid plants studied was facilitated by isozyme analysis of leaf tissue samples taken from plants in vitro at the rooting stage. Regenerated plants growing in planting medium were further verified for hybridity by 5 isozymes marking 7 loci on 5 chromosomes in tomato. These included Skdh-1 mapped to chromosome 1 of tomato, Pgm-2 on chromosome 4, Got-2 and Got-3 on chromosome 7, Got-4 on chromosome 8, and Pgi-1 and Pgdh-2 both on chromosome 12. Fraction I protein small subunits further confirmed the hybrid nature of the plants with bands of both parents expressed in all hybrids. The parental chloroplasts could not be differentiated by the isoelectric points of the large subunit. Seven of the eight somatic hybrids had a chromosome number ranging from the expected 2n=4x=48 to 2n=68. Mixoploid root-tip cells containing 48, 53, 54 or 55 chromosomes for two of the hybrids were also observed.

  7. Plant regeneration from leaf protoplasts of Solanum torvum.

    Science.gov (United States)

    Guri, A; Volokita, M; Sink, K C

    1987-07-01

    A protocol to obtain regenerated plants from protoplasts of Solanum torvum Sw a wild species of eggplant resistant to Verticillium wilt is reported. Leaf protoplasts were enzymatically isolated from six-week old seedlings grown in a controlled environment chamber. Protoplasts were plated on modified KM medium (0.4 M glucose)+(mg/l): 1.0 p-chlorophenoxyacetic acid (CPA)+1.0 naphthaleneacetic acid (NAA)+0.5 6-benzylaminopurine (BAP) and 0.02 abscisic acid (ABA). The protoplast density was 5×10(4) per ml with 5 ml placed in each of two quadrants in X-dishes (100×15 mm). The reservoir medium was modified KM+(mg/l): 0.1 NAA+0.5 BAP+0.1 M sucrose+0.1 M mannitol+0.6% washed agar+1% activated charcoal. Dishes were initially placed in the dark at 27°C. Protoplast division was initiated in 1-2 weeks and 4 weeks later p-calli were 1-3 mm. Plating efficiency was 11% when measured at 3 weeks. Six-week old p-calli were transferred individually onto Whatman No. 1 filter paper layered on modified KM (0.15 M sucrose)+mg/l: 2.0 indoleacetic acid (IAA)+2.0 zeatin+0.5% washed agar for 2 weeks. Subsequently, shoots occurred within 4 weeks at 70% efficiency on MS+30 g/l sucrose+2 mg/l zeatin. Shoots were rooted on half strength MS+10 g/l sucrose.

  8. Effect of plant growth regulators on callus induction and plant ...

    African Journals Online (AJOL)

    The present study was conducted to investigate the effects of different concentrations and combinations of growth regulators on callus induction and plant regeneration of potato (Solanum tuberosum L.) cultivar Diamant. The tuber segments were used as explants and cultured on Murashige and Skoog (MS) medium ...

  9. Effect of γ-radiation on the incidence of plant tumors (to the problem of carcinogenesis)

    International Nuclear Information System (INIS)

    Kuzin, A.M.; Yurov, S.S.; Vagabova, M.Eh.; Shchelkaeva, N.V.

    1986-01-01

    In experiments on two plant species: of Kalanchoe diagremontiana and potato (Solanum tuberosum) it was shown that γ-irradiation of the plant tissues, before infecting with Ti-plasmide Agrobacterium tumefaciens C-58, with doses stimulating the development of the plants markedly increases the incidence of tumors, promotes their growth, and increases the probability of inverse differentiation of tumor cells

  10. Improved efficiency of plant regeneration from protoplasts of eggplant Solanum melongena L.

    Science.gov (United States)

    Guri, A; Izhar, S

    1984-12-01

    Eggplant (Solanum melongena L.) mesophyll protoplasts were obtained from in vitro growing plants of line 410 and cv. 'Classic'. Relatively high (15%) plating efficiency was achieved using petri dishes with alternate quadrants containing reservoir medium (R medium + 1% activated charcoal) and culture medium. Shoot regeneration occurred within 6 weeks following initiation of protoplast culture.

  11. Avaliação da infestação de insetos-praga associados à batata (Solanum tuberosum L. sob efeito de nutrientes nitrogenados e potássicos e teores acumulados de aminoácidos livres nas cultivares Achat e Monalisa

    Directory of Open Access Journals (Sweden)

    Edson Henrique de Azeredo

    2002-01-01

    Full Text Available Evaluation of insect-pest infestation associated to potato (Solanum tuberosum L. under effect of nitrogen and potassium fertilizers and the accumulated amount of free aminoacids in Achat and Monalisa cultivars. The objective of this work was to evaluate the occurence of insect-pests on potato plants influenced by dosages of nitrogen and potassium accumulated in plant organs. A total of 169 plants of the Achat and Monalisa cultivars were evaluated to determine the presence-absence of Diabrotica speciosa Germar, 1824 and Agrotis ipsilon Hüfnagel, 1767. The experiment was carried out and executed at the Universidade Federal Fluminense, and the delineation was complete randomized block design, with four replication and nine treatments, using three fertilization level (0; 75 and 150 Kg/ha with N-urea + KCl. The aminoacid levels were adjusted by the Leucine standard-curve (µg/l, using the Ninhydrin method, at 570 nm. The results showed that the tubercles of Monalisa accumulated high free aminoacid levels with 7,95% in the treatment N1K2 and 7,75% in the N2K1.These treatments, induced the infestation by D. speciosa larvae in 27,03%, when the aminoacid level was 2,01 ± 0,58% (X ± EP, with probability of 0,0196

  12. Detección de posibles duplicados en la Colección Central Colombiana de papa Solanum tuberosum subespecie andigena a partir de caracteres morfológicos

    Directory of Open Access Journals (Sweden)

    Bernal Ángela María

    2006-12-01

    Full Text Available

    Dentro de una colección de germoplasma, la presencia de materiales duplicados amenaza su identidad genética, enmascarando su variabilidad y aumentando los costos de manejo y mantenimiento. Por tal razón, con el fin de identificar los materiales candidatos a duplicados dentro de la Colección Central Colombiana de papa Solanum tuberosum ssp. andigena, se llevó a cabo la caracterización morfológica con variables cualitativas. La investigación se realizó durante el primer y segundo semestre de 2004 en el Centro de Investigación Tibaitatá de la Corporación Colombiana de Investigación Agropecuaria (Corpoica. El análisis factorial de correspondencias múltiples (ACM permitió identificar los caracteres color primario y secundario de piel de tubérculo, color secundario de carne de tubérculo y color primario y secundario de flor, como los que mejor discriminan la colección, y mediante el análisis de conglomerados, se obtuvo un dendrograma que permitió definir siete grupos y cuatro subgrupos en los que se identificaron los posibles duplicados bajo un índice de nivel arbitrario que admitiera rigor estadístico y amplitud biológica. En total, se candidatizaron 64 materiales para una confirmación molecular posterior.

  13. Molecular evolution of the disease resistance gene Rx in Solanum

    NARCIS (Netherlands)

    Butterbach, P.B.E.

    2007-01-01

    Potato (Solanum tuberosum ssp. tuberosum) is the fourth most important food crop with an annual yield of about 300 million tons over the world. The history of the domestication of potato shows that disease-causing agents followed the tracks of potato cultivation in temperate climates

  14. Efficient plant regeneration of bittersweet (Solanum dulcamara L., a medicinal plant

    Directory of Open Access Journals (Sweden)

    Arzu Ucar Turker

    2011-01-01

    Full Text Available Solanum dulcamara L. (bittersweet is a medicinal plant that has been used to treat skin diseases, warts, tumors, felons, arthritis, rheumatism, bronchial congestion, heart ailments, ulcerative colitis, eye inflammations, jaundice and pneumonia. A reliable in vitro culture protocol for bittersweet was established. Explants (leaf and petiole segments were cultured on Murashige and Skoog minimal organics (MSMO medium with various plant growth regulator combinations. Leaf explants formed more shoots than petiole explants. Plant regeneration was observed through indirect organogenesis with both explants. Best shoot proliferation was obtained from leaf explants with 3 mg/l BA (benzyladenine and 0.5 mg/l IAA (indole-3-acetic acid. Regenerated shoots were transferred to rooting media containing different levels of IAA (indole-3-acetic acid, IBA (indole-3-butyric acid, NAA (naphthalene acetic acid or 2,4-D (2,4 dichlorophenoxyacetic acid. Most shoots developed roots on medium with 0.5 mg/l IBA. Rooted explants were transferred to vermiculate in Magenta containers for acclimatization and after 2 weeks, they were planted in plastic pots containing potting soil and maintained in the plant growth room.

  15. Guatemalan potato moth Tecia solanivora distinguish odour profiles from qualitatively different potatoes Solanum tuberosum L.

    DEFF Research Database (Denmark)

    Karlsson, Miriam Frida; Birgersson, Göran; Witzgall, Peter

    2013-01-01

    Guatemalan potato moth, Tecia solanivora, lay eggs in the soil nearby potato Solanum spp. and larvae feed on the tubers. We investigated the oviposition behaviour of T. solanivora females and the survival of larval offspring on healthy vs. stressed, i.e. light exposed and/or damaged potato tubers...... that volatiles guide the females to lay fewer eggs on stressed tubers that are of inferior quality for the larvae. We propose that volatiles, such as sesquiterpenes and aldehydes, mediate oviposition behaviour and are correlated with biosynthetically related, non-volatile compounds, such as steroidal....... In choice tests, females laid significantly more eggs in response to potato odour of healthy tubers and female oviposition preference correlated with higher larval survival. Survival of larvae was negatively correlated with the tuber content of the steroid glycoalkaloids α-solanine and α-chaconine: healthy...

  16. Effect of selected essential oil plants on bacterial wilt disease ...

    African Journals Online (AJOL)

    Objective: Bacterial wilt disease caused by Ralstonia solanacearum is a major constrain to production of potatoes (Solanum tuberosum). Control of bacterial wilt is very difficult as there are no effective curative chemicals. This study was aimed at investigating the potential roles of essential oil plants in control of the disease.

  17. Combined effects of CO2 enrichment, changes in diurnal light level and water stress on foliar metabolites of potato plants grown in naturally sunlit controlled environment chambers

    Science.gov (United States)

    Potato plants (Solanum tuberosum L. cv Kennebec) were grown in outdoor, naturally sunlit, soil-plant-atmosphere research (SPAR) chambers. Drought treatments were imposed at post-tuber initiation stage to assess water stress effects on leaf metabolites, and interactions with enriched CO2 concentrati...

  18. Asociaciones de marcadores moleculares con la resistencia a enfermedades, caracteres morfológicos y agronómicos en familias diploides de papa (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Julio Gabriel

    2016-01-01

    Full Text Available Quince familias de papa (840 genotipos provenientes de cruzas inter-específicas entre especies de Solanum stenotomum, S. goniocalyx y S. phureja  fueron genotipadas, con el objetivo de asociar  seis marcadores moleculares (GP94, HC, Nl25, Gro 1-4, RYSC3 y CP60 con genes mayores de resistencia para tizón tardío (Phytophthora infestans, verruga (Synchytrium endobioticum, nematodo - quiste (Globodera pallida y G. rostochiensis y virus PVY y PVX. Los resultados mostraron que cinco de los marcadores aplicados fueron polimórficos y amplificaron en más del 80% de las familias. El marcador RYSC3 que co-localiza con el gen Ryadg no amplificó en ninguna de las familias evaluadas. La familia 8 amplificó la banda para tres marcadores (CP60, GP94 y NL25 en la totalidad de sus clones. La prueba de χ2 se utilizó para determinar el ajuste de las proporciones de segregación de cada familia para cada marcador y genotipar los progenitores. Nueve caracteres agronómicos y morfológicos fueron evaluados en la cosecha. Mediante agrupamiento cluster fueron seleccionados 107 clones con resistencia a PVX, P. infestans, G. rostochiensis y S. endobioticum, alto rendimiento y volumen de tubérculos, elevado número de tubérculos y ojos superficiales. Sobre la base de estos resultados, aspectos prácticos para la aplicación eficiente de la selección asistida por marcadores moleculares son discutidos en este artículo.

  19. Species-specific identification from incomplete sampling: applying DNA barcodes to monitoring invasive solanum plants.

    Science.gov (United States)

    Zhang, Wei; Fan, Xiaohong; Zhu, Shuifang; Zhao, Hong; Fu, Lianzhong

    2013-01-01

    Comprehensive sampling is crucial to DNA barcoding, but it is rarely performed because materials are usually unavailable. In practice, only a few rather than all species of a genus are required to be identified. Thus identification of a given species using a limited sample is of great importance in current application of DNA barcodes. Here, we selected 70 individuals representing 48 species from each major lineage of Solanum, one of the most species-rich genera of seed plants, to explore whether DNA barcodes can provide reliable specific-species discrimination in the context of incomplete sampling. Chloroplast genes ndhF and trnS-trnG and the nuclear gene waxy, the commonly used markers in Solanum phylogeny, were selected as the supplementary barcodes. The tree-building and modified barcode gap methods were employed to assess species resolution. The results showed that four Solanum species of quarantine concern could be successfully identified through the two-step barcoding sampling strategy. In addition, discrepancies between nuclear and cpDNA barcodes in some samples demonstrated the ability to discriminate hybrid species, and highlights the necessity of using barcode regions with different modes of inheritance. We conclude that efficient phylogenetic markers are good candidates as the supplementary barcodes in a given taxonomic group. Critically, we hypothesized that a specific-species could be identified from a phylogenetic framework using incomplete sampling-through this, DNA barcoding will greatly benefit the current fields of its application.

  20. Morpho-histological analysis of tomato (Solanum lycopersicum L. plants after treatment with juglone

    Directory of Open Access Journals (Sweden)

    Anna Milewska-Hendel

    2017-06-01

    Full Text Available Juglone is a substance that limits plant growth and has a toxic effect on plant development. In this study, we analyzed the influence of juglone at two different concentrations (10−3 M and 10−4 M, which were applied to different parts of Solanum lycopersicum L. plants (root system, stem after decapitation, and surface of a younger leaf or after autografting for a short period of time (7 days, on the morphology and histology of stems. At a lower concentration, juglone had positive effects on plant growth, which resulted in an increase in interfascicular cambial cell divisions, faster development of a continuous cambium layer along the stem circumference, and development of fibers. Additionally, under the influence of juglone, the number of developing leaves increased and adventitious roots developed. The results are discussed based on the current literature concerning the reaction of plants to juglone and to stress conditions.

  1. Comparing effects of low levels of herbicides on greenhouse- and field-grown potatoes (Solanum tuberosum L.), soybeans (Glycine max L.), and peas (Pisum sativum L.).

    Science.gov (United States)

    Pfleeger, Thomas; Olszyk, David; Lee, E Henry; Plocher, Milton

    2011-02-01

    Although laboratory toxicology tests are generally easy to perform, cost effective, and readily interpreted, they have been questioned for their environmental relevance. In contrast, field tests are considered realistic while producing results that are difficult to interpret and expensive to obtain. Toxicology tests were conducted on potatoes, peas, and soybeans grown in a native soil in pots in the greenhouse and were compared to plants grown outside under natural environmental conditions to determine toxicological differences between environments, whether different plant developmental stages were more sensitive to herbicides, and whether these species were good candidates for plant reproductive tests. The reproductive and vegetative endpoints of the greenhouse plants and field-grown plants were also compared. The herbicides bromoxynil, glyphosate, MCPA ([4-chloro-2-methylphenoxy] acetic acid), and sulfometuron-methyl were applied at below field application rates to potato plants at two developmental stages. Peas and soybeans were exposed to sulfometuron-methyl at similar rates at three developmental stages. The effective herbicide concentrations producing a 25% reduction in a given measure differed between experimental conditions but were generally within a single order of magnitude within a species, even though there were differences in plant morphology. This study demonstrated that potatoes, peas, and soybeans grown in pots in a greenhouse produce phytotoxicity results similar to those grown outside in pots; that reproductive endpoints in many cases were more sensitive than vegetative ones; and that potato and pea plants are reasonable candidates for asexual and sexual reproductive phytotoxicity tests, respectively. Plants grown in pots in a greenhouse and outside varied little in toxicity. However, extrapolating those toxicity results to native plant communities in the field is basically unknown and in need of research. © 2010 SETAC.

  2. Identification of the site where the electron transfer chain of plant mitochondria is stimulated by electrostatic charge screening.

    NARCIS (Netherlands)

    Krab, K.; Wagner, M.J.; Wagner, A.M.; Moller, I.M.

    2000-01-01

    Modular kinetic analysis was used to determine the sites in plant mitochondria where charge-screening stimulates the rate of electron transfer from external NAD(P)H to oxygen. In mitochondria isolated from potato (Solanum tuberosum L.) tuber callus, stimulation of the rate of oxygen uptake was

  3. Mineral Content in Leaves of Tomato Plants Grafted on Solanum Rootstocks

    OpenAIRE

    松添, 直隆; 間, 浩美; 花田, 勝美; モハメド, アリ; 大久保, 敬; 藤枝, 國光

    1995-01-01

    Nutrient uptake of tomato plants cv. Momotaro grafted on Solanum sisymbriifoliulm, S. torvum and S. toxicarium which are resistant to soil-born disease were compared with tomato grafted on its own root, a tomato/tomato, scion/rootstock combination. Mineral content in leaves of tomato/S. sisymbriifoliulm was nearly equal to that of tomato/tomato. In leaves of tomato/S. torvum, nitrogen content was higher, and magnesium content was lower than those of tomato/tomato. Furthermore, phosphorus and ...

  4. Isolation and characterization of a β-propeller gene containing phosphobacterium Bacillus subtilis strain KPS-11 for growth promotion of potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Hanif, Muhammad Kashif; Hameed, Sohail; Imran, Asma; Naqqash, Tahir; Shahid, Muhammad; van Elsas, Jan D

    2015-01-01

    Phosphate-solubilizing and phytate-mineralizing bacteria collectively termed as phosphobacteria provide a sustainable approach for managing P-deficiency in agricultural soils by supplying inexpensive phosphate to plants. A phosphobacterium Bacillus subtilis strain KPS-11 (Genbank accession no.

  5. Electrochemical Determination of Low Molecular Mass Thiols Content in Potatoes (Solanum tuberosum Cultivated in the Presence of Various Sulphur Forms and Infected by Late Blight (Phytophora infestans

    Directory of Open Access Journals (Sweden)

    Rene Kizek

    2008-05-01

    Full Text Available In the present paper potato plants were cultivated in the presence of ammonium sulphate or elemental sulphur supplementation into the soil to reveal the effects of different sulphur forms on content of nitrogen, phosphorus, potassium, calcium, magnesium and sulphur, and yield of tubers. During the investigation of the influence of different sulphur forms on yield of potato tubers we did not observe significant changes. Average weight of tubers of control plants per one experimental pot was 355 g. Application of sulphur in both forms resulted in moderate potato tubers weight reduction per one experimental pot compared to control group; average value ranged from 320 to 350 g per one experimental pot. Further we treated the plants with two different supplementation of sulphur with cadmium(II ions (4 mg of cadmium(II acetate per kilogram of the soil. The significantly lowest cadmium content (p < 0.05 was determined in tissues of plants treated with the highest dosage of elemental sulphur (0.64 mg Cd/kg compared to control plants (0.82 mg Cd/kg. We also aimed our attention on the cadmium content in proteins, lipids or soluble carbohydrates and ash. Application of sulphate as well as elemental sulphur resulted in significant cadmium content reduction in lipid fraction compared to control plants. In addition to this we quantified content of low molecular mass thiols in potatoes tissues. To determine the thiols content we employed differential pulse voltammetry Brdicka reaction. After twelve days of the treatment enhancing of thiols level was observed in all experimental groups regardless to applied sulphur form and its concentration. Finally we evaluated the effect of sulphur supplementation on Phytophora infestans infection of potato plants.

  6. Efficacy of mineral oil combined with insecticides for the control of aphid virus vectors to reduce potato virus Y infections in seed potatoes (Solanum tuberosum)

    DEFF Research Database (Denmark)

    Hansen, Lars M.; Nielsen, Steen L.

    2012-01-01

    Aphids are major vectors of plant viruses. Potato virus Y (PVY) is the most important aphid-transmitted virus affecting potato crops in Denmark. Because of a changed seed potato growing strategy, the seed potato area in Denmark is changing from regions with a low average temperature to regions...... with a higher average temperature. This means that the aphids may infest the potato crops earlier and the population development of the aphids may be faster, and consequently PVY may more easily become epidemic in seed potato crops. With a view to reducing the spread of PVY a 3-year experiment was carried out...... with a combination of mineral oil and insecticides. In 2005 and 2007 when a very high number of aphids were present, nearly all plants were infected with PVY. In 2006 with a lower number of aphids a smaller proportion of the plants were infected, and a tendency to a lower PVY incidence in mineral-oil treated plots...

  7. Evaluation of an organic package of practice towards integrated management of Solanum tuberosum and its comparison with conventional farming in terms of yield, quality, energy efficiency and economics

    Directory of Open Access Journals (Sweden)

    Antara Seal

    2017-09-01

    Full Text Available A study was taken up during 2014-16 for evaluating the potential of an organic package of practice towards integrated crop production (green farming in comparison to conventional farmers’ practice in West Bengal, India. Under green farming, compost was integrated with chemical fertilizer for soil management while organic plant/ pest management was undertaken utilizing Inhana Rational Farming (IRF Technology. The study indicated higher yield (9.7 %, higher nutrient use efficiency and economic sustainability under green farming irrespective of study area or potato variety. Higher qualitative expression in terms of starch content, pulp pH, vitamin C etc. under green farming might be due to the organic plant management aimed at energization of plant biochemical functions. Soil quality development as noted under green farming might have been influenced by the on-farm produced compost containing rich self- generated micro flora (in order of 1016 per colony forming unit.. The study indicated that green farming may serve as an efficient substitute of conventional farming towards yield sustenance, abatement of food toxicity and quality end product; through higher use of renewable energy and activation of plant physiological functions.

  8. Reducing Severity of Late Blight (Phytophthora infestans and Improving Potato (Solanum tuberosum L. Tuber Yield with Pre-Harvest Application of Calcium Nutrients

    Directory of Open Access Journals (Sweden)

    Yewubnesh Wendimu Seifu

    2017-10-01

    Full Text Available The efficiency of pre-harvest application of calcium chloride alone, calcium nitrate alone, and combined application of calcium chloride and calcium nitrate (1:1 was evaluated in reducing the severity of P. infestans and improving potato tuber yield. Pot experiment was conducted in randomized complete block design with four replications. The treatments consisted of combination of two potato varieties (Shenkola and Gera and three types of calcium nutrients (calcium chloride alone, calcium nitrate alone, and calcium chloride mixed with calcium nitrate, each at three levels (5, 10, and 15 g per liter per plant and the control treatment (0 g of calcium nutrients. In comparison to the control treatment, the application of calcium nutrients significantly decreased the severity of late blight disease and improved potato tuber yield. The effect of calcium nutrients on the severity of late blight disease and potato tuber yield differed among the two potato varieties. The maximum severity reduction (60% was noticed in the Gera potato variety with the application of calcium chloride mixed with calcium nitrate (1:1, supplied at 15 g per plant. However, the highest average tuber yield was obtained with the application of calcium nitrate at 15 g per plant, and average tuber yield was increased by 77% in both potato varieties. Hence, foliar application of either calcium nitrate alone or calcium nitrate mixed with calcium chloride was found to be more efficient than the application of calcium chloride alone. This result suggests that the nitrate ion present in the calcium nitrate may make a difference in terms of reducing the severity of late blight disease and improving potato tuber yield. The lowered severity of late blight disease and the increased tuber yield in potato plants sprayed with calcium nutrients may be because of the higher accumulation of calcium in the plant tissue.

  9. Oxygen Availability Influences Expression of Dickeya solani Genes Associated With Virulence in Potato (Solanum tuberosum L. and Chicory (Cichorium intybus L.

    Directory of Open Access Journals (Sweden)

    Wioletta Lisicka

    2018-03-01

    Full Text Available Dickeya solani is a Gram-negative necrotrophic, plant pathogenic bacterium able to cause symptoms in a variety of plant species worldwide. As a facultative anaerobe, D. solani is able to infect hosts under a broad range of oxygen concentrations found in plant environments. However, little is known about oxygen-dependent gene expression in Dickeya spp. that might contribute to its success as a pathogen. Using a Tn5 transposon, harboring a promoterless gusA reporter gene, 146 mutants of D. solani IPO2222 were identified that exhibited oxygen-regulated expression of the gene into which the insertion had occurred. Of these mutants 114 exhibited higher expression under normal oxygen conditions than hypoxic conditions while 32 were more highly expressed under hypoxic conditions. The plant host colonization potential and pathogenicity as well as phenotypes likely to contribute to the ecological fitness of D. solani, including growth rate, carbon and nitrogen source utilization, production of pectinolytic enzymes, proteases, cellulases and siderophores, swimming and swarming motility and the ability to form biofilm were assessed for 37 strains exhibiting the greatest oxygen-dependent change in gene expression. Eight mutants expressed decreased ability to cause disease symptoms when inoculated into potato tubers or chicory leaves and three of these also exhibited delayed colonization of potato plants and exhibited tissue specific differences in gene expression in these various host tissues. The genes interrupted in these eight mutants encoded proteins involved in fundamental bacterial metabolism, virulence, bacteriocin and proline transport, while three encoded hypothetical or unknown proteins. The implications of environmental oxygen concentration on the ability of D. solani to cause disease symptoms in potato are discussed.

  10. Production of Phytophthora infestans-resistant potato (Solanum tuberosum) utilising Ensifer adhaerens OV14

    DEFF Research Database (Denmark)

    Wendt, Toni; Doohan, Fiona; Mullins, Ewen

    2012-01-01

    their gene transfer efficiencies. In this study we set out to identify alternative bacteria species that could (a) utilize vir genes for genetic transformation and (b) substitute for A. tumefaciens in existing transformation protocols, without a prerequisite for protocol modifications. To this end we...... isolated a collection (n=751) of plant-associated bacteria from the rhizosphere of commercially grown crops. Based on various screens, including plant transformation with the open-source vector pCAMBIA5105, we identified a strain of the bacterium Ensifer adhaerens with the capacity to transform both......Based on the use of Agrobacterium tumefaciens-mediated transformation commodity crop improvement through genetic engineering is the fastest adopted crop technology in the world (James 2010). However, the complexity of the Agrobacterium patent landscape remains a challenge for non-patent holders who...

  11. Efeito do nitrogênio, fósforo e potássio na adubação da batatinha - Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1950-08-01

    Full Text Available Five potatoes fertilizers trials were carried out. in diffeient soil types of the State of São Paulo with the purpose to study the effect of nitrogen, phosphoric acid and potash, on tuber production. It was found that nitrogen increased plant growth, intensified green color of foliage and retarded maturity. Nitrogen also increased susceptibility to fungus diseases. Phosphoric acid increased yield and shortened the vegetative period. Potassium induced a light -green color of the foliage, but otherwise had almost no influence on plant development. Phosphoric acid was the most important factor in increasing tuber production : nitrogen was second and potassium, third. A response to potassium was noticed only when this element was applied together with phosphorus and nitrogen.

  12. Evaluation of iodate toxicity (KIO3 on growth, morpho-physiological characteristics and mineral nutrients concentrations of potato (Solanum tuberosum L. cv. Agria

    Directory of Open Access Journals (Sweden)

    Ezatollah Esfandiari

    2015-08-01

    Full Text Available The current study was aimed to assess the effects of different iodate concentrations on morpho-physiological characteristics of potato. In this regard, a pot experiment was carried out during the spring and summer 2013. Five concentrations of KIO3 including control beside 10, 20, 40, and 80 mg/Kgsoil were applied through irrigation system. The results showed that all selected agronomical and morphological characteristics of potato except dry weight of stem (SDW and root (RDW were negatively affected by high iodate concentrations. The results showed that applying 80 mg KIO3/Kgsoil compared to control resulted in around 15, 86, 84, 41, 16, 25, 20, and 87% reductions in harvest index (HI, leaf dry weight (LDW, tuber dry weight (TDW, plant dry weight (PDW, stem length (SL, root length (RL, plant height (PH, and number of tuber per plant (NT, respectively. Iodate application (80 mg KIO3/Kgsoil vs. control also affected potato’s physiological characteristics including chlorophyll content (SPAD, relative water content (RWC, water use efficiency (WUE, evapo-transpiration efficiency (ETE, cell membrane stability index (CMSI and tolerance index (TI showing around 27, 12, 87, 39, 40, and 77% reductions for each one, respectively. Increasing iodate concentrations, although, showed no effect of Zn concentration of root and Fe and Mn concentrations of leaf, gradually decreased Zn concentration of leaf and increased Fe and Mn concentrations of root and Cu concentrations of root and leaf. Plants also showed several visible symptoms including stunting, chlorosis, browning of leaf tip and reduction in growth due to iodate toxicity.

  13. TAI vacuolar invertase orthologs: the interspecific variability in tomato plants (Solanum section Lycopersicon).

    Science.gov (United States)

    Slugina, M A; Shchennikova, A V; Kochieva, E Z

    2017-10-01

    Understanding the genetic mechanisms underlying carbohydrate metabolism can promote the development of biotechnological advances in fruit plants. The flesh tomato fruit represents an ideal system for examining the role of sucrose cleavage enzymes in fruit development, and wild tomato species differing in storage sugars serve as an excellent research material for this purpose. Plant vacuolar invertase is a key enzyme of sucrose metabolism in the sink organs. In the present study, we identified complete gene sequences encoding the TAI vacuolar invertase in 11 wild and one cultivated tomato accessions of the Solanum section Lycopersicon. The average level of interspecific polymorphism in TAI genes was 8.58%; however, in the green-fruited tomatoes, the TAI genes contained 100 times more SNPs than those in the red-fruited accessions. The TAI proteins demonstrated 8% variability, whereas the red-fruited species had none. A TAI-based phylogenetic tree revealed two main clusters containing self-compatible and self-incompatible species, which concurs with the previous crossability-based division and demonstrates that the TAI genes reflect the evolutionary relationships between the red- and green-fruited tomatoes. Furthermore, we detected differential expression patterns of the TAI genes in the fruits of wild and cultivated tomatoes, which corresponded to sugar composition. The polymorphism analysis of the TAI acid invertases of Solanum section Lycopersicon species will contribute to the understanding of the genetic potential of TAI genes to impact tomato breeding through genetic engineering of the carbohydrate composition in the fruit.

  14. Intraspecific competition facilitates the evolution of tolerance to insect damage in the perennial plant Solanum carolinense.

    Science.gov (United States)

    McNutt, David W; Halpern, Stacey L; Barrows, Kahaili; Underwood, Nora

    2012-12-01

    Tolerance to herbivory (the degree to which plants maintain fitness after damage) is a key component of plant defense, so understanding how natural selection and evolutionary constraints act on tolerance traits is important to general theories of plant-herbivore interactions. These factors may be affected by plant competition, which often interacts with damage to influence trait expression and fitness. However, few studies have manipulated competitor density to examine the evolutionary effects of competition on tolerance. In this study, we tested whether intraspecific competition affects four aspects of the evolution of tolerance to herbivory in the perennial plant Solanum carolinense: phenotypic expression, expression of genetic variation, the adaptive value of tolerance, and costs of tolerance. We manipulated insect damage and intraspecific competition for clonal lines of S. carolinense in a greenhouse experiment, and measured tolerance in terms of sexual and asexual fitness components. Compared to plants growing at low density, plants growing at high density had greater expression of and genetic variation in tolerance, and experienced greater fitness benefits from tolerance when damaged. Tolerance was not costly for plants growing at either density, and only plants growing at low density benefited from tolerance when undamaged, perhaps due to greater intrinsic growth rates of more tolerant genotypes. These results suggest that competition is likely to facilitate the evolution of tolerance in S. carolinense, and perhaps in other plants that regularly experience competition, while spatio-temporal variation in density may maintain genetic variation in tolerance.

  15. Use of Gentamicine sulfate for the control of Pantoea agglomerans, contaminant of the Solanum tuberosum L cv. Desirée in vitro multiplication

    Directory of Open Access Journals (Sweden)

    Yelenys Alvarado-Capó

    2006-10-01

    Full Text Available Bacterial contamination is one of the principal problems of plant tissue culture. The use of natural or synthetic antimicrobial substances represent an alternative for it solution. In potato micropropagation bacterial contamination produce serious damages. In this paper the effect of Gentamicine sulfate on control of high frequently contaminant was evaluated. The microorganism was isolated from media culture of potato cv. Desirée in vitro plants in multiplication stage. Traditional tintorial, bioquemical and physiological test were performed for bacteria identification together with BIOLOG bacteria identification system. Besides, the minimal inhibitory concentration (MIC and minimal bactericidal concentration (MBC of Gentamicine sulfate were determined and it antimicrobial and phytotoxic effect in multiplication stage were evaluated too. Pantoea agglomerans was identificated as potato contaminant and show sensibility to Gentamicine sulfate. The MIC was 0.625 mg.l-1 and the MBC was 1.25 mg.l-1. The antibiotics controlled the contamination in the 80% of contaminated explants without phytotoxicity at 2.5 mg.l-1. Key words: bacteria, in vitro culture, microbial contamination, potato

  16. The effects of potato virus Y-derived virus small interfering RNAs of three biologically distinct strains on potato (Solanum tuberosum) transcriptome.

    Science.gov (United States)

    Moyo, Lindani; Ramesh, Shunmugiah V; Kappagantu, Madhu; Mitter, Neena; Sathuvalli, Vidyasagar; Pappu, Hanu R

    2017-07-17

    Potato virus Y (PVY) is one of the most economically important pathogen of potato that is present as biologically distinct strains. The virus-derived small interfering RNAs (vsiRNAs) from potato cv. Russet Burbank individually infected with PVY-N, PVY-NTN and PVY-O strains were recently characterized. Plant defense RNA-silencing mechanisms deployed against viruses produce vsiRNAs to degrade homologous viral transcripts. Based on sequence complementarity, the vsiRNAs can potentially degrade host RNA transcripts raising the prospect of vsiRNAs as pathogenicity determinants in virus-host interactions. This study investigated the global effects of PVY vsiRNAs on the host potato transcriptome. The strain-specific vsiRNAs of PVY, expressed in high copy number, were analyzed in silico for their proclivity to target potato coding and non-coding RNAs using psRobot and psRNATarget algorithms. Functional annotation of target coding transcripts was carried out to predict physiological effects of the vsiRNAs on the potato cv. Russet Burbank. The downregulation of selected target coding transcripts was further validated using qRT-PCR. The vsiRNAs derived from biologically distinct strains of PVY displayed diversity in terms of absolute number, copy number and hotspots for siRNAs on their respective genomes. The vsiRNAs populations were derived with a high frequency from 6 K1, P1 and Hc-Pro for PVY-N, P1, Hc-Pro and P3 for PVY-NTN, and P1, 3' UTR and NIa for PVY-O genomic regions. The number of vsiRNAs that displayed interaction with potato coding transcripts and number of putative coding target transcripts were comparable between PVY-N and PVY-O, and were relatively higher for PVY-NTN. The most abundant target non-coding RNA transcripts for the strain specific PVY-derived vsiRNAs were found to be MIR821, 28S rRNA,18S rRNA, snoR71, tRNA-Met and U5. Functional annotation and qRT-PCR validation suggested that the vsiRNAs target genes involved in plant hormone signaling, genetic

  17. HRE-type genes are regulated by growth-related changes in internal oxygen concentrations during the normal development of potato (Solanum tuberosum) tubers.

    Science.gov (United States)

    Licausi, Francesco; Giorgi, Federico Manuel; Schmälzlin, Elmar; Usadel, Björn; Perata, Pierdomenico; van Dongen, Joost Thomas; Geigenberger, Peter

    2011-11-01

    The occurrence of hypoxic conditions in plants not only represents a stress condition but is also associated with the normal development and growth of many organs, leading to adaptive changes in metabolism and growth to prevent internal anoxia. Internal oxygen concentrations decrease inside growing potato tubers, due to their active metabolism and increased resistance to gas diffusion as tubers grow. In the present work, we identified three hypoxia-responsive ERF (StHRE) genes whose expression is regulated by the gradual decrease in oxygen tensions that occur when potato tubers grow larger. Increasing the external oxygen concentration counteracted the modification of StHRE expression during tuber growth, supporting the idea that the actual oxygen levels inside the organs, rather than development itself, are responsible for the regulation of StHRE genes. We identified several sugar metabolism-related genes co-regulated with StHRE genes during tuber development and possibly involved in starch accumulation. All together, our data suggest a possible role for low oxygen in the regulation of sugar metabolism in the potato tuber, similar to what happens in storage tissues during seed development.

  18. A Three-Way Transcriptomic Interaction Study of a Biocontrol Agent (Clonostachys rosea), a Fungal Pathogen (Helminthosporium solani), and a Potato Host (Solanum tuberosum).

    Science.gov (United States)

    Lysøe, Erik; Dees, Merete W; Brurberg, May Bente

    2017-08-01

    Helminthosporium solani causes silver scurf, which affects the quality of potato. The biocontrol agent Clonostachys rosea greatly limited the severity of silver scurf symptoms and amount of H. solani genomic DNA in laboratory experiments. Transcriptomic analysis during interaction showed that H. solani gene expression was highly reduced when coinoculated with the biocontrol agent C. rosea, whereas gene expression of C. rosea was clearly boosted as a response to the pathogen. The most notable upregulated C. rosea genes were those encoding proteins involved in cellular response to oxidative stress, proteases, G-protein signaling, and the methyltransferase LaeA. The most notable potato response to both fungi was downregulation of defense-related genes and mitogen-activated protein kinase kinase kinases. At a later stage, this shifted, and most potato defense genes were turned on, especially those involved in terpenoid biosynthesis when H. solani was present. Some biocontrol-activated defense-related genes in potato were upregulated during early interaction with C. rosea alone that were not triggered by H. solani alone. Our results indicate that the reductions of silver scurf using C. rosea are probably due to a combination of mechanisms, including mycoparasitism, biocontrol-activated stimulation of plant defense mechanisms, microbial competition for nutrients, space, and antibiosis.

  19. Phytotoxicity and cytogenotoxicity of hydroalcoholic extracts from Solanum muricatum Ait. and Solanum betaceum Cav. (Solanaceae) in the plant model Lactuca sativa.

    Science.gov (United States)

    Dos Santos, Fabio Eduardo; Carvalho, Marcos Schleiden Sousa; Silveira, Graciele Lurdes; Correa, Felipe Folgaroli; Cardoso, Maria das Graças; Andrade-Vieira, Larissa Fonseca; Vilela, Luciane Resende

    2018-03-05

    Plants are rich in biologically active compounds. They can be explored for the production of bioherbicides. In this context, the present work aimed to evaluate the allelopathic effect of hydroalcoholic extracts from two Solanaceae species: Solanum muricatum Ait. and Solanum betaceum Cav. For this end, we conducted phytochemical screening and biological assays, determining the effects of the extracts on germination, early development, cell cycle, and DNA fragmentation in plantlets and meristematic cells of the plant model Lactuca sativa L. (lettuce). The percentage of seeds germinated under effect of S. muricatum extract did not differ from the control, but plantlet growth was reduced at the highest concentrations. For S. betaceum extract, dose dependence was observed for both germination and plantlet development, with the highest concentrations inhibiting germination. The growth curves revealed the concentrations of 2.06 and 1.93 g/L for S. muricatum and S. betaceum extracts, respectively, as those reducing 50% of root growth (RG). At these concentrations, both extracts presented mitodepressive effect, besides inducing significant increase in the frequency of condensed nuclei, associated to DNA fragmentation and cytoplasmic shrinkage. The frequency of chromosome alterations was not significant. We further discuss the mechanisms of action related to the chemical composition of the extracts, which presented organic acids, reducing sugars, proteins, amino acids, and tannins, besides catechins and flavonoids, only found in the extract of S. betaceum.

  20. Data integration and knowledge management to facilitate research on plant-pathogen interactions: case study Solanum tuberosum – Verticillium

    Science.gov (United States)

    Verticillium wilt is an important disease causing considerable economic losses in potato production globally. Soil and environmental conditions affect symptom expression and the effect of the disease on yield. A ten year field trial has been conducted in order to better understand the dynamics of wi...

  1. Potato Annexin STANN1 Promotes Drought Tolerance and Mitigates Light Stress in Transgenic Solanum tuberosum L. Plants

    Czech Academy of Sciences Publication Activity Database

    Szalonek, M.; Sierpien, B.; Rymaszewski, W.; Gieczewska, K.; Vaňková, Radomíra; Dobrev, Petre; Szczesny, P.; Marczewski, W.; Krusiewicz, D.; Strzelczyk-Zyta, D.; Konopka-Postupolska, D.

    2015-01-01

    Roč. 10, č. 7 (2015), e0132683 E-ISSN 1932-6203 Institutional support: RVO:61389030 Keywords : MEDIATED OXIDATIVE STRESS * VIOLAXANTHIN DE-EPOXIDASE * BRASSICA-JUNCEA ANNEXIN-3 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.057, year: 2015

  2. Kajian Manajemen Pemasaran Kentang (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Palgunadi Palgunadi

    2013-06-01

    Full Text Available Kayu Aro di Kabupaten Kerinci mempunyai kondisi agroklimat yang sesuai untuk pertumbuhan dan produksi tanaman kentang. Rendahnya produktivitas kentang di Kabupaten Kerinci diduga ada hubungannya dengan faktor produksi dan gangguan hama penyakit, faktor penerapan strategi pemasaran yaitu strategi produksi, strategi harga dan strategi distribusi/pemasaran. Penelitian ini bertujuan untuk menganalisis hubungan antara manajemen pemasaran dengan harga yang diterima petani.  Penentuan lokasi penelitian dan contoh pedagang dilakukan secara sengaja (purposive, mencakup beberapa pedagang yang terlibat dalam pemasaran kentang, yang mendistribusikan produk ke luar daerah yang bukan bersifat musiman tetapi kontinyu. Pedagang antar kota sebanyak 30 orang yang terpencar di Kecamatan Kayu Aro, jumlah responden pedagang sebanyak 15 orang atau 50% dari jumlah sampel frame pedagang. Analisis data menggunakan model Korelasi Spearman. Hasil penelitian menunjukkan bahwa pedagang yang menerapkan manajemen pemasaran yang sangat baik berjumlah dua orang, manajemen pemasarannya baik sebanyak enam orang, dan tidak ada pedagang yang manajemen pemasarannya kurang-baik dan tidak-baik. Harga jual kentang rata – rata pada pedagang dengan manajemen pemasaran yang sangat-baik sebesar Rp. 1.753,906; pada pedangang dengan manajemen pemasaran yang baik sebesar Rp. 1.480,417; dan pada pedagang dengan manajemen pemasaran yang cukup-baik sebesar Rp. 1.341,295. Hasil analisis menunjukkan bahwa kedua variabel menunjukkan hubungan yang signifikan. Semakin baik tingkat manajemen pemasaran yang diterapkan pedagang kentang, ternyata harga jual kentang yang diterima pedagang semakin tinggi. Kata kunci: Pemasaran, pedagang, kentang

  3. Treated Wastewater Reuse on Potato (Solanum Tuberosum)

    DEFF Research Database (Denmark)

    Battilani, A; Plauborg, Finn; Andersen, Mathias Neumann

    2014-01-01

    A field experiment was carried out in Northern Italy (Po Valley), within the frame of the EU project SAFIR, to asses the impact of treated wastewater reuse on potato yield, quality and hygiene. The potato crop was drip irrigated and fertigated. Wastewater produced by small communities (≤2000 EI......) was treated by Membrane Bio Reactor (MBR) technology and gravel filter (FTS) during three cropping seasons. Treated wastewater, soil and tubers were analysed for the faecal indicator bacterium E. coli and heavy metals contents. Potato total yield was similar for tap and reused water, while the marketable...... production has been found higher with the latter. The tuber dry matter content as well as reducing sugars were not affected by reused water. Total sugars content was higher with MBR and FTS water. Water use efficiency (WUE) was significantly higher with reused water. Compared to tap water, crop gross margin...

  4. Morphological characterization of potato (Solanum tuberosum L ...

    African Journals Online (AJOL)

    Saad

    2013-05-22

    May 22, 2013 ... for this trait to least significant difference test (LSD) and all the varieties were grouped into five homogenous groups, where the means were not significantly different from one another (Tables 1 and 2). SH-19 and Asterix were in group 'A' by producing highest number of seedlings and this was also visible ...

  5. Plant nutritional status modulates glutamine synthetase levels in ripe tomatoes (Solanum lycopersicum cv. Micro-Tom).

    Science.gov (United States)

    Scarpeci, Telma E; Marro, Martin L; Bortolotti, Santiago; Boggio, Silvana B; Valle, Estela M

    2007-02-01

    Tomato (Solanum lycopersicum) fruit ripening implies that chloroplastic proteins are degraded and new proteins are synthesized. Supplementary nutrition is frequently required when tomato plants begin to fruit and continues until the end of the plant's life cycle. Ammonium assimilation is crucial in these fruit maturation and ripening processes. Glutamine synthetase (GS; EC 6.3.1.2), the main ammonium-fixing enzyme in plants, could not be detected in red fruits of several tomato varieties when growing under standard nutrition. In this paper, we analyze the influence of the nutritional status on the ammonium assimilation capacity of ripe tomato (cv. Micro-Tom) fruit. For this purpose, GS expression and protein profiles were followed in mature green and red fruits harvested from plants grown under standard or supplemented nutrition. Under standard nutrient regime (weekly supplied with 0.5 x Hoagland solution) GS activity was found in chloroplasts (GS2) of mature green fruits, but it was not detected either in the chromoplasts or in the cytosol of red fruits. When plants were shifted to a supplemented nutritional regime (daily supplied with 0.5 x Hoagland solution), GS was found in red fruits. Also, cytosolic transcripts (gs1) preferentially accumulated in red fruits under high nutrition. These results indicate that mature green Micro-Tom fruits assimilate ammonia through GS2 under standard nutrition, while ripe red fruits accumulate GS1 under high nutrition, probably in order to assimilate the extra N-compounds made available through supplemented nutrition.

  6. Oxidative stress and antioxidative mechanisms in tomato (solanum lycopersicum l.) plants sprayed with different pesticides

    International Nuclear Information System (INIS)

    Yildiztekin, M.; Kaya, C.

    2015-01-01

    A glasshouse experiment was conducted to appraise the influence of exogenously applied pesticides such as abamectin, thiamethoxam, pyriproxyfen and acetamiprid on oxidative defence system and some key physiological attributes in tomato (Solanum lycopersicum L.). Each of these pesticides was applied in three doses (recommended dose, twice and three times higher than the recommended dose). Higher doses of pesticides sprayed to the plants resulted in marked increase in leaf free proline content and electrolyte leakage, but in a decrease in shoot dry matter, chl a, chl b and chl a+b in tomato plants as compared to those plants not sprayed with pesticides. These reductions were greater in tomato plants sprayed with highest doses of thiamethoxam (144 mg L-1), whereas the reverse was true for proline content and electrolyte leakage. The foliar application of pesticides at the highest levels caused enhanced accumulation of malondialdehyde (MDA) in most cases, and these being greater in treatment of foliar application of thiamethoxam at the highest level. The highest doses of pesticides promoted the activities of catalase (CAT), peroxidase (POD), and superoxide dismutase (SOD) in most cases. The results clearly indicate that application of pesticides at higher doses than recommended doses provoked both oxidative and antioxidative systems in tomato plants. (author)

  7. In vitro micropropagation of solanum villosum-a potential alternative food plant

    International Nuclear Information System (INIS)

    Iftikhar, A.; Qureshi, R.; Munir, M.

    2015-01-01

    Solanum villosum Miller is annual to biennial herb which is used as potherb as well as fodder/forage that limits its distribution in Pakistan. The aim of this study was to develop a suitable protocol for S. villosum through direct organogenesis. Leaf, stem node and shoot tip explants from the tested plant were inoculated in three different hormonal combinations of BAP (6-benzyl amino purine) alone along NAA (alpha-naphthalene acetic acid) and Kin (Kinetin). Maximum shoot induction was recorded for stem node and leaf (91% each) in MS medium comprising of BAP (1.9 mg/l) and NAA (0.1 mg/l), while shoot tip showed somewhat moderate (81%) response. The highest mean number of shoot (9.1 ± 2 was also obtained for the same medium using leaf explants. Plantlets were successfully rooted in auxin free medium and shifted to green house for multiplication after acclimatizing them. This study may contribute in providing quick and disease free propagation of this neutraceutically and economically potential plant. (author)

  8. Morphology and biomass variations in root system of young tomato plants (Solanum sp.)

    International Nuclear Information System (INIS)

    Álvarez Gil, Marta A.; Fernández, Ana Fita; Ruiz Sánchez, María del C.; Bolarín Jiménez, María del C.

    2016-01-01

    The scarce exploitation of genotypic variability present in plant roots is an attractive breeding choice with regard to abiotic stresses and supports the objective of this work, which is to identify genotypic variation in root system traits of tomato genotypes (Solanum sp.). Thus, five tomato genotypes were studied: the commercial hybrid cultivar Jaguar (S. lycopersicum), Pera, Volgogradiskij and PE-47 entry (S. pennellii), which were collected in Peru, and the interspecific hybrid PeraxPE-47. Plants were grown in hydroponics for 26 days since germination; their roots were extracted and images were digitalized on scanner to evaluate total length, average diameter, the projected area and root length, following the categories per diameter of the whole root system through software Win Rhizo Pro 2003. The dry mass of roots and aerial parts was also recorded. Results indicated that genotypes differed in morphology, length according to diameter, root system spatial configuration and biomass, mainly with respect to the wild salinity resistant species PE-47. The interspecific hybrid PxPE-47 could be used as a rootstock to increase salt tolerance of susceptible cultivars. (author)

  9. Organic production of tomatoes in the amazon region by plants grafted on wild Solanum rootstocks

    Directory of Open Access Journals (Sweden)

    Elaine Aparecida de Paula Farias

    2013-08-01

    Full Text Available The production of organically grown tomatoes in the Amazonian region of Brazil is difficult due to inherent phytosanitary issues. The objectives of the present investigation were to evaluate the productivity of grafted tomato plants (Solanumlycopersicum cv. Santa Adélia grown organically in Rio Branco, Acre, Brazil, and to assess scion/rootstock compatibility under organic growth conditions. The Solanum species employed as rootstocks were S. gilo (jiló, S. lycocarpum (jurubebão, S. stramonifolium (jurubeba vermelha and S. viarum (joá, while the susceptible S.lycopersicum cultivar Santa Adélia was the scion. Ungrafted tomato plants and tomato grafted on tomato rootstock were employed as controls. The experiment was arranged in a completely randomized block design with six treatments and five repetitions of five plants each. Data were submitted to analysis of variance and the significance of differences between treatments were determined using the Tukey test (P<0.05. All ungrafted tomato plants and those comprising tomato grafted on S.lycopersicum rootstock became infected by brown rot and perished. The total numbers of fruits, numbers of marketable fruits, mean masses of fruits, total productivities and productivities of marketable fruits associated with tomato grafted on S. gilo, S. lycocarpum and S. stramonifolium rootstocks were significantly higher (P<0.05 than the equivalent values obtained with tomato grafted on S. viarum rootstock. S. gilo exhibited the best compatibility index (1.11 of all rootstock/scion combinations studied. It is concluded that tomato grafted on S. gilo, S. lycocarpum and S. stramonifolium rootstocks represent viable alternatives for the production of organic tomatoes in the Amazon region.

  10. Expressão eficiente do gene reporter beta-glucuronidase nos tecidos vasculares de batata (Solanum tuberosum L. utilizando de um promotor específico (BRA3 de Agrobacterium rhizogenes Efficient expression of beta-glucuronidase reporter gene in vascular tissue of potato (Solanum tuberosum L. utilizing a specific promoter (BRA3 from Agrobacterium rhizogenes

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Torres

    2003-06-01

    Full Text Available Promotores tecido-específico controlam a transcrição de genes em diferentes tecidos vegetais bem como em diferentes estádios de desenvolvimento da planta, levando à indução de distintos níveis de atividade transiente e/ou estável do gene. Tais promotores podem ser empregados para a expressão seletiva de genes de interesse. O promotor rol A de Agrobacterium rhizogenes, por exemplo, é floema-específico, sugerindo que possa ser empregado em estratégias de defesa de plantas que são infectadas por vírus com replicação restrita ao floema. A expressão do gene marcador da ß-glucuronidase (gus dirigido pelo promotor rol A (pBRA3 foi observada em plantas transgênicas de batata (cvs. Macaca e Baronesa. Entrenós e secções de folhas foram submetidos ao cocultivo com A. tumefaciens. A atividade do gene gus avaliada em brotações resistentes à canamicina não se restringiu ao floema (alto nível de expressão do gene, mas também se manifestou no xilema dos caules. As expressões transiente e estável são, no entanto, tecido-específicas, localizadas sobretudo no sistema vascular de entrenós e ausente em raízes e folhas. As plantas gus positivas foram micropropagadas, plantadas em casa de vegetação e avaliadas por PCR, utilizando-se 'primers' específicos para o gene npt II. Nenhuma alteração fenotípica foi observada em plantas transgênicas, em relação às não transformadas.Tissue-especific promoters allow the modulation of gene transcription in different tissue types as well as in different stages of plant development, leading different levels of transient and stable activity of the gene product. These promoters have been employed for selective gene expression. The Agrobacterium rhizogenes rol A gene promoter (BRA3 controls phloem-specific expression indicating that this promoter might have an important role in plant defense strategies against virus which replicated only in the phloem. The expression of

  11. Notes on some insect galls associated with Solanum plants in South ...

    African Journals Online (AJOL)

    1990-12-18

    . Received 10 ... in press) related to the biological control of Solanum weed species. During ... in the Albany Museum (Natural History) and the National ..... identifying insect specimens. MJ. ... insects imported for weed control.

  12. Oxidative Stress and Antioxidants in Tomato (Solanum lycopersicum) Plants Subjected to Boron Toxicity

    Science.gov (United States)

    Cervilla, Luis M.; Blasco, Begoña; Ríos, Juan J.; Romero, Luis; Ruiz, Juan M.

    2007-01-01

    Background and Aims Boron (B) toxicity triggers the formation of reactive oxygen species in plant tissues. However, there is still a lack of knowledge as to how B toxicity affects the plant antioxidant defence system. It has been suggested that ascorbate could be important against B stress, although existing information is limited in this respect. The objective of this study was to analyse how ascorbate and some other components of the antioxidant network respond to B toxicity. Methods Two tomato (Solanum lycopersicum) cultivars (‘Kosaco’ and ‘Josefina’) were subjected to 0·05 (control), 0·5 and 2 mm B. The following were studied in leaves: dry weight; relative leaf growth rate; total and free B; H2O2; malondialdehyde; ascorbate; glutathione; sugars; total non-enzymatic antioxidant activity, and the activity of superoxide dismutase, catalase, ascorbate peroxidase, monodehydroascorbate reductase, dehydroascorbate reductase, glutathione reductase, ascorbate oxidase and l-galactose dehydrogenase. Key Results The B-toxicity treatments diminished growth and boosted the amount of B, malondialdehyde and H2O2 in the leaves of the two cultivars, these trends being more pronounced in ‘Josefina’ than in ‘Kosaco’. B toxicity increased ascorbate concentration in both cultivars and increased glutathione only in ‘Kosaco’. Activities of antioxidant- and ascorbate-metabolizing enzymes were also induced. Conclusions High B concentration in the culture medium provokes oxidative damage in tomato leaves and induces a general increase in antioxidant enzyme activity. In particular, B toxicity increased ascorbate pool size. It also increased the activity of l-galactose dehydrogenase, an enzyme involved in ascorbate biosynthesis, and the activity of enzymes of the Halliwell–Asada cycle. This work therefore provides a starting point towards a better understanding of the role of ascorbate in the plant response against B stress. PMID:17660516

  13. Control Químico de Maleza en el Cultivo de Papa Solanum tuberosum L., en la Región de Irapuato, Gto., México Control Químico de Maleza en el Cultivo de Papa Solanum tuberosum L., en la Región de Irapuato, Gto., México

    Directory of Open Access Journals (Sweden)

    Luis Pérez Moreno

    2012-02-01

    Full Text Available Este estudio se realizó en el Campo Agrícola Experimental del Instituto de Ciencias Agrícolas de la Universidad de Guanajuato, municipio de Irapuato, Gto., México; las actividades iniciaron en Septiembre de 1998 y culminaron en Diciembre de 1998. La variedad de papa utilizada fue la Alfa. Se evaluaron los tratamientos herbicidas oxadiazón, metribuzín y diurón, comparados con un testigo limpio y un testigo con maleza todo el ciclo. Se usó un diseño experimental de bloques al azar, con cuatro repeticiones. Se analizaron las variables: a respuesta de cada una de las especies de maleza al efecto de los herbicidas y b daño al follaje de la papa por efecto de los herbicidas. Se encontró que ninguno de los herbicidas evaluados ocasionó fitotoxicidad a las plantas de papa. Con respecto a control de maleza, los mejores tratamientos fueron el testigo sin maleza todo el ciclo, el oxadiazón en dosis de 3, 4 y 5 l ha-1 y el metribuzín en dosis de 1 kg ha-1. This study was conducted at the Experimental Agricultural Field of the Institute of Agricultural Sciences of the University of Guanajuato, in Irapuato, Gto., Mexico; the study was started on September 1998 and was ended on December of the same year. The variety used was Alpha. The treatments evaluated were the application of herbicides oxadiazon, metribuzin and diuron, to weeded and unweeded plots for a complete cycle. A randomized block design was used with four replicates. The variables examined were: a response of each weed species to the effect of herbicides and, b damage to the potato leaves affected by herbicides. It was found that none of the evaluated herbicides caused phytointoxication to potato plants. Regarding the weed control the best treatments were the unweeded whole cycle, the oxadiazon at dosages of 3, 4 and 5 l ha-1 and metribuzin at a dosage of 1.0 kg ha-1.  

  14. RESPUESTA DE DIFERENTES POBLACIONES DE Spongospora subterranea f. sp. subterranea A LA ROTACIÓN ENTRE DOS VARIEDADES DE PAPA (Solanum tuberosum ssp. andigena RESPONSE OF DIFFERENT POPULATIONS OF Spongospora subterranea f .sp. subterranea TO ROTATION OF TWO POTATO CULTIVARS (Solanum tuberosum ssp. andigena

    Directory of Open Access Journals (Sweden)

    Sonia Jaramillo Villegas

    2007-12-01

    and different populations of Spongospora subterranea f. sp. subterranea on the powder scab. Cistosori (spore balls was extracted from 23 populations of S. subterranea extracted from pustules in tubers surface or galls in roots from different varieties, from potato regions of Colombia . The incidence and severity degree of these populations was evaluated under the process of the ICA Puracé-Diacol Capiro rotation and viceversa, in three successive harvests, under the mesh house conditions. It was observed that the different pathogen populations did not affect the weight, neither caused powder scab symptoms in the tubers, although presented different severity levels on the roots of two varieties with unpredictable tendency during the different harvests, with low level (> 0 to 2, medium (>2 to 6 and high (>6 symptoms, being more susceptible the Diacol Capiro, which apparently incremented the infection in the soil. The ICA Puracé was low level affected by few population (7/23 with the powder scab, during the first cycle and possibly presented a suppressive effect over the powdery scab for the Diacol Capiro rotation in the second harvest, and then, a rising in the galls of both varieties during the third harvest, in the pots where originally planted, because of a possible increasing of cistosori in the soil. The initial rotation reduces the powder scab symptoms (second harvest in Diacol Capiro, but the ICA Puracé cultivar is more affected trough the generations where Diacol Capiro was growing.

  15. In vitro methods for mutation induction in potato ( Solanum ...

    African Journals Online (AJOL)

    Potato (Solanum tuberosum L.) is an important vegetable and staple crop worldwide and mainly propagated vegetatively. Breeding of potato is problematic and therefore induced mutation is an attractive means of improving the crop. In vitro culture systems, and especially the production of microtubers, are ideal for such ...

  16. Aerobic Mesophilic Bacteria Associated With Irish Potato ( Solanum ...

    African Journals Online (AJOL)

    A total of 15 samples of spoilt Irish potatoes (Solanum tuberosum L.) were collected from five grocery shops in Ile-Ife, Osun State, Nigeria and were analysed for aerobic mesophilic bacterial load. The isolated aerobic mesophilic bacteria were phenotypically characterized by biochemical tests and their susceptibility to ...

  17. Phytohormone profiling in relation to osmotic adjustment in NaCl-treated plants of the halophyte tomato wild relative species Solanum chilense comparatively to the cultivated glycophyte Solanum lycopersicum

    Czech Academy of Sciences Publication Activity Database

    Gharbi, E.; Martínez, J. L.; Benahmed, H.; Hichri, I.; Dobrev, Petre; Motyka, Václav; Quineta, M.; Lutts, S.

    2017-01-01

    Roč. 258, MAY (2017), s. 77-89 ISSN 0168-9452 R&D Projects: GA ČR(CZ) GA16-14649S Institutional support: RVO:61389030 Keywords : antioxidant enzyme-activities * improves salinity tolerance * enhances salt tolerance * abscisic-acid * water-stress * na+-exclusion * accumulation * ethylene * growth * arabidopsis * Osmotic adjustment * Halophyte * Salinity * Solanum chilense * Hormone * Tomato Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.437, year: 2016

  18. Induction and selection of lincomycin-resistant plants in Solanum melongena

    International Nuclear Information System (INIS)

    Sadanandam, A.; Farooqui, M.A.

    1991-01-01

    Cotyledon explants from axenic cultures of Solanum melongena were exposed to 1KR gamma rays and 0.1% ethylmethane sulphonate (EMS). Mutagenised were explants were implanted on shoot regeneration medium containing 100 mg 1 −1 limcomycin. Radiation treatment was efficient in inducing a high frequency of lincomcyn resistant shoots developing on cotyledon explants whereas EMS failed to induce antibiotic resistant shoots. The efficiency of irradiation in inducing lincomycin resistant adventitious shoots and kiloploid nature of chloroplast genome is discussed

  19. Contribution to the knowledge of chemical plants of northeast Brazil: Solanum buddleifolium SENDTN

    OpenAIRE

    Francisco das Chagas Lima Pinto

    2013-01-01

    This work describes the chemical study of Solanum buddleifolium (Solanaceae) aimed the isolation and structural characterization of its secondary metabolites. The chemical prospection was realized using chromatographic techniques such as chromatography over silica gel Sephadex LH-20 and solid phase extraction (SPE) besides High Performance Liquid Chromatography (HPLC) From EtOH were isolated the known compounds β-sitosterol and estigmasterol betulinic acid 13-hidroxysolavetrivone polista...

  20. Genome analysis methods: Solanum tuberosum [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available th ab initio gene predictions, protein similarity and transcripts to build optimal gene models. 39,031 PGSC; http://potato.plantbiolo...gy.msu.edu/index.shtml v4.03 v4.03 10.1038/nature10158 21743474 ...

  1. Turning Waste into Value: Nanosized Natural Plant Materials of Solanum incanum L. and Pterocarpus erinaceus Poir with Promising Antimicrobial Activities

    Directory of Open Access Journals (Sweden)

    Sharoon Griffin

    2016-04-01

    Full Text Available Numerous plants are known to exhibit considerable biological activities in the fields of medicine and agriculture, yet access to their active ingredients is often complicated, cumbersome and expensive. As a consequence, many plants harbouring potential drugs or green phyto-protectants go largely unnoticed, especially in poorer countries which, at the same time, are in desperate need of antimicrobial agents. As in the case of plants such as the Jericho tomato, Solanum incanum, and the common African tree Pterocarpus erinaceus, nanosizing of original plant materials may provide an interesting alternative to extensive extraction and isolation procedures. Indeed, it is straightforward to obtain considerable amounts of such common, often weed-like plants, and to mill the dried material to more or less uniform particles of microscopic and nanoscopic size. These particles exhibit activity against Steinernema feltiae or Escherichia coli, which is comparable to the ones seen for processed extracts of the same, respective plants. As S. feltiae is used as a model nematode indicative of possible phyto-protective uses in the agricultural arena, these findings also showcase the potential of nanosizing of crude “waste” plant materials for specific practical applications, especially—but not exclusively—in developing countries lacking a more sophisticated industrial infrastructure.

  2. Taxonomic Treatment of Solanum Section Petota (Wild Potatoes) in Catálogo de Plantas Vasculares del Cono Sur (Argentina, Chile, Paraguay, Uruguay, y sur del Brasil)

    Science.gov (United States)

    Solanum section Petota (Solanaceae), which includes the cultivated potato (Solanum tuberosum) and its wild relatives, contains over 150 wild species distributed from the southwestern U.S.A. (38°N) to central Argentina and adjacent Chile (41°S). This catalog includes all species from the Southern Con...

  3. Agrobacterium rhizogenes rolB gene affects photosynthesis and chlorophyll content in transgenic tomato (Solanum lycopersicum L.) plants.

    Science.gov (United States)

    Bettini, Priscilla P; Marvasi, Massimiliano; Fani, Fabiola; Lazzara, Luigi; Cosi, Elena; Melani, Lorenzo; Mauro, Maria Luisa

    2016-10-01

    Insertion of Agrobacterium rhizogenes rolB gene into plant genome affects plant development, hormone balance and defence. However, beside the current research, the overall transcriptional response and gene expression of rolB as a modulator in plant is unknown. Transformed rolB tomato plant (Solanum lycopersicum L.) cultivar Tondino has been used to investigate the differential expression profile. Tomato is a well-known model organism both at the genetic and molecular level, and one of the most important commercial food crops in the world. Through the construction and characterization of a cDNA subtracted library, we have investigated the differential gene expression between transgenic clones of rolB and control tomato and have evaluated genes specifically transcribed in transgenic rolB plants. Among the selected genes, five genes encoding for chlorophyll a/b binding protein, carbonic anhydrase, cytochrome b 6 /f complex Fe-S subunit, potassium efflux antiporter 3, and chloroplast small heat-shock protein, all involved in chloroplast function, were identified. Measurement of photosynthesis efficiency by the level of three different photosynthetic parameters (F v /F m , rETR, NPQ) showed rolB significant increase in non-photochemical quenching and a, b chlorophyll content. Our results point to highlight the role of rolB on plant fitness by improving photosynthesis. Copyright © 2016 Elsevier GmbH. All rights reserved.

  4. Resistance of solanum species to phytophthora infestans evaluated in the detached-leaf and whole-plant assays

    International Nuclear Information System (INIS)

    Akhtar, K.P.; Saleem, M.Y.; Asghar, M.

    2012-01-01

    The reaction of 82 tomato genotypes belonging to 8 Solanum and a Lycopersicon species against Phytophthora infestans causing late blight was determined using detached-leaf and whole-plant assays. None of the test genotypes was immune or highly resistant. Of the 82 commercial and wild genotypes only TMS-2 (male-sterile and characterized by indeterminate growth) belonging to Lycopersicon esculentum was resistant with severity index of 2.4 in the detached-leaf assay on 0-5 scale (where 5 was highly susceptible) and percent disease index (%DI) of 23.3% under the whole-plant assay. Among the remaining genotypes, 41 were susceptible and 40 were highly susceptible under the detached-leaf assay, while 18 were susceptible and 63 were highly susceptible under the whole-plant assay. However, there was a significant difference in %DI for genotypes under the whole-plant assay. The response of whole-plants to inoculation with P. infestans in the detached-leaf assay was similar in all cases. The overall screening results indicate that TMS-2 is a good source of resistance and it can be useful for the development of tomato hybrid cultivars resistant to late blight. (author)

  5. Response to nitrate/ammonium nutrition of tomato (Solanum lycopersicum L.) plants overexpressing a prokaryotic NH4(+)-dependent asparagine synthetase.

    Science.gov (United States)

    Martínez-Andújar, Cristina; Ghanem, Michel Edmond; Albacete, Alfonso; Pérez-Alfocea, Francisco

    2013-05-01

    Nitrogen availability is an important limiting factor for plant growth. Although NH4(+) assimilation is energetically more favorable than NO3(-), it is usually toxic for plants. In order to study if an improved ammonium assimilatory metabolism could increase the plant tolerance to ammonium nutrition, tomato (Solanum lycopersicum L. cv P-73) plants were transformed with an NH4(+)-dependent asparagine synthetase (AS-A) gene from Escherichia coli (asnA) under the control of a PCpea promoter (pea isolated constitutive promotor). Homozygous (Hom), azygous (Az) asnA and wild type (WT) plants were grown hydroponically for 6 weeks with normal Hoagland nutrition (NO3(-)/NH4(+)=6/0.5) and high ammonium nutrition (NO3(-)/NH4(+)=3.5/3). Under Hoagland's conditions, Hom plants produced 40-50% less biomass than WT and Az plants. However, under NO3(-)/NH4(+)=3.5/3 the biomass of Hom was not affected while it was reduced by 40-70% in WT and Az plants compared to Hoagland, respectively. The Hom plants accumulated 1.5-4 times more asparagine, glycine, serine and soluble proteins and registered higher glutamine synthetase (GS) and glutamate synthase (GOGAT) activities in the light-adapted leaves than the other genotypes, but had similar NH4(+) and NO3(-) levels in all conditions. In the dark-adapted leaves, a protein catabolism occurred in the Hom plants with a concomitant 25-40% increase in organic acid concentration, while asparagine accumulation registered the highest values. The aforementioned processes might be responsible for a positive energetic balance as regards the futile cycle of the transgenic protein synthesis and catabolism. This explains growth penalty under standard nutrition and growth stability under NO3(-)/NH4(+)=3.5/3, respectively. Copyright © 2013 Elsevier GmbH. All rights reserved.

  6. Interactions of zinc and cadmium toxicity in their effects on growth and in antioxidative systems in tomato plants (Solanum lycopersicum)

    Institute of Scientific and Technical Information of China (English)

    Jaouhra Cherif; Chamseddine Mediouni; Wided Ben Ammar; Fatma Jemal

    2011-01-01

    The interaction between zinc and cadmium was investigated in tomato plants (Solanum lycopersicum).Ten-day-old seedlings were treated with 10 μmol/L CdCl2 associated to different concentrations of ZnCl2 (10, 50, 100, and 150 μmol/L).Zn supply clearly reduced Cd accumulation in leaves and simultaneously increased Zn concentration.Cd induced oxidative stress in leaves as indicated by an increase in thiobarbituric acid-reactive substances (TBARS) level and chlorophyll breakdown.Furthermore, compared with control, Cdtreated plants had significantly higher activities of superoxide dismutase (SOD, EC 1.15.1.1), whereas, catalase (CAT, EC 1.111.1.6),ascorbate peroxidase (APX, EC 1.11.1.11), and glutathione reductase (GR, EC 1.6.4.2) activities were significantly suppressed by Cd addition.Zn supplementation, at low level, restored and enhanced the functional activity of these enzymes (SOD, CAT, APX and GR) as compared to Cd-alone-treated plants.The beneficial effect of adequate Zn level on Cd toxicity was confirmed by a significant decrease in TBARS level and restoration of chlorophyll content.However, when Zn was added at high level in combination with Cd there was an accumulation of oxidative stress, which was higher than that for Cd or excess Zn alone treatments.These results suggested that higher Zn concentrations and Cd are synergistic in their effect on plant growth parameters and oxidative stress.

  7. Efecto de la edad al trasplante y de la concentración de azúcar in vitro sobre la adaptación y el crecimiento de vitroplantas de papa (Solanum tuberosum L. vars. atlantic y 1625 frito lay en invernadero.

    Directory of Open Access Journals (Sweden)

    Rafael Orozco

    2016-03-01

    Full Text Available La aclimatización y posterior crecimiento y desarrollo in vivo de plantas propagadas in vitro constituye una de las etapas culminantes del proceso de micropropagación de una especie. Esta investigación se desarrolló con el objetivo de determinar el efecto de diferentes edades al trasplante (15, 20 y 25 días de cultivo y el preacondicionamiento in vitro con tres niveles de azúcar comercial (15, 30 y 45 g L-1 sobre el crecimiento y desarrollo en invernadero de vitroplantas de papa (Solanum tuberosum L. vars. Atlantic y 1625 Frito Lay. En el primer caso se usó el medio de cultivo MS (1962 suministrado por laboratorios Gibco, a razón de 17 g L-1 y suplementado con vitaminas y aminoácidos del mismo medio. En el segundo caso se usó el medio Hyponex a razón de 2.25 g L-1 suplementado con las vitaminas y aminoácidos del medio MS. Los resultados indican que es posible trasplantar a suelo plantas de ambas variedades en cualquiera de las tres edades, sin afectar el rendimiento de minitubérculos. Sin embargo, la tasa de fotosíntesis aparente (TFA se vio favorecida al incrementarse la edad. Respecto a la influencia del preacondicionamiento in vitro con diferentes concentraciones de azúcar, las plantas de la variedad Atlantic ganaron altura, peso seco de raíz y peso fresco y seco de minitubérculos con 15 g L-1 de azúcar, mientras que en plantas de la variedad 1625, este efecto se dio en la concentración de 30 g L-1; el número de minitubérculos no fue favorecido con las concentraciones de azúcar empleadas en el medio Hyponex, pero sí en el medio MS (1962. En este último caso, la TFA sufrió una ganancia gradual al aumentar la concentración de azúcar.

  8. Evaluación preliminar del efecto que sobre algunas enzimas del suelo tienen diferentes mecanismos de control del hongo (Phytophthora infestans en un cultivo de papa (Solanum tuberosum bajo dos tipos de manejo agrícola (orgánico y convencional

    Directory of Open Access Journals (Sweden)

    Pedro Nel Murcia García

    2004-07-01

    Full Text Available Se evaluó comparativamente el posible efecto diferencial que, sobre la actividad de las enzimas proteasa, fosfatasa ácida, fosfatasa alcalina y celulasa, además del pH y la materia orgánica del suelo, tuvieron los métodos de control de Phytophthora infestans tanto en la agricultura orgánica (purín de Chipaca Bidens pilosum como en la convencional (diversos fungicidas comerciales en plantas de papa (Solanum tuberosum. Igualmente, en los parámetros antes mencionados, se evaluó el efecto de un promotor fúngico utilizado como control del mismo hongo en ambas agriculturas. La investigación se dividió en una fase de campo y una de laboratorio. En la fase de campo, realizada durante siete meses de 1999, se acompañó la siembra, el desarrollo del cultivo y evolución de la enfermedad a través de la determinación de la incidencia y su severidad. En el laboratorio se determinó la actividad enzimática proteasa, fosfatasa ácida, fosfatasa alcalina, celulasa, así como también el pH y porcentaje de materia orgánica. Se encontró que en el manejo agrícola orgánico la actividad de la fosfatasa ácida, la fosfatasa alcalina y la proteasa así como también el pH fueron más influenciados por el estado de desarrollo de las plantas que por efecto del los tratamientos utilizados en el control del hongo. En el manejo agrícola convencional la actividad enzimática de las celulasas fue inhibida significativamente por los fungicidas. La actividad de las proteasas y fosfatasas ácidas fueron estimuladas por efecto de los fungicidas comerciales y por el estado de desarrollo de las plantas. Las actividades enzimáticas fosfatasa ácida, proteasa y celulasa presentaron comportamientos significativamente diferentes entre los cultivos convencional y orgánico. Para el control de la enfermedad, el uso de los fungicidas fue el tratamiento que mejores resultados presentó con una mayor producción de papa pero con mayores gastos de producción, mientras

  9. The characterization of novel mycorrhiza-specific phosphate transporters from ¤Lycopersicon esculentum¤ and ¤Solanum tuberosum¤ uncovers functional redundancy in symbiotic phosphate transport in solanaceous species

    DEFF Research Database (Denmark)

    Nagy, F.; Karandashov, V.; Chague, W.

    2005-01-01

    , is the transfer of phosphate (Pi) from the AM fungus to the plant, facilitated by plasma membrane-spanning Pi transporter proteins. The first mycorrhiza-specific plant Pi transporter to be identified, was StPT3 from potato [Nature 414 (2004) 462]. Here, we describe novel Pi transporters from the solanaceous...... species tomato, LePT4, and its orthologue StPT4 from potato, both being members of the Pht1 family of plant Pi transporters. Phylogenetic tree analysis demonstrates clustering of both LePT4 and StPT4 with the mycorrhiza-specific Pi transporter from Medicago truncatula [Plant Cell, 14 (2002) 2413] and rice......Solanaceous species are among the >200 000 plant species worldwide forming a mycorrhiza, that is, a root living in symbiosis with soil-borne arbuscular-mycorrhizal (AM) fungi. An important parameter of this symbiosis, which is vital for ecosystem productivity, agriculture, and horticulture...

  10. Variedades de batatinha (Solanum tuberosum L. procedentes da Holanda: parte II - resultados experimentais da segunda plantação, no país, com tubérculos importados em 1947

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1948-12-01

    Full Text Available This paper presents the results obtained from six replicated experimental plantings of Irish potatoes in the State of São Paulo, Brazil. The potatoes tubers employed as seed in these test plantings were selected from the crop produced from the original tubers introduced from Holland in 1947. The results obtained from plantings in February 1947 made of the original seed pieces were the subject of a previous publication. The current tests reported herein were carried out in the same areas as those previously reported. The date of the second planting was, September 1947 and the second crop was harvested in February and March of 1948. The results obtained from the second plantings were similar to those secured from the original tests. Phytopthora infection was prevailent and caused considerable damage to the Eersteling and Saskia varieties while the Alpha and Voran varieties appeared to have appreciably more resistance. Under the conditions tested, the Eersteling, Saskia, Doré, and Geelblon were found to be early maturing varieties, while Alpha, Voran, and Libertas, were late maturing varieties. The highest average yields per hectar were 16 tons with the variety Eigenheimer and 12.4 tons with the variety Bintje. The yields obtained from the second plantings were greater than those obtained from the first plantings. This difference in yield has been attributed to the more favorable distribution of rain in the second growing season.

  11. Plant population structure and insect herbivory on Solanum mauritianum Scopoli (Solanaceae in southern Brazil: a support to biological control

    Directory of Open Access Journals (Sweden)

    Deise Mari Barboza

    2009-04-01

    Full Text Available Solanum mauritianum Scopoli (Solanaceae, a native Brazilian shrub, has become naturalized and invasive in several countries. In South Africa, where invasions are severe, herbivorous insects that attack S. mauritianum in its native area have been considered for introduction as biological control agents. To assess the action of such herbivores on the plant, studies were carried out on a population of S. mauritianum in an area undergoing regeneration in southern Brazil. An analysis of the structure of that population was performed, as well as of herbivory by insects, in particular of Anthonomus (Curculionidae. The population structure showed an "inverted J" pattern in diameter classes, but not in height classes. Individual plants showed an aggregate distribution. The damage caused by Anthonomus did not amount to the loss of a large leaf area, but since it was inflicted on young leaves and in a large proportion, could lead to the survival decrease.Solanum mauritianum Scopoli (Solanaceae, um arbusto endêmico do sul do Brasil, naturalizou-se e tornou-se invasor em vários países do mundo. Na África do Sul, onde as invasões são severas, insetos fitófagos associados à planta no país de origem têm sido considerados para introdução como agentes de controle biológico. Para avaliar a ação de tais insetos no ambiente natural, foram conduzidos estudos em uma população de S. mauritianum em uma área em regeneração no sul do Brasil. Foi realizada análise da estrutura populacional, bem como da herbivoria causada por insetos, em particular para uma espécie do gênero Anthonomus (Curculionidae, para subsidiar o trabalho sobre controle biológico. A estrutura da população mostrou um padrão "J invertido" nas classes de diâmetro, mas não nas classes de altura; a distribuição espacial dos indivíduos era agregada. O dano causado por Anthonomus sp. não refletiu na perda real de grande área foliar. No entanto, uma vez que foi detectada uma

  12. Enhancement of antidandruff activity of shampoo by biosynthesized silver nanoparticles from Solanum trilobatum plant leaf

    Science.gov (United States)

    Pant, Gaurav; Nayak, Nitesh; Gyana Prasuna, R.

    2013-10-01

    The present investigation describes simple and effective method for synthesis of silver nanoparticles via green route. Solanum trilobatum Linn extract were prepared by both conventional and homogenization method. We optimized the production of silver nanoparticles under sunlight, microwave and room temperature. The best results were obtained with sunlight irradiation, exhibiting 15-20 nm silver nanoparticles having cubic and hexagonal shape. Biosynthesized nanoparticles were highly toxic to various bacterial strains tested. In this study we report antibacterial activity against various Gram negative ( Klebsiella pneumoniae, Vibrio cholerae and Salmonella typhi) and Gram positive ( Staphylococcus aureus, Bacillus cereus and Micrococcus luteus) bacterial strains. Screening was also performed for any antifungal properties of the nanoparticles against human pathogenic fungal strains ( Candida albicans and Candida parapsilosis). We also demonstrated that these nanoparticles when mixed with shampoo enhance the anti-dandruff effect against dandruff causing fungal pathogens ( Pityrosporum ovale and Pityrosporum folliculitis). The present study showed a simple, rapid and economical route to synthesize silver nanoparticles and their applications hence has a great potential in biomedical field.

  13. In vitro plant regeneration from leaf explants of Solanum pimpinellifolium L.

    Directory of Open Access Journals (Sweden)

    Shirley Valderrama-Alfaro

    2011-01-01

    Full Text Available Tomato is a species of agricultural importance. Besides, it is a source of vitamins, minerals and antioxidant compounds. Therefore it is essential to obtain varieties resistant to diseases. Solanum pimpinellifolium L. ‘Tomatillo wild’, one of the wild relatives of tomato, is considered multipurpose reservoir of genes. This characteristic must be exploited. In vitro plantlets from leaves of ‘wild tomatillo’ were regenerated with this objective. A system for in vitro germination of seeds obtained from ex vitro sources was created. The use of seed allowed obtaining adequate seedlings in a short time to start regeneration. Thein vitro response of explants was evaluated in four treatments. The Murashige and Skoog (MS basal culture medium supplemented with a-naphthaleneacetic acid (NAA and 6-benzyl aminopurine (BAP was used in different combinations. The higher percentage (30% of shoot induction was achieved with 0.1 mg l1 NAA / 1 mg l1 BAP. The presence of callus and roots was observed after seven days of culture in the combination treatment with 1 mg l1 NAA / 0.1 mg l1 BAP. Callus showed 1 or 2 adventitious shoots per explant after 30 days of culture and 3 to 6 shoots after seventy days. Furthermore, the presence of fully formed adventitious plantlets (shoot and root was observed after the fifth week of culture. Therefore, the best combination for in vitro regeneration is NAA 0.1 mg l1 / 1 mg l1 BAP. Keywords: auxin, cytokinins, indirect organogenesis

  14. Impact of recombination on polymorphism of genes encoding Kunitz-type protease inhibitors in the genus Solanum.

    Science.gov (United States)

    Speranskaya, Anna S; Krinitsina, Anastasia A; Kudryavtseva, Anna V; Poltronieri, Palmiro; Santino, Angelo; Oparina, Nina Y; Dmitriev, Alexey A; Belenikin, Maxim S; Guseva, Marina A; Shevelev, Alexei B

    2012-08-01

    The group of Kunitz-type protease inhibitors (KPI) from potato is encoded by a polymorphic family of multiple allelic and non-allelic genes. The previous explanations of the KPI variability were based on the hypothesis of random mutagenesis as a key factor of KPI polymorphism. KPI-A genes from the genomes of Solanum tuberosum cv. Istrinskii and the wild species Solanum palustre were amplified by PCR with subsequent cloning in plasmids. True KPI sequences were derived from comparison of the cloned copies. "Hot spots" of recombination in KPI genes were independently identified by DnaSP 4.0 and TOPALi v2.5 software. The KPI-A sequence from potato cv. Istrinskii was found to be 100% identical to the gene from Solanum nigrum. This fact illustrates a high degree of similarity of KPI genes in the genus Solanum. Pairwise comparison of KPI A and B genes unambiguously showed a non-uniform extent of polymorphism at different nt positions. Moreover, the occurrence of substitutions was not random along the strand. Taken together, these facts contradict the traditional hypothesis of random mutagenesis as a principal source of KPI gene polymorphism. The experimentally found mosaic structure of KPI genes in both plants studied is consistent with the hypothesis suggesting recombination of ancestral genes. The same mechanism was proposed earlier for other resistance-conferring genes in the nightshade family (Solanaceae). Based on the data obtained, we searched for potential motifs of site-specific binding with plant DNA recombinases. During this work, we analyzed the sequencing data reported by the Potato Genome Sequencing Consortium (PGSC), 2011 and found considerable inconsistence of their data concerning the number, location, and orientation of KPI genes of groups A and B. The key role of recombination rather than random point mutagenesis in KPI polymorphism was demonstrated for the first time. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  15. Adubação mineral para a batatinha - Solanum tuberosum L: influência dos elementos N, P e K em solos ricos em matéria orgânica do Vale do Paraíba

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1951-01-01

    Full Text Available Besults are presented of mineral fertilizer trials witht Irish potato crop in the State of São Paulo. The experiments were conducted in the flat lands of the Paraíba River banks. In this region, potato plantings are usually made from May to October, a period with little rain, :nul practically free from flood. From October to April, when good weather conditions prevail, rice is almost the only crop grown. Iu other regions of the State, potato is planted in February or in August. Chemical analyses of an average sample of the soil revealed a high organic matter content, about seven fold higher total nitrogen content and a twelve fold higher total carbon content, as compared with those found in a soil sample taken from Capão Bonito, an important potato area in the State, where phosphoric acid has been found to be responsible for increases in tuber productions. The experimental design was arranged so that conclusions could be drawn from the influence of increasing amounts of each nutrient element N, P and K, in the presence of a constant amount of the other two. In spite of the high total nitrogen content of the soil, results have shown this element not to he in available form for plants. In these experiments, application of nitrogen has been found to be effective and even decisive in increasing tuber yield. Lack of this element results in a lower production, in some cases, even inferior to check plots. In experiment n.° 38, for instance, PK yielded two tons of tubers per hectar, whereas NK and NP yielded, respectively, 1.1.9 and 12.4 tons. In another trial, n.° 40 BK yielded 10.5 tons per hectar (less than check, while NPK yielded 16.2 tons. From the economical point of view, an amount of 80 kg of N to the hectar in the presence of PK, brougth better profits, application of PK alone, resulted in losses. Determinations of starch content in tubers of every treatment have shown no appreciable differences between them.

  16. Variedades de batatinhas (Solanum tuberosum L. procedentes da Holanda: Parte I - Resultados experimentais da primeira plantação, no país, com tubérculos importados em 1947

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1948-12-01

    Full Text Available The author reports the results of six experiments with eight yellow fleshed potato varieties from Holland, conducted at six different locations in the State of São Paulo. Time of planting was February-March, less favorable than August-September, because of climatic conditions during the growth period (somewhat dry weather. For this reason, yields were not good. Observations were made on development; resistance, precocity and production of varieties, as well as specific gravety of tubers. Under the conditions of the experiments the varieties Voran and Alpha were the least susceptible to Phytpphthora while Eersteling, and Saskia were the most susceptible. The Doré, Eersteling, Saskia and Geelblon were found to be early maturing varieties while Alpha, Voran and Libertas were late maturing varieties. The varieties Eigenheimer and Bintje revealed themselves the better yielders, with about 7.3 metric tons of tubers per hectare. Yields of next experiments, conducted at September-October, are expected to be better.

  17. Fertilización con azufre en el cultivo de papa (Solanum tuberosum L. para la industria en el Sudeste Bonaerense Effect of sulfur fertilization on potato for the processing industry in southeastern Buenos Aires

    Directory of Open Access Journals (Sweden)

    Claudia Marcela Giletto

    2012-07-01

    10 (10 kg S ha-1 and S20 (20 kg S ha-1. Total dry matter and S accumulation in plant were not affected by S fertilization. The N:S ratio decreased during the growing season in both sites. This ratio was below the critical threshold of 15:1, wich indicates that the crop was not S deficient. Yield, S concentration and N:S ratio in tubers were not affected by S fertilization in any site. The maximum amount of S accumulated in the tubers at harvest averaged 18.8 and 14.2 kg ha-1 in Site 1 and 2, respectively. Based on the mass balance of S, the main destination of this nutrient in the soil-plant system was to form residual S . In potato, the contributions of S by the application of fungicide and water from irrigation were considerable, reaching values of 14 and 17 kg ha-1, respectively. Therefore, it is highly recommended to determine the contributions of these two sources of S in order to develop strategies for S fertilization on potato.

  18. Modification of the health-promoting value of potato tubers field grown under drought stress: emphasis on dietary antioxidant and glycoalkaloid contents in five native andean cultivars (Solanum tuberosum L.).

    Science.gov (United States)

    Andre, Christelle M; Schafleitner, Roland; Guignard, Cédric; Oufir, Mouhssin; Aliaga, Carlos Alberto Alvarado; Nomberto, Giannina; Hoffmann, Lucien; Hausman, Jean-François; Evers, Danièle; Larondelle, Yvan

    2009-01-28

    The effects of drought stress on dietary antioxidant and glycoalkaloid contents in potato tubers were investigated using a selection of five native Andean cultivars. Both freshly harvested and 4 month-stored tubers were analyzed. Responses to drought stress were highly cultivar-specific. The antioxidant contents of the yellow tuber-bearing cultivars (Sipancachi and SS-2613) were weakly affected by the drought treatment, whereas the pigmented cultivars demonstrated highly cultivar-dependent variations. A drastic reduction of anthocyanins and other polyphenols was revealed in the red- (Sullu) and purple-fleshed (Guincho Negra) cultivars, whereas an increase was shown in the purple-skinned and yellow-fleshed cultivar (Huata Colorada). The hydrophilic antioxidant capacity (evaluated by Folin-Ciocalteu and H-oxygen radical absorbance capacity assays) was highly correlated with the polyphenol content and followed, therefore, the same behavior upon drought. Carotenoid contents, including beta-carotene, as well as vitamin E, tended to increase or remain stable following drought exposure, except for the cultivar Sullu, in which the level of these lipophilic antioxidants was decreased. Vitamin C contents were not affected by drought with the exception of Guincho Negra, in which the level was increased. These variations of health-promoting compounds were associated with increased or stable levels of the toxic glycoalkaloids, alpha-solanine and alpha-chaconine. Storage at 10 degrees C for 4 months tended to decrease the concentrations of all dietary antioxidants, except those of vitamin E. This storage also reduced the drought-induced variations observed in freshly harvested tubers. These results were discussed in terms of their implications for human diet and health as well as in plant stress defense mechanisms.

  19. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96929 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  20. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96944 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  1. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT97016 Solanum tuberosum Solanaceae ... After baking darkening Non-enzymatic discolo...uration of french fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  2. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96931 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  3. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96911 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  4. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96668 Solanum tuberosum Solanaceae ... After baking darkening Non-enzymatic discolo...uration of french fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  5. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96940 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  6. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96935 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  7. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96933 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  8. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96937 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  9. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT97018 Solanum tuberosum Solanaceae ... After baking darkening Non-enzymatic discolo...uration of french fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  10. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96927 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  11. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96946 Solanum tuberosum Solanaceae ... after baking darkening Non-enzymatic discolo...uration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after baking.

  12. Determination of the starch-phosphorylating enzyme activity in plant extracts

    DEFF Research Database (Denmark)

    Ritte, G.; Steup, M.; Kossmann, J.

    2003-01-01

    For quantification of alpha-glucan, water dikinase(GWD) activity in crude extracts of plant tissues a radio-labeling assay was established that uses soluble starch and P-33-labeled ATP as phosphate acceptor and donor, respectively. A constant rate of starch labeling was observed only if the ATP...... incorporation of phosphate whereas extracts from potato (Solanum tuberosum L.) tuber expressing a GWD antisense construct exhibited less activity than the wild-type control. To our knowledge this is the first time that a quantification of the starch-phosphorylating activity has been achieved in plant crude...

  13. From introduced American weed to Cape Verde Islands endemic: the case of Solanum rigidum Lam. (Solanaceae, Solanum subgenus Leptostemonum).

    Science.gov (United States)

    Knapp, Sandra; Vorontsova, Maria S

    2013-01-01

    A Solanum species long considered an American introduction to the Cape Verde Islands off the west coast of Africa is identified as Solanum rigidum, a member of the Eggplant clade of Old World spiny solanums (Solanum subgenus Leptostemonum) and is probably endemic to the Cape Verde Islands. Collections of this species from the Caribbean are likely to have been introduced from the Cape Verde Islands on slave ships. We discuss the complex nomenclatural history of this plant and provide a detailed description, illustration and distribution map. The preliminary conservation status of Solanum rigidum is Least Concern, but needs to be reassessed in light of its endemic rather than introduced status.

  14. Heterologous expression of a ketohexokinase in potato plants leads to inhibited rates of photosynthesis, severe growth retardation and abnormal leaf development

    DEFF Research Database (Denmark)

    Geigenberger, P.; Regierer, B.; Lytovchenko, A.

    2004-01-01

    of ketohexokinase but did not accumulate fructose 1-phosphate. They were, however, characterised by a severe growth retardation and abnormal leaf development. Studies of (14)CO(2) assimilation and metabolism, and of the levels of photosynthetic pigments, revealed that these lines exhibited restricted photosynthesis......In the present paper we investigated the effect of heterologous expression of a rat liver ketohexokinase in potato (Solanum tuberosum L.) plants with the aim of investigating the role of fructose 1-phosphate in plant metabolism. Plants were generated that contained appreciable activity...

  15. Impacto dos nutrientes N e K e de açúcares solúveis sobre populações de Diabrotica speciosa (Germar (Coleoptera, Chrysomelidae e Agrotis ipsilon (Hüfnagel (Lepidoptera, Noctuidae na cultura da batata, Solanum tuberosum L. (Solanaceae Impact of the nutrients N and K and soluble sugars on Diabrotica speciosa (Germar (Coleoptera, Chrysomelidae and Agrotis ipsilon (Hüfnagel (Lepidoptera, Noctuidae populations in potato crops, Solanum tuberosum L. (Solanaceae

    Directory of Open Access Journals (Sweden)

    Edson Henrique de Azeredo

    2004-03-01

    Full Text Available Foi estudada a ocorrência de Diabrotica speciosa (Germar, 1824 (Coleoptera, Chrysomelidae e de Agrotis ipsilon (Hüfnagel, 1767 (Lepidoptera, Noctuidae em plantas de batata, cultivares Achat e Monalisa, influenciadas por dosagens de nitrogênio e potássio, e teor mínimo de açúcares solúveis. Os seguintes parâmetros foram avaliados: concentração de nutrientes minerais e açúcar em folha verde, folha senescente, folha em abcisão, haste, tubérculo e planta total usando extratos de infusão em etanol 80%. A maior infestação por larvas de D. speciosa foi na cultivar Monalisa a 150 kg.ha-1 de N + K com 27,03% a PThe occurrence of Diabrotica speciosa (Germar, 1824 and Agrotis ipsilon (Hüfnagel, 1767 on the potato cultivars Achat and Monalisa, influenced by nitrogen and potassium dosage, and minimum theor of soluble sugars, was studied. The following parameters were evaluated: concentration of mineral nutrient and sugar in green leaf, senescent leaf, leaf in abscission, stem, tubercle and total plant using extracts of infusion in ethanol 80%. The largest infestation of D. speciosa larvae was on Monalisa cultivar at 150 kg.ha-1 of N + K with 27.03% at P< 0,05. It was observed that the effect of the dosage of N + K in the increment of the concentration of soluble sugars increased the damages in the tubercles and stems by A. ipsilon. The infestation by these species increased to 58.82% on the Monalisa cultivar, when the nitrogen dosage increased from zero to 150 kg.ha-1, in the absence of potassium. On the other hand, high dosage of K reduced the damages by A. ipsilon on Monalisa cultivar. However, it did not influence the storage of soluble sugar. The results indicated that in Achat cultivar the accumulated soluble sugar was reduced, probably sensibilized by elevation of potassic fertilization dosing, differing from Monalisa cultivar, in which the influence was by nitrogen dosing.

  16. Efectividad Biológica de TCMTB para el Control de la Costra Negra Rhizoctonia solani Kühn de la Papa Solanum Tuberosum L., en la Región de León, Guanajuato, México Efectividad Biológica de TCMTB para el Control de la Costra Negra Rhizoctonia solani Kühn de la Papa Solanum Tuberosum L., en la Región de León, Guanajuato, México

    Directory of Open Access Journals (Sweden)

    Fernando Javier Cantú Galindo

    2012-02-01

    Full Text Available During the 1988 summer-fall growing cycle in the Mexican region of Leon, Guanajuato the fungicide 2-(Thiocyanomethylthio benzothiazole (TCMTB was evaluated applying it at the rate of 6, 8 and 10 liters per hectare for the control of soil borne Black Scurf R. solani. A randomized block design with four reps was used. An evaluation was made of the following: emerged stems, phytotoxical damage, percentage of damaged shoots and stems by R. solani, yield and tuber quality; finally, percentage of R. solani damaged tuber and percentage of tubers with over 5% of damage inflicted by R. solani. It was found that no phytotoxic effect of fungicide to the potato crop was observed; that any of the fungicides comprising treatments protected the plant shoots; that no statistic differences were found among treatments pertaining tuber yield; finally the rates 8.0 and 10.0 l/ha of TCMTB and 5.0 kg/ha of pencycuron produced 27, 20 y 25 percentage of tubers with over 5% of damage inflicted by R. solani, propitiated the highest potato quality when reducing R. solani damage to tubers. En la región de León, Guanajuato, México durante el ciclo verano-otoño 1998, se evaluó el fungicida 2-(Thiocyanomethylthio benzothiazole (TCMTB en dosis de 6, 8 y 10 litros por hectárea para el control del hongo del suelo Rhizoctonia solani Kühn. Se usó un diseño de bloques al azar, con cuatro repeticiones. Se evaluó el número de tallos emergidos, el efecto fitotóxico, los porcentajes de brotes y tallos dañados por R. solani, el rendimiento y calidad del tubérculo; finalmente, el porcentaje de daño de R. solani al tubérculo y el porcentaje de tubérculos con más del 5% de daño por R. solani. Se encontró que no hubo efecto fitotóxico del fungicida al cultivo de papa; que cualquiera de los tratamientos que contenían fungicidas protegieron los brotes de las plantas; que no hubo diferencias estadísticas entre tratamientos con respecto al rendimiento de tub

  17. The impact of aeration on potato ( Solanum tuberosum L.) minituber ...

    African Journals Online (AJOL)

    Aeroponic systems are more effective than hydroponics for minituber production, as provided by the optimal system for root oxygenation. The study was conducted to improve conventional hydroponic systems by applying aeration so as to enhance potato minituber production yield via providing adequate oxygen in the root ...

  18. Influence of ventilation and media on potato (Solanum tuberosum L ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... Considering the most suitable relationship between ventilation and media in this study, two mixtures of perlite and coir (3:1, light and 1:3, heavy v/v) were applied to determine the growth characteristics var. Sante of potato plantlets. As potato has high potential in minituber production, different levels of.

  19. The efficacy of aqueous leaf extract of Solanum tuberosum on ...

    African Journals Online (AJOL)

    Human schistosomiasis is one of the important diseases of helminth origin; it is among the most devastating infectious parasitic disease responsible for several deaths and economic losses amongst ... The skinned suspended tails were then immersed in the test-tube containing 150 cercariae suspension for mice infections.

  20. The impact of aeration on potato (Solanum tuberosum L.) minituber ...

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-18

    Mar 18, 2015 ... 2Department of Crop Science, Faculty of Agriculture, Universiti Putra Malaysia, Malaysia. 3Department of ... aeroponic systems in potato minituber production showed ...... seed as an important factor for growth and total yield.

  1. Shooting responses of potato ( Solanum tuberosum L.) varieties in ...

    African Journals Online (AJOL)

    A study was conducted in 2012 and 2013 at IRAD Bambui (Cameroon) to evaluate the rate of shooting in four improved IRAD potato varieties: Cipira, Tubira, Mafo and Bambui wonder. Liquid and solid media stocks prepared according to the International Potato Center (CIP)'s protocol were used. A randomized complete ...

  2. Parafilimonas rhizosphaerae sp. nov., isolated from the rhizosphere of tomato plant (Solanum lycopersicum L.).

    Science.gov (United States)

    Cho, Hayoung; Ahn, Jae-Hyung; Weon, Hang-Yeon; Joa, Jae-Ho; Hong, Seung-Beom; Seok, Soon-Ja; Kim, Jeong-Seon; Kwon, Soon-Wo; Kim, Soo-Jin

    2017-07-01

    A bacterial strain, designated T16E-198T, was isolated from the rhizosphere of tomato plant collected from a farm on Buyeo-gun, Chungcheongnam-do, South Korea. The strain was aerobic, Gram-stain-negative, rod-shaped, non-flagellated and yellow-pigmented. Strain T16E-198T was mesophilic, catalase- and oxidase-positive and with flexirubin-type pigments. A phylogenetic tree based on 16S rRNA gene sequences showed that strain T16E-198T formed a lineage with Parafilimonas terrae 5GHs7-2T, sharing highest sequence similarity of 98.4 % with it and less than 93 % with all the other validly published species. The major fatty acids were iso-C15 : 0, iso-C17 : 0 3-OH and iso-C15 : 1 G. The predominant menaquinone was MK-7. The polar lipids were phosphatidylethanolamine, one unknown aminophospholipid, five unknown aminolipids and five unknown lipids. The DNA G+C content was 41.2 mol%. On the basis of the phenotypic, phylogenetic and chemotaxonomic data presented, strain T16E-198T is considered to represent a novel species of the genus Parafilimonas, for which the name Parafilimonas rhizosphaerae sp. nov. is proposed; the type strain is T16E-198T (=KACC 18786T=JCM 31601T).

  3. AFLP analysis reveals a lack of phylogenetic structure within Solanum section Petota

    Directory of Open Access Journals (Sweden)

    Vleeshouwers Vivianne GAA

    2008-05-01

    Full Text Available Abstract Background The secondary genepool of our modern cultivated potato (Solanum tuberosum L. consists of a large number of tuber-bearing wild Solanum species under Solanum section Petota. One of the major taxonomic problems in section Petota is that the series classification (as put forward by Hawkes is problematic and the boundaries of some series are unclear. In addition, the classification has received only partial cladistic support in all molecular studies carried out to date. The aim of the present study is to describe the structure present in section Petota. When possible, at least 5 accessions from each available species and 5 individual plants per accession (totally approx. 5000 plants were genotyped using over 200 AFLP markers. This resulted in the largest dataset ever constructed for Solanum section Petota. The data obtained are used to evaluate the 21 series hypothesis put forward by Hawkes and the 4 clade hypothesis of Spooner and co-workers. Results We constructed a NJ tree for 4929 genotypes. For the other analyses, due to practical reasons, a condensed dataset was created consisting of one representative genotype from each available accession. We show a NJ jackknife and a MP jackknife tree. A large part of both trees consists of a polytomy. Some structure is still visible in both trees, supported by jackknife values above 69. We use these branches with >69 jackknife support in the NJ jackknife tree as a basis for informal species groups. The informal species groups recognized are: Mexican diploids, Acaulia, Iopetala, Longipedicellata, polyploid Conicibaccata, diploid Conicibaccata, Circaeifolia, diploid Piurana and tetraploid Piurana. Conclusion Most of the series that Hawkes and his predecessors designated can not be accepted as natural groups, based on our study. Neither do we find proof for the 4 clades proposed by Spooner and co-workers. A few species groups have high support and their inner structure displays also

  4. Genome sequence of M6, a diploid inbred clone of the high glycoalkaloid-producing tuber-bearing potato species Solanum chacoense, reveals residual heterozygosity

    Science.gov (United States)

    Background: Potato (Solanum tuberosum) is the world’s most important vegetable crop and central to global food security. Cultivated potato is a highly heterozygous autotetraploid that presents challenges in genome analyses and breeding. Numerous wild potato species serve as a resource for introgress...

  5. Effect of Post-Infiltration Soil Aeration at Different Growth Stages on Growth and Fruit Quality of Drip-Irrigated Potted Tomato Plants (Solanum lycopersicum.

    Directory of Open Access Journals (Sweden)

    Yuan Li

    Full Text Available Soil hydraulic principles suggest that post-infiltration hypoxic conditions would be induced in the plant root-zone for drip-irrigated tomato production in small pots filled with natural soil. No previous study specifically examined the response of tomato plants (Solanum lycopersicum at different growth stages to low soil aeration under these conditions. A 2 × 6 factorial experiment was conducted to quantify effects of no post-infiltration soil aeration versus aeration during 5 different periods (namely 27-33, 34-57, 58-85, 86-99, and 27-99 days after sowing, on growth and fruit quality of potted single tomato plants that were sub-surface trickle-irrigated every 2 days at 2 levels. Soil was aerated by injecting 2.5 liters of air into each pot through the drip tubing immediately after irrigation. Results showed that post-infiltration aeration, especially during the fruit setting (34-57 DAS and enlargement (58-85 DAS growth stages, can positively influence the yield, root dry weight and activity, and the nutritional (soluble solids and vitamin C content, taste (titratable acidity, and market quality (shape and firmness of the tomato fruits. Interactions between irrigation level and post-infiltration aeration on some of these fruit quality parameters indicated a need for further study on the dynamic interplay of air and water in the root zone of the plants under the conditions of this experiment.

  6. Effect of Post-Infiltration Soil Aeration at Different Growth Stages on Growth and Fruit Quality of Drip-Irrigated Potted Tomato Plants (Solanum lycopersicum).

    Science.gov (United States)

    Li, Yuan; Jia, Zongxia; Niu, Wenquan; Wang, Jingwei; Zhang, Mingzhi

    2015-01-01

    Soil hydraulic principles suggest that post-infiltration hypoxic conditions would be induced in the plant root-zone for drip-irrigated tomato production in small pots filled with natural soil. No previous study specifically examined the response of tomato plants (Solanum lycopersicum) at different growth stages to low soil aeration under these conditions. A 2 × 6 factorial experiment was conducted to quantify effects of no post-infiltration soil aeration versus aeration during 5 different periods (namely 27-33, 34-57, 58-85, 86-99, and 27-99 days after sowing), on growth and fruit quality of potted single tomato plants that were sub-surface trickle-irrigated every 2 days at 2 levels. Soil was aerated by injecting 2.5 liters of air into each pot through the drip tubing immediately after irrigation. Results showed that post-infiltration aeration, especially during the fruit setting (34-57 DAS) and enlargement (58-85 DAS) growth stages, can positively influence the yield, root dry weight and activity, and the nutritional (soluble solids and vitamin C content), taste (titratable acidity), and market quality (shape and firmness) of the tomato fruits. Interactions between irrigation level and post-infiltration aeration on some of these fruit quality parameters indicated a need for further study on the dynamic interplay of air and water in the root zone of the plants under the conditions of this experiment.

  7. Chromium toxicity tolerance of Solanum nigrum L. and Parthenium hysterophorus L. plants with reference to ion pattern, antioxidation activity and root exudation.

    Science.gov (United States)

    UdDin, Islam; Bano, Asghari; Masood, Sajid

    2015-03-01

    Chromium (Cr), being a highly toxic metal, adversely affects the mineral uptake and metabolic processes in plants when present in excess. The current study was aimed at investigating the Cr accumulation in various plant tissues and its relation to the antioxidation activity and root exudation. Plants were grown in soil spiked with different concentrations of Cr for three weeks in pots and analysed for different growth, antioxidants and ion attributes. Furthermore, plants treated with different concentrations of Cr in pots were shifted to rhizobox-like system for 48h and organic acids were monitored in the mucilage dissolved from the plant root surface, mirroring rhizospheric solution. The results revealed that the Cr application at 1mM increased the shoot fresh and dry weight and root dry weight of Solanum nigrum, whereas the opposite was observed for Parthenium hysterophorus when compared with lower levels of Cr (0.5mM) or control treatment. In both plant species, Cr and Cl concentrations were increased while Ca, Mg and K concentrations in root, shoot and root exudates were decreased with increasing levels of Cr. Higher levels of Cr treatments enhanced the activities of SOD, POD and proline content in leaves of S. nigrum, whereas lower levels of Cr treatment were found to have stimulatory effects in P. hysterophorus. P. hysterophorus exhibited highest exudation of organic acid contents. With increasing levels of Cr treatments, citric acid concentration in root exudates increased by 35% and 44% in S. nigrum, whereas 20% and 76% in P. hysterophorus. Cr toxicity was responsible for the shoot growth reduction of S. nigrum and P. hysterophorus, however, shoot growth response was different at different levels of applied Cr. Consequently, Cr stress negatively altered the plant physiology and biochemistry. However, the enhanced antioxidant production, Cl uptake and root exudation are the physiological and biochemical indicators for the plant adaptations in biotic systems

  8. Acúmulo de massa seca e de macronutrientes por plantas de Glycine max e Solanum americanum Accumulation of dry mass and macronutrients by Glycine max and Solanum americanum plants

    Directory of Open Access Journals (Sweden)

    S. Bianco

    2012-03-01

    S.Soybean is one of the main crops in Brazil, but its productivity is very affected by weed competition. Two experiments were carried out in Jaboticabal, SP, Brazil, under greenhouse conditions to determine the accumulation and distribution of dry mass and macronutrients in soybean cv. BR-16, from October 2000 to February 2001, and Solanum americanum plants, from January to May 1995. Plants were grown in seven liter pots filled with river sand substrate and were daily irrigated with nutrient solution. The treatments were constituted by the times of samplings carried out at 14 day intervals, starting 21 days after emergence (DAE. Soybean evaluation was extended to 161 DAE, while S. americanum was extended to 119 DAE. The point of maximum theoretical accumulation of dry mass in soybean occurred at 104 DAE (35.00 g per plant while for S. americanum, it occurred at 143 DAE (179.62 g per plant. From emergence until 49 and 63 DAE, leaves showed higher participation in dry mass accumulation of soybean and S. americanum, respectively. After these periods, an inversion could be observed, with leaves being surpassed by stems for the weeds, and by stems and later, by reproductive structures, for the crop. Macronutrient uptake rate reached higher values between 69 to 87 DAE for soybean and between 105 to 119 DAE for S. americanum. Considering the mean inflexion point values observed in soybean crop, at 75 DAE, it can be evidenced that one soybean plant theoretically accumulated 23.90 g of dry mass, 564.40 mg of N, 7.10 mg of P, 490.80 mg of K, 487.00 mg of Ca, 156.60 mg of Mg and 36.00 mg of S, while one S. americanum plant theoretically accumulated 33.75 g of dry mass, 875.96 mg of N, 88.46 mg of P, 983.54 mg of K, 647.60 mg of Ca, 100.93 mg of Mg, and 42.15 mg of S.

  9. Effect of biologically synthesized copper oxide nanoparticles on metabolism and antioxidant activity to the crop plants Solanum lycopersicum and Brassica oleracea var. botrytis.

    Science.gov (United States)

    Singh, Ajey; Singh, N B; Hussain, Imtiyaz; Singh, Himani

    2017-11-20

    Study on the ecological effect of metal oxide nanomaterials (NMs) has quickly amplified over the precedent years because it is assumed that these NMs will sooner or later be released into the environment. The present study deals with biologically oriented process for the green synthesis of copper oxide nanoparticles (CuO NPs) by using Morus alba leaf extract as reducing agent. Powder X-ray diffraction (XRD) and transmission electron microscope (TEM) analysis revealed the monoclinic phase and 20-40nm size respectively. The presence of reducing and capping agents revealed by Fourier transform infrared (FTIR) spectroscopy. The seedlings of Brassica oleracea var. botrytis and Solanum lycopersicum were exposed to 10, 50, 100, and 500mgL -1 concentrations of CuO NPs in the sand medium. Bioaccumulation of Cu was also investigated by atomic absorption spectroscopy (AAS). Plant exposure to 100 and 500mgL -1 of CuO NPs has resulted in significant reduction of total chlorophyll and sugar content in the two test plants while 10mgL -1 of NPs slightly increased the pigment and sugar content in tomato plants only. Augmentation of lipid peroxidation, electrolyte leakage, and antioxidant enzyme activity was observed in a dose dependent manner upon plants exposure to CuO NPs. Deposition of lignin in roots of both plants treated with the highest concentration of CuO NPs was observed. Histochemical analysis of leaves of treated plant with nitroblue tetrazolium and 3 ' 3 ' diaminobenzidine showed a concentration dependent increase in superoxide and hydrogen peroxide formation in leaves. The green synthesis of CuO NPs was carried out by using Morus alba leaf extract. Accumulation of NPs more actively by tomato plants as compared to cauliflower was possibly due to the difference in root morphology. The histochemical visualization highlights the spatial organization of oxidant biochemistry occurring in response to metal stress. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Genome sequence of M6, a diploid inbred clone of the high-glycoalkaloid-producing tuber-bearing potato species Solanum chacoense, reveals residual heterozygosity.

    Science.gov (United States)

    Leisner, Courtney P; Hamilton, John P; Crisovan, Emily; Manrique-Carpintero, Norma C; Marand, Alexandre P; Newton, Linsey; Pham, Gina M; Jiang, Jiming; Douches, David S; Jansky, Shelley H; Buell, C Robin

    2018-05-01

    Cultivated potato (Solanum tuberosum L.) is a highly heterozygous autotetraploid that presents challenges in genome analyses and breeding. Wild potato species serve as a resource for the introgression of important agronomic traits into cultivated potato. One key species is Solanum chacoense and the diploid, inbred clone M6, which is self-compatible and has desirable tuber market quality and disease resistance traits. Sequencing and assembly of the genome of the M6 clone of S. chacoense generated an assembly of 825 767 562 bp in 8260 scaffolds with an N50 scaffold size of 713 602 bp. Pseudomolecule construction anchored 508 Mb of the genome assembly into 12 chromosomes. Genome annotation yielded 49 124 high-confidence gene models representing 37 740 genes. Comparative analyses of the M6 genome with six other Solanaceae species revealed a core set of 158 367 Solanaceae genes and 1897 genes unique to three potato species. Analysis of single nucleotide polymorphisms across the M6 genome revealed enhanced residual heterozygosity on chromosomes 4, 8 and 9 relative to the other chromosomes. Access to the M6 genome provides a resource for identification of key genes for important agronomic traits and aids in genome-enabled development of inbred diploid potatoes with the potential to accelerate potato breeding. © 2018 The Authors The Plant Journal © 2018 John Wiley & Sons Ltd.

  11. Coupling auto trophic in vitro plant cultivation system to scanning electron microscope to study plant-fungal interactions

    Energy Technology Data Exchange (ETDEWEB)

    Jaeger, N. de; Decock, C.; Declereck, S.; Providencia, I. E. de la

    2010-07-01

    The interactions of plants with pathogens and beneficial micro-organisms have been seldom compared on the same host and under strict controlled auto trophic in vitro culture conditions. Here, the life cycle of two plant beneficial (Glomus sp. MUCL 41833 and Trichoderma harzianum) and one plant pathogen (Rhizoctonia solani) fungi were described on potato (Solanum tuberosum) plantlets under auto trophic in vitro culture conditions using video camera imaging and the scanning electron microscope (SEM). (i) The colony developmental pattern of the extraradical mycelium within the substrate, (ii) the reproduction structures and (iii) the three-dimensional spatial arrangements of the fungal hyphae within the potato root cells were successfully visualized, monitored and described. The combination of the autotrophic in vitro culture system and SEM represent a powerful tool for improving our knowledge on the dynamics of plant-fungal interactions. (Author) 41 refs.

  12. The impact of an extreme climatic disturbance and different fertilization treatments on plant development, phenology, and yield of two cultivar groups of Solanum betaceum Cav.

    Directory of Open Access Journals (Sweden)

    Joffre V Tandazo-Yunga

    Full Text Available Changing climatic conditions impose a challenge both to biodiversity and food security. The effects of climate change affect different aspects of the plant or crop, such as morphological and phenological aspects, as well as yield. The effects of greenhouse conditions might be comparable in some cases to a permanent extreme disturbance in climate and weather, thus, contributing to our knowledge on climate change impacts on plant species. We have investigated the differences for 23 traits in two cultivar groups of an Andean traditional crop, Solanum betaceum, under two different environmental conditions that correspond to the traditional practices in the open field and three cultural managements under greenhouse conditions (no fertilization or control, organic, and mineral. We found that traditional practices in the open field are the less productive. Moreover, in warmer and drier conditions the treatment with organic fertilization was the most productive. Greenhouse conditions, however, delay production. We further identified traits that differentiate both cultivar groups and traits that are linked to either the new climate conditions or the fertilization treatments. Fruit characteristics were quite homogeneous between the two cultivar groups. Overall, our results provide insight on the consequences that climate change effects might exert on crops such as tree tomato, reveal that greenhouses can be a robust alternative for tree tomato production, and highlight the need to understand how different managements are linked to different solutions to fulfil the farmers' demands.

  13. Een nieuwe variëteit van Solanum triflorum Nutt

    NARCIS (Netherlands)

    Ooststroom, van S.J.

    1966-01-01

    A note on a new variety of Solanum triflorum Nutt., viz. var. dentatum Ooststr., found in 1938 near Nijmegen, prov. Gelderland. SANDWITH (2, p. 346) mentions a plant from Bristol, which is identical with this.

  14. Specificity of DNA import into isolated mitochondria from plants and mammals

    Directory of Open Access Journals (Sweden)

    Koulintchenko M. V.

    2014-01-01

    Full Text Available Aim. Investigation of different features of DNA import into plant and human mitochondria, for a better understanding of mitochondrial genetics and generation of biotechnological tools. Methods. DNA up-take experiments with isolated plant mitochondria, using as substrates various sequences associated or not with the specific terminal inverted repeats (TIRs present at each end of the plant mitochondrial linear plasmids. Results. It was established that the DNA import efficiency has a non-linear dependence on DNA size. It was shown that import into plant mitochondria of DNA molecules of «medium» sizes, i. e. between 4 and 7 kb, barely has any sequence specificity: neither TIRs from the 11.6 kb Brassica plasmid, nor TIRs from the Zea mays S-plasmids influenced DNA import into Solanum tuberosum mitochondria. Conclusions. The data obtained support the hypothesis about species-specific import mechanism operating under the mitochondrial linear plasmids transfer into plant mitochondria.

  15. Optimalisation de l'extraction d'ADN génomique de la morelle jaune (Solanum elaeagnifolium Cav., une plante invasive des milieux cultivés en région méditerranéenne

    Directory of Open Access Journals (Sweden)

    Ripoll, J.

    2011-01-01

    Full Text Available Optimization of the genomic DNA extraction method of silverleaf nightshade (Solanum elaeagnifolium Cav., an invasive plant in the cultivated areas within the Mediterranean region. The geographical origin of an invasive plant in the cultivated area within the Mediterranean region, silverleaf nightshade, Solanum elaeagnifolium Cav. (Solanaceae should be identified through the analysis of genetic similarities between native and introduced populations using microsatellite markers. Beforehand, an effective and less costly method for extracting genomic DNA from dehydrated and polysaccharide-rich leaves was investigated. The original Doyle's protocol based on the use of a cationic detergent, CTAB, was successfully optimized in order to extract high quality DNA (A260/280 ratio of 1.8; A260/230 ratio of 1.7 to 2. The DNA yields obtained with this new protocol were higher than those obtained with a commercial kit, although quality of the DNA extracted was comparable. The improvement of the protocol was further proven by the amplification of several microsatellite loci first developed in eggplant, Solanum melongena L.

  16. Flowerlocation in Solanum dulcamara L. (Solanaceae

    Directory of Open Access Journals (Sweden)

    Irina Zhuravlyeva

    2013-01-01

    Full Text Available The morphology of inflorescence of Solanum dulcamara is studied. Pseudolateral location of inflorescence relatively to plant body is set, the absence of bracteae and the sympodial type of growing of branches are found out. From W. Troll point of view the inflorescence of nightshade is defined as the polytelica synflorescence – complex dichasium.

  17. Detection of biosynthetic gene and phytohormone production by endophytic actinobacteria associated with Solanum lycopersicum and their plant-growth-promoting effect.

    Science.gov (United States)

    Passari, Ajit Kumar; Chandra, Preeti; Zothanpuia; Mishra, Vineet Kumar; Leo, Vincent Vineeth; Gupta, Vijai Kumar; Kumar, Brijesh; Singh, Bhim Pratap

    2016-10-01

    In the present study, fifteen endophytic actinobacterial isolates recovered from Solanum lycopersicum were studied for their antagonistic potential and plant-growth-promoting (PGP) traits. Among them, eight isolates showed significant antagonistic and PGP traits, identified by amplification of the 16S rRNA gene. Isolate number DBT204, identified as Streptomyces sp., showed multiple PGP traits tested in planta and improved a range of growth parameters in seedlings of chili (Capsicum annuum L.) and tomato (S. lycopersicum L.). Further, genes of indole acetic acid (iaaM) and 1-aminocyclopropane-1-carboxylate (ACC) deaminase (acdS) were successively amplified from five strains. Six antibiotics (trimethoprim, fluconazole, chloramphenicol, nalidixic acid, rifampicin and streptomycin) and two phytohormones [indole acetic acid (IAA) and kinetin (KI)] were detected and quantified in Streptomyces sp. strain DBT204 using UPLC-ESI-MS/MS. The study indicates the potential of these PGP strains for production of phytohormones and shows the presence of biosynthetic genes responsible for production of secondary metabolites. It is the first report showing production of phytohormones (IAA and KI) by endophytic actinobacteria having PGP and biosynthetic potential. We propose Streptomyces sp. strain DBT204 for inoculums production and development of biofertilizers for enhancing growth of chili and tomato seedlings. Copyright © 2016 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  18. Intercropping System for Protection the Potato Plant from Insect Infestation

    Directory of Open Access Journals (Sweden)

    Aziza Sharaby

    2015-06-01

    Full Text Available The use of intercropping system provides an option for insect control for organic farmers that are limited in their chemical use. Additionally, intercropping systems can be attractive to conventional growers as a cost-effective insect control solution. A study was carried out for two seasons 2011-2012 and 2012-2013 to evaluate the effect of intercropping of potato (Solanum tuberosum L. with onion (Allium cepa L. on whitefly (Bemicia tabasi Gennadius and aphids’ Myzus persicae Sulz. and Aphis gossypii Glover infestation in potato fields. Results indicated that intercropping significantly reduced potato plant infestation with whitefly by 42.7, 51.3% while it was 62.69% reduction with aphids during the two successive winter seasons than when potato plants were cultivated alone. Therefore, intercropping could be recommended as a protection method of reducing pest population in the fields.

  19. Poliploidização em berinjela (Solanum melongena L.: II - Observações em plantas resultantes de tratamentos com colquicina Polyploidization in egg-plant (Solanum melongena L.: II - Observation in plants resulting from colchicine treatments

    Directory of Open Access Journals (Sweden)

    Dixier M. Medina

    1972-01-01

    Full Text Available As observações de diversos caracteres morfológicos em plantas de berinjela (Solatium melongena L. provenientes de tratamentos com colquicina levaram à separação de razoável número de possíveis poliplóides. O número de cromossomos determinado em células-mães de pólen revelou a existência de plantas tetraplóides e plantas quiméricas, além das normais diplóides. Numa amostra representando os diferentes tratamentos, encontrou-se uma associação quase perfeita entre a natureza tetraplóide ou quimérica da planta e a irregularidade do tamanho do pólen; tal associação não foi encontrada quando se analisou a quantidade de pólen vazio. Os frutos tetraplóides obtidos produziram sementes maiores e em número bem menor que os diplóides de pesos equivalentes.The observations on several morphological characteristics made on plants derived from treatments of seed with colchicine in the egg-plant (Solatium melongena L. led to separation of a reasonable number of possible polyploids. Chromosome number determined in P.M.C. indicated the existence of tetraploid plants, chimeric plants at level 24-48 and at level 48-96 beside the diploid normal ones. In a certain number of plants representing the different treatments, it was found an almost perfect association between tetraploidy and chimeric condition of the plants at one side and irregular size of the pollen at the other side; such an association was not found when the amount of empty pollen was analysed. The tetraploid fruits produced low number of seeds which were not uniform in size but were larger and in general heavier than the diploid ones.

  20. Data mining and influential analysis of gene expression data for plant resistance gene identification in tomato (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Francisco Torres-Avilés

    2014-03-01

    Conclusion: Application of different statistical analyses to detect potential resistance genes reliably has shown to conduct interesting results that improve knowledge on molecular mechanisms of plant resistance to pathogens.

  1. Taxonomy Icon Data: potato [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available potato Solanum tuberosum Solanum_tuberosum_L.png Solanum_tuberosum_NL.png Solanum_tuber...osum_S.png Solanum_tuberosum_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Solanum+tuberosum&t...=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Solanum+tuberosum&t=NL http://biosciencedbc.jp/taxonomy_...icon/icon.cgi?i=Solanum+tuberosum&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Solanum+tuberosum&t=NS ...

  2. Characteristics of Analog Rice From Potato Flour (Solanum Tuberosom L.) Corn Flour (Zea Mays L.) and Sago Flour (Arenga Microcarpa Beccari)

    OpenAIRE

    Korompis, Olga S; Mamuaja, Christine F; Mandey, Lucia C

    2016-01-01

    Potato (Solanum tuberosum L.), corn (Zea mays L.) and sago (Arenga microcarpa Beccari) are crops containing high carbohydrate, as source of calory food, and those can be made into rice analog. This study aimed: (1) to determine the formulations by organoleptic test in manufacture analog rice from potato flour, corn flour and sago flour, and (2) to analyze the physical properties, chemical properties of rice analog from potato flour with the addition of corn flour and sago flour. The research ...

  3. Oxidation and reduction of pyridine nucleotides in alamethicin-permeabilized plant mitochondria

    DEFF Research Database (Denmark)

    Johansson, F.I.; Michalecka, A.M.; Møller, I.M.

    2004-01-01

    method to permearbilize mitochondria and study the highly branched electron-transport chain in potato tuber (Solanum tuberosum) and pea leaf (Pisum sativum) mitochondria. We show that AlaM permeabilized the inner membrane of plant mitochondria to NAD(P)H, allowing the quantification of internal NAD......M-treated mitochondria was much higher than what has been previously measured by other techniques. Our results also show a difference in substrate specificities for complex I in mitochondria as compared with inside-out submitochondrial particles. AlaM facilitated the passage of cofactors to and from the mitochondrial...... environment not only in plant mitochondria but also in other membrane-enclosed compartments, such as intact cells, chloroplasts and peroxisomes....

  4. In vitro development of buds from tubers of (Solanum tuberosum L.); Desarrollo in vitro de yemas procedentes de tuberculos de patata (Solanum tuberosum L.) tratados por radiacion GAMMA

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Gonzalez, J; Garcia Collantes, M A

    1976-07-01

    The present work studies the in vitro development of buds from potato tubers subjected to gamma radiation at doses of 3, 6, 9 and 12 Krad. Ths effect of radiation was dependent on the dormant stage of the buds. Intermediate doses (6-9 Krad) did inhibit mitotic division but not cellular elongation. When irradiation is carried out at the end of the resting period, there is an apparent sprouting due to the elongation of previously formed cells. (Author) 17 refs.

  5. Corte de tubérculos de batatinha (Solatium tuberosum L.: parte I - Estudos comparativos sôbre plantio de tubérculos inteiros, e cortados em "ápice" e "base"

    Directory of Open Access Journals (Sweden)

    Olavo J. Boock

    1947-01-01

    Full Text Available Several trials were conducted with potatoes (Solanum tuberosum L. to study the relative value of the apical and basal sets, as compared to whole seed tubers, since cutting potatoes before planting has been a matter of discussion. The experiments have been carried out on a high and on a low districts, say, respectively, at Joanópolis mountainous region, and at Taubaté flat lands, the latter on the right bank of Paraíba river, both in the State of São Paulo. Results have shown that on high lands, over 1,000 meters above sea level, the cutting process may be accomplished, though the basal sets have yielded less than apical ones, and whole tubers. Apical sets produced as well as whole tubers. At Taubaté district, aproximately 500 meters above sea level, where potato crop is usually grown from May to September in the dry season, on irrigated flat lands, after rice has been harvested, best results were secured from whole seed tubers. Apical and basal sets decayed easily, due probably to irrigation water ; for this reason they are not to be used.

  6. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96955 Solanum tuberosum Solanaceae ... flesh colour after cooking Yellow pigmentati...on intensity to the genetic control of tuber flesh yellowness in cooked tuber tissue. 1 ... Chr08 ... 10.1007/s00122-013-2254-y 24408376

  7. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96953 Solanum tuberosum Solanaceae ... flesh colour after cooking Yellow pigmentati...on intensity to the genetic control of tuber flesh yellowness in cooked tuber tissue. 1 ... Chr03 ... 10.1007/s00122-013-2254-y 24408376

  8. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96951 Solanum tuberosum Solanaceae ... flesh colour after cooking Yellow pigmentati...on intensity to the genetic control of tuber flesh yellowness in cooked tuber tissue. 1 ... Chr01 ... 10.1007/s00122-013-2254-y 24408376

  9. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96907 Solanum tuberosum Solanaceae ... after cooking darkening Non-enzymatic discol...ouration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after cooking. After 1 hour of the coo...king, discolouration was evaluated. 1,4 ... Chr11 ... 10.1007/s00122-013-2254-y 24408376

  10. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT96905 Solanum tuberosum Solanaceae ... after cooking darkening Non-enzymatic discol...ouration of French fries or cooked tubers, through oxidation of iron-chlorogenic acid observed after cooking. After 1 hour of the coo...king, discolouration was evaluated. 1,4 ... Chr03 ... 10.1007/s00122-013-2254-y 24408376

  11. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT97962 Solanum tuberosum Solanaceae ... chip color of tuber at normal temperature after cold storage mean val...ue of 2 years 1,3 pPt-536041 ... Chr01 67.8 3.83 ... 10.1007/s11032-015-0415-1 26612975

  12. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT97965 Solanum tuberosum Solanaceae ... chip color of tuber at normal temperature after cold storage mean val...ue of 2 years 1,3 pPt-536863 ... Chr06 75.9 3.84 ... 10.1007/s11032-015-0415-1 26612975

  13. Experimental infection of plants with an herbivore-associated bacterial endosymbiont influences herbivore host selection behavior.

    Directory of Open Access Journals (Sweden)

    Thomas Seth Davis

    Full Text Available Although bacterial endosymbioses are common among phloeophagous herbivores, little is known regarding the effects of symbionts on herbivore host selection and population dynamics. We tested the hypothesis that plant selection and reproductive performance by a phloem-feeding herbivore (potato psyllid, Bactericera cockerelli is mediated by infection of plants with a bacterial endosymbiont. We controlled for the effects of herbivory and endosymbiont infection by exposing potato plants (Solanum tuberosum to psyllids infected with "Candidatus Liberibacter solanacearum" or to uninfected psyllids. We used these treatments as a basis to experimentally test plant volatile emissions, herbivore settling and oviposition preferences, and herbivore population growth. Three important findings emerged: (1 plant volatile profiles differed with respect to both herbivory and herbivory plus endosymbiont infection when compared to undamaged control plants; (2 herbivores initially settled on plants exposed to endosymbiont-infected psyllids but later defected and oviposited primarily on plants exposed only to uninfected psyllids; and (3 plant infection status had little effect on herbivore reproduction, though plant flowering was associated with a 39% reduction in herbivore density on average. Our experiments support the hypothesis that plant infection with endosymbionts alters plant volatile profiles, and infected plants initially recruited herbivores but later repelled them. Also, our findings suggest that the endosymbiont may not place negative selection pressure on its host herbivore in this system, but plant flowering phenology appears correlated with psyllid population performance.

  14. Plasma membrane potential depolarization and cytosolic calcium flux are early events involved in tomato (Solanum lycopersicon) plant-to-plant communication.

    Science.gov (United States)

    Zebelo, Simon A; Matsui, Kenji; Ozawa, Rika; Maffei, Massimo E

    2012-11-01

    Tomato plants respond to herbivory by emitting volatile organic compounds (VOCs), which are released into the surrounding atmosphere. We analyzed the tomato herbivore-induced VOCs and tested the ability of tomato receiver plants to detect tomato donor volatiles by analyzing early responses, including plasma membrane potential (V(m)) variations and cytosolic calcium ([Ca²⁺](cyt)) fluxes. Receiver tomato plants responded within seconds to herbivore-induced VOCs with a strong V(m) depolarization, which was only partly recovered by fluxing receiver plants with clean air. Among emitted volatiles, we identified by GC-MS some green leaf volatiles (GLVs) such as (E)-2-hexenal, (Z)-3-hexenal, (Z)-3-hexenyl acetate, the monoterpene α-pinene, and the sesquiterpene β-caryophyllene. GLVs were found to exert the stronger V(m) depolarization, when compared to α-pinene and β-caryophyllene. Furthermore, V(m) depolarization was found to increase with increasing GLVs concentration. GLVs were also found to induce a strong [Ca²⁺](cyt) increase, particularly when (Z)-3-hexenyl acetate was tested both in solution and with a gas. On the other hand, α-pinene and β-caryophyllene, which also induced a significant V(m) depolarization with respect to controls, did not exert any significant effect on [Ca²⁺](cyt) homeostasis. Our results show for the first time that plant perception of volatile cues (especially GLVs) from the surrounding environment is mediated by early events, occurring within seconds and involving the alteration of the plasma membrane potential and the [Ca²⁺](cyt) flux. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  15. Pólen 2n e mecanismos meióticos de formação em Solanum commersonii ssp 2n pollen and meiotic mechanisms of Formation in Solanum commersonii ssp

    Directory of Open Access Journals (Sweden)

    Lívia Gracielle Oliveira Tomé

    2009-04-01

    Full Text Available Solanum commersonii subsp. commersonii Dun. e Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 - 1EBN não podem ser diretamente cruzadas com a batata cultivada de S. tuberosum subsp. tuberosum L. (2n=4x=48 -4 EBN em razão da barreira da ploidia e do número de equilíbrio do endosperma (EBN. No entanto, a produção de pólen não reduzido por S. commersonii ssp. (2x=2n=24 - 1EBN, permite o cruzamento desta com dihaplóides de batata e com as espécies diplóides S. phureja Juz. & Bukasov. e S. chacoense Bitt., que possuem 2 EBN. Conduziu-se este trabalho, com o objetivo de determinar o mecanismo meiótico e a freqüência dos grãos de pólen não reduzidos em cinco clones de Solanum commersonii ssp. Foram avaliados três clones de S. commersonii subsp. commersonii (SCC e dois de S. commersonii subsp. malmeanum (SCM. Nas avaliações, duzentos grãos de pólen viáveis foram corados (carmim acético 2% e mensurados, sendo considerados não reduzidos aqueles com o diâmetro igual ou superior a 25 µm. O clone Solanum commersonii subsp. commersonii Dun. (SCC 100 produz 26.1% de polen não reduzido, por fusos fundidos e fusos paralelos, o qual pode ser utilizado em programas de melhoramento.Solanum commersonii subsp. commersonii Dun. and Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 -1EBN cannot be directly crossed with the cultivated Solanum tuberosum subsp. Tuberosum L. (2n=4x=48 - 4EBN species due to ploidy barriers and endosperm balance number (EBN. However, non-reduced pollen production by the wild species S. commersonii ssp. (2x=2n=24 -1EBN, allows the crossing of these species with dihaploids of potato and with the diploids species, S. phureja Juz. & Bukasov. and S. chacoense Bitt., all with 2EBN. The aim of this work was to determine the meiotic mechanism and frequency of non-reduced pollen production of five clones of S. commersonii ssp. Three different clones of S. commersonii subsp. commersonii Dun. (SCC and two of S

  16. Role of Solanum dulcamara L. in Potato Late Blight Epidemiology

    NARCIS (Netherlands)

    Golas, T.M.; Weerden, van der G.M.; Berg, van den R.G.; Mariani, C.; Allefs, J.J.H.M.

    2010-01-01

    Four sites with naturally growing Solanum dulcamara were surveyed during 2006 and 2007 for the presence of late blight. Despite 2 years of observations, no late blight was detected among natural populations of bittersweet. Nevertheless, repeated infections occurred on few S. dulcamara plants from a

  17. Marker list: QM357356 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM357356 Solanum tuberosum Solanaceae toPt-437059 Others ... CIP703825 ... Chr10 ratio of tuber length to tuber... width trait and eye depth of tuber trait 1 10.1186/s12863-015-0213-0 26024857

  18. The free NADH concentration is kept constant in plant mitochondria under different metabolic conditions

    DEFF Research Database (Denmark)

    Kasimova, M.R.; Grigiene, J.; Krab, K.

    2006-01-01

    with fluorescence spectroscopy. The NADH content of actively respiring mitochondria (from potato tubers [Solanum tuberosum cv Bintje]) in different metabolic states was then measured by spectral decomposition analysis of fluorescence emission spectra. Most of the mitochondrial NADH is bound to proteins...... metabolism. These findings have far-reaching consequences for the interpretation of cellular metabolism....

  19. Infection of potato plants with potato leafroll virus changes attraction and feeding behaviour of Myzus persicae

    NARCIS (Netherlands)

    Alvarez, A.E.; Garzo, E.; Verbeek, M.; Vosman, B.; Dicke, M.; Tjallingii, W.F.

    2007-01-01

    Potato leafroll virus (PLRV; genus Polerovirus, family Luteoviridae) is a persistently transmitted circulative virus that depends on aphids for spreading. The primary vector of PLRV is the aphid Myzus persicae (Sulzer) (Homoptera: Aphididae). Solanum tuberosum L. potato cv. Kardal (Solanaceae) has a

  20. Abundance of food plant species and food habits of Rhinoceros unicorns Linn. in Pobitora Wildlife Sanctuary, Assam, India

    Directory of Open Access Journals (Sweden)

    P. Konwar

    2009-09-01

    Full Text Available Food habits and abundance of food plant species of Rhinoceros unicornis in Pobitora Wildlife Sanctuary were studied from January 1999 through December 2001. Totally 32 numbers of Rhino food plants were identified, of which 15 were grasses, four shrubs, five aquatic hydrophytes and eight tree species (21 terrestrial and 11 aquatic. During the dry season, the Rhino feeds on almost 90% food items from Hemarthria compressa, Arundo donax, Phragmites karka, Cerex rubro-brumee etc. The other short grasses such as Cynodon dactylon, Andropogon ssp., Cenchrus ciliaris, Chrysopogon aciculatus and tender and young shoots and twigs of Schelristechya fuesche, Saccharum spontaneum, Lagerstroemia flosreginae etc. are consumed in limited portions. The rhino consumes 11 cultivated crops and vegetables, viz., Ricinus communis, Oryza sativa, Solanum melongena, Lycopersicon esculentum, Solanum tuberosum, Brassica nigra, Luffa cylindrica, Luffa acutangula, Cucurbita moschata, Cucumis sativus and Ipomoea batatas etc. Highest density of food plant species observed in the study area were Cynodon dactylon (167.5/m2, Hemarthria compressa (73.75/m2, Vetiveria zizanioides (56/m2, Saccharum ravannae (51.5/m2, Pharagmites karka (50.75/m2, Leersia hexandra (46.75/m2, Brachiarea pseudointerrupta (40/m2 and Eichhornia crassipes (35/m2.

  1. The Solanum commersonii Genome Sequence Provides Insights into Adaptation to Stress Conditions and Genome Evolution of Wild Potato Relatives

    Science.gov (United States)

    Aversano, Riccardo; Contaldi, Felice; Ercolano, Maria Raffaella; Grosso, Valentina; Iorizzo, Massimo; Tatino, Filippo; Xumerle, Luciano; Dal Molin, Alessandra; Avanzato, Carla; Ferrarini, Alberto; Delledonne, Massimo; Sanseverino, Walter; Cigliano, Riccardo Aiese; Capella-Gutierrez, Salvador; Gabaldón, Toni; Frusciante, Luigi; Bradeen, James M.; Carputo, Domenico

    2015-01-01

    Here, we report the draft genome sequence of Solanum commersonii, which consists of ∼830 megabases with an N50 of 44,303 bp anchored to 12 chromosomes, using the potato (Solanum tuberosum) genome sequence as a reference. Compared with potato, S. commersonii shows a striking reduction in heterozygosity (1.5% versus 53 to 59%), and differences in genome sizes were mainly due to variations in intergenic sequence length. Gene annotation by ab initio prediction supported by RNA-seq data produced a catalog of 1703 predicted microRNAs, 18,882 long noncoding RNAs of which 20% are shown to target cold-responsive genes, and 39,290 protein-coding genes with a significant repertoire of nonredundant nucleotide binding site-encoding genes and 126 cold-related genes that are lacking in S. tuberosum. Phylogenetic analyses indicate that domesticated potato and S. commersonii lineages diverged ∼2.3 million years ago. Three duplication periods corresponding to genome enrichment for particular gene families related to response to salt stress, water transport, growth, and defense response were discovered. The draft genome sequence of S. commersonii substantially increases our understanding of the domesticated germplasm, facilitating translation of acquired knowledge into advances in crop stability in light of global climate and environmental changes. PMID:25873387

  2. Identification of genotypic variation for nitrogen response in potato (Solanum tuberosum) under low nitrogen input circumstances

    NARCIS (Netherlands)

    Tiemens-Hulscher, M.; Lammerts Van Bueren, E.; Struik, P.C.

    2009-01-01

    Nitrogen is an essential nutrient for crop growth. The demand for nitrogen in the potato crop is relatively high. However, in organic farming nitrogen input is rather limited, compared with conventional farming. In this research nine potato varieties were tested at three nitrogen levels. Genotypic

  3. Exploratory sensory profiling of three culinary preparations of potatoes (Solanum tuberosum L.).

    Science.gov (United States)

    Seefeldt, Helene F; Tønning, Erik; Thybo, Anette K

    2011-01-15

    A consumer-oriented description of potato quality with regard to culinary preparation could increase potato consumption. The aim of this study was to investigate the sensory attributes in 11 potato varieties grown at two locations and used for three culinary preparations. Sensory evaluation of the potatoes served either as boiled, oven-fried or mashed were performed using 15-19 descriptors for appearance, flavour and texture attributes. A principal component analysis revealed that 45% of the variation in the sensory data was related to variety differences, which was ascribed to variation in appearance, dry matter content and texture. Growing location also significantly affected appearance and texture. The sensory panel judged the sensory attributes 'yellowness', 'hardness', 'adhesiveness' and 'moistness' to be important quality descriptors in all three culinary preparations. Internal references showed the high reproducibility of the sensory evaluations. The potatoes grown in a sandy location had higher content of dry matter compared to those grown in a clay location, affecting the quality. This study showed that it was possible to do reliable and reproducible sensory profiles in a potato material with a large span in quality. Sensory information based on few attributes can be used to describe culinary quality of potato varieties. Copyright © 2010 Society of Chemical Industry.

  4. Criodesecación atmosférica de papa (Solanum tuberosum

    Directory of Open Access Journals (Sweden)

    Juan Sebastián Ramírez Navas

    2011-01-01

    etapas del proceso, empleando el índice de amarillez, y se evaluaron las propiedades microbiológicas de las papas crio-desecadas tmosféricamente. Se concluye que el secado de rodajas de papa por CDA permite eliminar el crecimiento microbiológico y las reacciones químicas, pero es necesario realizar pretratamientos para evitar el pardamiento.

  5. De verspreiding van virusziekten van de aardappel (Solanum tuberosum L.) door insekten

    NARCIS (Netherlands)

    Elze, D.L.

    1927-01-01

    The object was to study the relation between virus and the transmitting insect, especially the aphids Myzus persicae Sulz., Myzus pseudosolani Theob., Macrosiphum solanifold Ashm., Aphis rhamni Fonsc. and Aphis fabae Scop. The diseases studied were leafroll, common mosaic (virus A), crinckle (virus

  6. Pseudomonas endophytica sp. nov., isolated from stem tissue of Solanum tuberosum L. in Spain.

    Science.gov (United States)

    Ramírez-Bahena, Martha-Helena; Cuesta, Maria José; Tejedor, Carmen; Igual, José Mariano; Fernández-Pascual, Mercedes; Peix, Álvaro

    2015-07-01

    A bacterial strain named BSTT44(T) was isolated in the course of a study of endophytic bacteria occurring in stems and roots of potato growing in a soil from Salamanca, Spain. The 16S rRNA gene sequence had 99.7% identity with respect to that of its closest relative, Pseudomonas psychrophila E-3T, and the next most closely related type strains were those of Pseudomonas fragi, with 99.6% similarity, Pseudomonas deceptionensis, with 99.2% similarity, and Pseudomonas lundensis, with 99.0% similarity; these results indicate that BSTT44(T) should be classified within the genus Pseudomonas. Analysis of the housekeeping genes rpoB, rpoD and gyrB confirmed its phylogenetic affiliation and showed identities lower than 92% in all cases with respect to the above-mentioned closest relatives. Cells of the strain bore one polar-subpolar flagellum. The respiratory quinone was Q-9.The major fatty acids were C16:0, C18:1ω7c and summed feature 3 (C16:1ω7c and/or C16:1ω6c). The strain was oxidase-, catalase- and urease-positive and the arginine dihydrolase system was present, but tests for nitrate reduction, β-galactosidase production and aesculin hydrolysis were negative. It could grow at 35 °C and at pH 5-9.The DNA G+C content was 60.2 mol%. DNA-DNA hybridization results showed less than 48% relatedness with respect to the type strains of the four most closely related species. Therefore, the combined results of genotypic, phenotypic and chemotaxonomic analyses support the classification of strain BSTT44 into a novel species of the genus Pseudomonas, for which the name Pseudomonas endophytica sp. nov. is proposed. The type strain is BSTT44(T) ( = LMG 28456(T) = CECT 8691(T)).

  7. Mitotic and meiotic irregularities in somatic hybrids of Lycopersicon esculentum and Solanum tuberosum.

    Science.gov (United States)

    Wolters, A M; Schoenmakers, H C; Kamstra, S; Eden, J; Koornneef, M; Jong, J H

    1994-10-01

    Chromosome numbers were determined in metaphase complements of root-tip meristems of 107 tomato (+) potato somatic hybrids, obtained from five different combinations of parental genotypes. Of these hybrids 79% were aneuploid, lacking one or two chromosomes in most cases. All four hybrids that were studied at mitotic anaphase of root tips showed laggards and bridges, the three aneuploids in a higher frequency than the single euploid. Hybrid K2H2-1C, which showed the highest percentage of aberrant anaphases, possessed 46 chromosomes. Fluorescence in situ hybridization with total genomic DNA showed that this hybrid contained 23 tomato, 22 potato, and 1 recombinant chromosome consisting of a tomato chromosome arm and a potato chromosome arm. The potato parent of K2H2-1C was aneusomatic in its root tips with a high frequency of monosomic and trisomic cells and a relatively high frequency of cells with one fragment or telosome. Meiotic analyses of three tomato (+) potato somatic hybrids revealed laggards, which occurred most frequently in the triploid hybrids, and bridges, which were frequently present in pollen mother cells (PMCs) at anaphase I of hypotetraploid K2H2-1C. We observed putative trivalents in PMCs at diakinesis and metaphase I of eutriploid A7-82A and quadrivalents in part of the PMCs of hypotetraploid K2H2-1C, suggesting that homoeologous recombination between tomato and potato chromosomes occurred in these hybrids. All three hybrids showed a high percentage of first division restitution, giving rise to unreduced gametes. However, shortly after the tetrad stage all microspores completely degenerated, resulting in exclusively sterile pollen.

  8. An efficient method for the establishment of cell suspension cultures in potato (Solanum tuberosum L.)

    International Nuclear Information System (INIS)

    Sajid, Z.A.

    2016-01-01

    Cell suspension cultures offers an In vitro system that can be used as a tool for various studies involving mutant selection, mass propagation, protoplast isolation, gene transfer and selection of cell-lines which are resistant to various biotic or abiotic stresses. Research work on the development of cell suspension cultures was carried out to establish the most efficient method in Potato (cv. Desiree). Healthy, well-proliferating tissues from different types of callus cultures (compact, friable, embryogenic or non-embryogenic) were inoculated on various media combinations, i.e., MS, MS2 or AA liquid medium containing 18.09 micro M 2, 4-D. A fixed quantity (0.5-1.0 g) of callus tissue from 60-day-old callus cultures was transferred to 10-25 ml of liquid medium in 100 ml Erlenmeyer flask. Cultures were placed on an orbital shaker and agitated at different speeds (75, 100 or 125 rpm) under 16-h photoperiod at 25 ± 2 degree C. Medium was changed after every 3 days and fractionated tissue was filtered after every 6 days through sterile mesh (100-800 micro m) to develop a cell-line by transferring resulting suspension to fresh medium under the same conditions. Results indicated that eight-week-old translucent, friable, off-white callus cultures were an excellent starting material for the initiation of homogeneous cell suspension cultures as compared to other tested sources. Of the three tested media (MS, MS2 or AA medium containing 18.09 micro M 2, 4-D), MS2 was found to be a better medium for the initiation of cell suspension cultures. Cell suspension cultures, placed in 16-h photoperiod at 25 ± 2 degree C and agitated at 120 rpm using a gyratory shaker showed excellent results. Several other factors influencing quick establishment of cell suspension cultures in this cultivar are also discussed in this communication. (author)

  9. Detection of Glycoalkaloids and Chlorophyll in Potatoes (Solanum tuberosum L.) by Hyperspectral Imaging

    DEFF Research Database (Denmark)

    Kjær, Anders; Nielsen, Glenn; Stærke, Søren

    2017-01-01

    The purpose of the study was to investigate the use of hyperspectral imaging (HSI) to detect and quantify chlorophyll (Chl) and total glycoalkaloid concentrations (TGA) in potatoes. To create a set of tubers with different concentrations of Chl and TGA, potatoes of four varieties were wounded...

  10. Mechanisms of self-incompatibility and unilateral incompatibility in diploid potato (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Eijlander, R.

    1998-01-01

    In chapter 1 an overview is given of the major mechanisms operating in Angiosperms that prevent or limit the degree of inbreeding. The two major systems that function on the basis of interaction between pollen and stigma/style, are the sporophytic and the gametophytic self-incompatibility

  11. Co adaptation of LiCl tolerant Solanum tuberosum L. callus cultures ...

    African Journals Online (AJOL)

    Jane

    2011-10-12

    Oct 12, 2011 ... also brings about tolerance to osmotic effects of salt. This data is highly .... These RGR values of control and LiCl adapted calli were used as reference .... by the Higher Education Commission (HEC) grants. The technical ...

  12. First report of Fusarium proliferatum causing dry rot in Michigan commercial potato (Solanum tuberosum) production

    Science.gov (United States)

    Fusarium dry rot of potato is a postharvest disease caused by several Fusarium spp. and is of worldwide importance. Thirteen Fusarium spp. have been implicated in fungal dry rots of potatoes worldwide. Among them, 11 species have been reported causing potato dry rot of seed tubers in the northern Un...

  13. Preservation by Irradiation of three varieties of Colombian Potatoes (Solanum Tuberosum L.)

    International Nuclear Information System (INIS)

    Zuleta, S.

    1986-01-01

    This is first study performed in the Gamma Facility of the Instituto de Asuntos Nucleares, in Bogota, Colombia, related to the Food Irradiation Programme. The study was made with: Parda Pastusa, ICA Guantiva, and ICA Purace, selected as the most important varieties of colombian potatoes. A complete study prior to the irradiation exposure was made in order to determine the optimum irradiation package. Different dose treatments, chemical and physical changes and organoleptic tests, were studied in this work. The work was performed in the early 1980s

  14. In vitro development of buds from tubers of (Solanum tuberosum L.)

    International Nuclear Information System (INIS)

    Fernandez Gonzalez, J.; Garcia Collantes, M. A.

    1976-01-01

    The present work studies the in vitro development of buds from potato tubers subjected to gamma radiation at doses of 3, 6, 9 and 12 Krad. Ths effect of radiation was dependent on the dormant stage of the buds. Intermediate doses (6-9 Krad) did inhibit mitotic division but not cellular elongation. When irradiation is carried out at the end of the resting period, there is an apparent sprouting due to the elongation of previously formed cells. (Author) 17 refs

  15. Cultivar variability of patatin biochemical characteristics: table versus processing potatoes (Solanum tuberosum L.).

    Science.gov (United States)

    Bárta, Jan; Bártová, Veronika; Zdráhal, Zbyněk; Sedo, Ondrej

    2012-05-02

    Biochemical characteristics of patatin proteins purified by ion-exchange and affinity chromatography from tubers of 20 potato cultivars were studied to evaluate their genotype differences with respect to utility groups, table potato cultivars (TPCs) and processing potato cultivars (PPCs). Both groups of cultivars showed similar values of protein content in dry matter (3.98-7.39%) and of patatin relative abundance (5.40-35.40%). Three mass levels (∼40.6, 41.8, and 42.9 kDa) of purified patatins were found by MALDI-TOF MS within all cultivars. Differences among mass levels corresponding with the mass of sugar antenna (∼1.2 kDa) confirmed the previous concept of different glycosylation extentsin patatin proteins. It was showed that the individual types of patatin varying in their masses occur in the patatin family in a ratio specific for each of the cultivars, with the lowest mass type being the major one. Electrophoretic analyses demonstrated wide cultivar variability in number of patatin forms. Especially 2D-PAGE showed 17-23 detected protein spots independently on the utility group. Specific lipid acyl hydrolase (LAH) activity of purified patatins from the individual tested cultivars varied between 0.92 and 5.46 μmol/(min mg). Patatin samples within most of the TPCs exhibited higher values of specific LAH activity than samples of PPCs. It may be supposed that individual patatin forms do not have similar physiological roles.

  16. A retail market study of organic and conventional potatoes (Solanum tuberosum): mineral content and nutritional implications.

    Science.gov (United States)

    Griffiths, Andrea M; Cook, David M; Eggett, Dennis L; Christensen, Merrill J

    2012-06-01

    Whether or not all foods marketed to consumers as organic meet specified standards for use of that descriptor, or are nutritionally different from conventional foods, is uncertain. In a retail market study in a Western US metropolitan area, differences in mineral composition between conventional potatoes and those marketed as organic were analysed. Potatoes marketed as organic had more copper and magnesium (p potatoes. Comparison of individual mineral concentrations between foodstuffs sold as organic or conventional is unlikely to establish a chemical fingerprint to objectively distinguish between organic and conventional produce, but more sophisticated chemometric analysis of multi-element fingerprints holds promise of doing so. Although statistically significant, these differences would only minimally affect total dietary intake of these minerals and be unlikely to result in measurable health benefits.

  17. Antioxidant Contents and Antioxidant Activities of White and Colored Potatoes (Solanum tuberosum L.).

    Science.gov (United States)

    Lee, Sang Hoon; Oh, Seung Hee; Hwang, In Guk; Kim, Hyun Young; Woo, Koan Sik; Woo, Shun Hee; Kim, Hong Sig; Lee, Junsoo; Jeong, Heon Sang

    2016-06-01

    This study was performed to evaluate and compare the antioxidant substance content and antioxidant activities of white (Superior) and colored (Hongyoung, Jayoung, Jasim, Seohong, and Jaseo) potatoes. The potatoes were extracted with 80% ethanol and were evaluated for the total polyphenol, flavonoid, and anthocyanin contents and for 1,1-diphenyl- 2-picrylhydrazyl (DPPH)/2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt (ABTS) radical scavenging activity, reducing power, and ferrous metal ion chelating effect. The total polyphenol, flavonoid, and anthocyanin contents of Hongyoung and Jayoung were higher than white and other colored potatoes. All colored potato extracts, except for Jaseo and Seohong, showed higher ABTS radical scavenging activities than the general white potato extract. Hongyoung and Jayoung had the highest ABTS and DPPH radical scavenging activities. Optical density values for the reducing power of Jayoung and Jaseo at concentration of 2 mg/mL were 0.148 and 0.090, respectively. All colored potato extracts had lower ferrous metal ion chelating effect than the white potato. A significant (P<0.05) positive correlation was observed between total polyphenol content and total flavonoid content (r=0.919), anthocyanin content (r=0.992), and ABTS radical scavenging activity (r=0.897). Based on these results, this research may be useful in developing the Hongyoung and Jayoung cultivars with high antioxidant activities.

  18. Insight into the role of catalases in salt stress in potato (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    M'Hamdi M.

    2009-01-01

    Full Text Available In order to investigate a possible link between catalase (CAT activity and salinity tolerance, an in vitro and in vivo study of the behavior of transgenic lines of potato (cv. ‘Désirée’ under salt stress conditions was carried out. Three groups of transgenic lines and non transformed control (DWT were used in this study: lines expressing a bacterial catalase gene and lines repressing catalase activity by either co-suppression or anti-sense strategies. Various concentrations of NaCl were tested: in vitro 0, 25, 50 and 75 mM and in vivo 25, 50 and 75 mM. The results of this work show that the genetic modification of CAT activity affects the multiplication rate of vitroplants, as well as vegetative and physiological growth parameters under salt stress conditions. At 25, 50 and 75 mM of NaCl, over-expression (line KatE16 and repression of CAT increased and reduced respectively the multiplication rate of vitroplants. Differences between the transgenic lines and the wild type were evident in tuber yield and leaf chlorophyll content. These parameters were significantly increased in CAT over-expressing and slightly decreased in SU3 line repressed in CAT under 25 mM of salt stress. A stability of the potential quantum yield (Fv/Fm was observed in the lines over-expressing the CAT at 25, 50 and 75 mM of NaCl. The repression of CAT was associated with a decrease of Fv/Fm value at 50 mM of NaCl. These results show that catalases contribute to salinity tolerance mechanisms in potato.

  19. Biological Control Of The Egyptian Brown Rot In Potato (Solanum Tuberosum L.)

    International Nuclear Information System (INIS)

    Salem, E.A.; Askora, A. M.

    2012-01-01

    Pseudomonas fluorescence, P. aeruginosa, Bacillus subtillus and streptomyces spp. Were used in control of Ralstonia solanacearum, the casual agent of brown rot in potato. In vitro, antagonistic activities showed that streptomyces spp. was the most antagonistic followed by P. fluorescence, Bacillus subtilus and P. aeruginosa respectively. Also, in vivo, biological control of R. solanacearum showed that Streptomyces spp. was found to reduce the percentage of brown rot infection to 5% followed by P. fluorescence, Bacillus subtilus and P. aeruginosa reducing the percentage of infection to 15 , 25 and 40%, respectively. Also, the disease severity when using Streptomyces spp. and P. fluorescence was reduced from 5 to 1 and reduced from 5 to 2 when using Bacillus subtilus and P. aeruginosa.

  20. Analysis of the potato (Solanum tuberosum L.) value chain in Zimbabwe

    NARCIS (Netherlands)

    Svubure, O.; Struik, P.C.; Haverkort, A.J.; Steyn, J.M.

    2017-01-01

    The performance of the Irish potato sector in Zimbabwe is not well understood. Using value chain analysis, this article evaluated the potato industry using quantitative data gathered from stakeholders using structured questionnaires, field observations, local knowledge and expert consultation.

  1. Changes in anthocyanidin levels during the maturation of color-fleshed potato (Solanum tuberosum L.) tubers.

    Science.gov (United States)

    Šulc, Miloslav; Kotíková, Zora; Paznocht, Luboš; Pivec, Vladimír; Hamouz, Karel; Lachman, Jaromír

    2017-12-15

    Certain potato cultivars are capable of producing anthocyanin pigments in the potato skin and flesh and those pigments have been shown, together with other phytochemicals, to promote good health. Six common anthocyanidins (cyanidin, delphinidin, petunidin, pelargonidin, malvidin and peonidin) were analyzed weekly for 15weeks in red- and purple-fleshed potato cultivars (Red Emma, Königspurpur, Valfi and Blaue de la Mancha) grown in field conditions using a validated LC-(+ESI)MS/MS method. Pelargonidin was the major type detected in red-fleshed cultivars whereas petunidin was the major type detected in the purple ones. Neither cyanidin nor delphinidin were found in any of the cultivars. The anthocyanidin levels observed were as high as 78mg/100g FW during tuber growth; however, fully matured tubers contained only 10-39mg anthocyanidins/100gFW. Anthocyanidin levels were moderately correlated with global solar irradiation (r<0.6252) but not with rainfall or daily temperature. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Identification of genotypic variation for nitrogen response in potato (Solanum tuberosum) under low nitrogen input circumstances

    OpenAIRE

    Tiemens-Hulscher, M.; Lammerts Van Bueren, E.; Struik, P.C.

    2009-01-01

    Nitrogen is an essential nutrient for crop growth. The demand for nitrogen in the potato crop is relatively high. However, in organic farming nitrogen input is rather limited, compared with conventional farming. In this research nine potato varieties were tested at three nitrogen levels. Genotypic variation for yield, leaf area index, period of maximum soil cover, sensitivity for N-shortage and nitrogen efficiency under low input circumstances was found. However, in these experiments varietie...

  3. Hongos solubilizadores de fosfato en suelo de páramo cultivado con papa (Solanum tuberosum)

    OpenAIRE

    Beltrán Pineda, M. E

    2014-01-01

    Los hongos solubilizadores de fosfato (HSF) son un grupo funcional de microorganismos que juegan un rol fundamental en el ciclaje de fósforo en los suelos; gracias a su actividad, las plantas pueden aprovechar las grandes reservas de fósforo insoluble que se encuentra fijado a los minerales del suelo, contribuyendo a que disminuya la aplicación de fertilizantes fosforados a los suelos. En este estudio se lograron aislar 43 cepas de hongos con capacidad solubilizadora de fosfato a partir de la...

  4. Respon Enam Generasi Kentang (Solanum Tuberosum L.) Terhadap Pemberian Pyraclostrobin Di Dataran Medium

    OpenAIRE

    Setiawan, Hans Kurnia; Ainurrasyid, Ainurrasyid; Kuswanto, Kuswanto

    2016-01-01

    Kentang ialah salah satu tanaman yang dibudidayakan karena kaya akan karbohidrat, mineral dan vitamin. Pyraclostrobin merupakan fungisida sis-temik yang berbentuk emulsi yang dapat larut dalam air, yang berfungsi sebagai pemicu pertumbuhan dan hasil tanaman. Selain sebagai fungisida, Pyraclostrobin dapat digunakan sebagai tambahan unsur hara bagi tanaman karena Pyraclostrobin juga mengandung unsur nitrogen (N) dan klor (Cl) yang diperlukan tanaman. Penelitian ini dilakukan untuk mengkaji resp...

  5. Expression of a cucumber class III chitinase and Nicotiana plumbaginifolia class I glucanase genes in transgenic potato plants

    NARCIS (Netherlands)

    Moravcikova, J.; Matusikova, I.; Libantova, J.; Bauer, M.; Mlynarova, L.

    2004-01-01

    The genes encoding for a cucumber class III chitinase and Nicotiana plumbaginifolia class I glucanase were co-introduced into Slovak potato (Solanum tuberosum L.) breeding line 116/86 using Agrobacterium tumefaciens. For both transgenes the number of integrated copies and level of RNA expression

  6. A Plant-Feeding Nematode Indirectly Increases the Fitness of an Aphid

    Directory of Open Access Journals (Sweden)

    Grace A. Hoysted

    2017-11-01

    Full Text Available Plants suffer multiple, simultaneous assaults from above and below ground. In the laboratory, pests and/or pathogen attack are commonly studied on an individual basis. The molecular response of the plant to attack from multiple organisms and the interaction of different defense pathways is unclear. The inducible systemic responses of the potato (Solanum tuberosum L. host plant were analyzed to characterize the plant-mediated indirect interactions between a sedentary, endoparasitic nematode (Globodera pallida, and a phloem-sucking herbivore (Myzus persicae. The reproductive success of M. persicae was greater on potato plants pre-infected with G. pallida compared to control plants. Salicylic acid (SA increased systemically in the leaves of potato plants following nematode and aphid infection singly with a corresponding increase in expression of SA-mediated marker genes. An increase in jasmonic acid associated with aphid infection was suppressed when plants were co-infected with nematodes. Our data suggests a positive, asymmetric interaction between a sedentary endoparasitic nematode and a sap-sucking insect. The systemic response of the potato plant following infection with G. pallida indirectly influences the performance of M. persicae. This work reveals additional secondary benefits of controlling individual crop pests.

  7. GROWTH PROCESS OF ORGANIC VETIVER ROOT WITH POTATO AS INTERCROPPING PLANT

    Directory of Open Access Journals (Sweden)

    Asep Kadarohman

    2012-02-01

    Full Text Available Vetiver oil (Vetiveria zizanoides is one of Indonesia main export commodities. Vetiver root is perennial plant and generally planted with vegetables as intercropping plant. Increasing the selling price of vetiver oil can be done by transferring the production of conventional vetiver oil (non-organic to organic vetiver oil. Demonstration of land used was one hectare, which 2,000 m2 for planting vetiver root with potato (Solanum tuberosum as inter-cropping plant and 8,000 m2 for vetiver root without intercropping, in Sukakarya-Samarang, Garut. The planting used goat and cow dung as manure, distillate water of vetiver oil and liquid bio-pesticide as pesticide. Variables studied included plant height, number of leaf and crotch. In the first quarter of the years, the number of leaf and crotch of vetiver root with intercropping was better than vetiver root without inter-cropping. However, there was not significant difference for plant height of vetiver root, both with and without intercropping. Products of organic potato as intercropping plant of vetiver root were less than those of non-organic potato, but the latter had a better texture and durability.

  8. Targeted identification of short interspersed nuclear element families shows their widespread existence and extreme heterogeneity in plant genomes.

    Science.gov (United States)

    Wenke, Torsten; Döbel, Thomas; Sörensen, Thomas Rosleff; Junghans, Holger; Weisshaar, Bernd; Schmidt, Thomas

    2011-09-01

    Short interspersed nuclear elements (SINEs) are non-long terminal repeat retrotransposons that are highly abundant, heterogeneous, and mostly not annotated in eukaryotic genomes. We developed a tool designated SINE-Finder for the targeted discovery of tRNA-derived SINEs. We analyzed sequence data of 16 plant genomes, including 13 angiosperms and three gymnosperms and identified 17,829 full-length and truncated SINEs falling into 31 families showing the widespread occurrence of SINEs in higher plants. The investigation focused on potato (Solanum tuberosum), resulting in the detection of seven different SolS SINE families consisting of 1489 full-length and 870 5' truncated copies. Consensus sequences of full-length members range in size from 106 to 244 bp depending on the SINE family. SolS SINEs populated related species and evolved separately, which led to some distinct subfamilies. Solanaceae SINEs are dispersed along chromosomes and distributed without clustering but with preferred integration into short A-rich motifs. They emerged more than 23 million years ago and were species specifically amplified during the radiation of potato, tomato (Solanum lycopersicum), and tobacco (Nicotiana tabacum). We show that tobacco TS retrotransposons are composite SINEs consisting of the 3' end of a long interspersed nuclear element integrated downstream of a nonhomologous SINE family followed by successfully colonization of the genome. We propose an evolutionary scenario for the formation of TS as a spontaneous event, which could be typical for the emergence of SINE families.

  9. Targeted Identification of Short Interspersed Nuclear Element Families Shows Their Widespread Existence and Extreme Heterogeneity in Plant Genomes[W

    Science.gov (United States)

    Wenke, Torsten; Döbel, Thomas; Sörensen, Thomas Rosleff; Junghans, Holger; Weisshaar, Bernd; Schmidt, Thomas

    2011-01-01

    Short interspersed nuclear elements (SINEs) are non-long terminal repeat retrotransposons that are highly abundant, heterogeneous, and mostly not annotated in eukaryotic genomes. We developed a tool designated SINE-Finder for the targeted discovery of tRNA-derived SINEs. We analyzed sequence data of 16 plant genomes, including 13 angiosperms and three gymnosperms and identified 17,829 full-length and truncated SINEs falling into 31 families showing the widespread occurrence of SINEs in higher plants. The investigation focused on potato (Solanum tuberosum), resulting in the detection of seven different SolS SINE families consisting of 1489 full-length and 870 5′ truncated copies. Consensus sequences of full-length members range in size from 106 to 244 bp depending on the SINE family. SolS SINEs populated related species and evolved separately, which led to some distinct subfamilies. Solanaceae SINEs are dispersed along chromosomes and distributed without clustering but with preferred integration into short A-rich motifs. They emerged more than 23 million years ago and were species specifically amplified during the radiation of potato, tomato (Solanum lycopersicum), and tobacco (Nicotiana tabacum). We show that tobacco TS retrotransposons are composite SINEs consisting of the 3′ end of a long interspersed nuclear element integrated downstream of a nonhomologous SINE family followed by successfully colonization of the genome. We propose an evolutionary scenario for the formation of TS as a spontaneous event, which could be typical for the emergence of SINE families. PMID:21908723

  10. Nouvelle technique d'élevage de l'acarien phyllophage Tetranychus urticae Koch (Acari : Tetranychidae et son application à l'étude de l'efficacité de quelques acaricides sur pomme de terre (Solarium tuberosum L.

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2000-01-01

    Full Text Available A New Rearing Technique of Phytophagous Mite Tetranychus urticae Koch (Acari : Tetranychida and its Application in the Study of the Efficacy of some Acaricides on Potato [Solanum tuberosum L.. A 5 cm diameter leaf disc of potato or another host plant (or four on 2.5 cm diameter was used in a Petri dish of 9 cm diameter for the rearing technique. This leaf disc, pierced in its centre, slides along a rustproof pin and floats on a 1 mm thick lamina of demineralized fresh water. Water is a "strong barrier" which confines the tetranychid mites on the leaf disc, even if this one does not corne from a host plant (tetranychid mites deprived of food. This rearing technique was used as a bioassay to test the effectiveness of acaricides (pyrimiphos-methyl, bromopropylate, fenpropathrin, dienochlor on the developmental stages of Tetranychus urticae. The ovicidal activity against the eggs of one, three, seven days old (the eggs incubation duration being 8.1 ±0.15 days was also studied. The results obtained show that bromopropylate, fenpropathrin and dienochlor have an ovicidal activity against the eggs of the different ages, but dienochlor has the highest efficiency (90 % mortality. Pyrimiphos-methyl is only active against the seven-day old eggs and bromopropylate has a high efficiency only on the one-day old eggs. Concerning the other developmental stages such as chrysalis (protochrysalis, deu-tochrysalis, teleiochrysalis and mobile stages (larva, protonymph, deutonymph and adult female, pyrimiphos-methyl has de highest efficiency (90 % mortality ; dienochlor also, except mobile stages. Bromopropylate has no activity against the chrysalis and mobile stages and fenpropathrin has a remarkable repulsive effect.

  11. Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments

    Directory of Open Access Journals (Sweden)

    Bruggmann Rémy

    2007-05-01

    Full Text Available Abstract Background Quantitative phenotypic variation of agronomic characters in crop plants is controlled by environmental and genetic factors (quantitative trait loci = QTL. To understand the molecular basis of such QTL, the identification of the underlying genes is of primary interest and DNA sequence analysis of the genomic regions harboring QTL is a prerequisite for that. QTL mapping in potato (Solanum tuberosum has identified a region on chromosome V tagged by DNA markers GP21 and GP179, which contains a number of important QTL, among others QTL for resistance to late blight caused by the oomycete Phytophthora infestans and to root cyst nematodes. Results To obtain genomic sequence for the targeted region on chromosome V, two local BAC (bacterial artificial chromosome contigs were constructed and sequenced, which corresponded to parts of the homologous chromosomes of the diploid, heterozygous genotype P6/210. Two contiguous sequences of 417,445 and 202,781 base pairs were assembled and annotated. Gene-by-gene co-linearity was disrupted by non-allelic insertions of retrotransposon elements, stretches of diverged intergenic sequences, differences in gene content and gene order. The latter was caused by inversion of a 70 kbp genomic fragment. These features were also found in comparison to orthologous sequence contigs from three homeologous chromosomes of Solanum demissum, a wild tuber bearing species. Functional annotation of the sequence identified 48 putative open reading frames (ORF in one contig and 22 in the other, with an average of one ORF every 9 kbp. Ten ORFs were classified as resistance-gene-like, 11 as F-box-containing genes, 13 as transposable elements and three as transcription factors. Comparing potato to Arabidopsis thaliana annotated proteins revealed five micro-syntenic blocks of three to seven ORFs with A. thaliana chromosomes 1, 3 and 5. Conclusion Comparative sequence analysis revealed highly conserved collinear regions

  12. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F; Velvis, H; Zachow, C; Berg, G; Van Elsas, JD; Sessitsch, A

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  13. Impact of transgenic potatoes expressing anti-bacterial agents on bacterial endophytes is comparable with the effects of plant genotype, soil type and pathogen infection

    NARCIS (Netherlands)

    Rasche, F.; Velvis, H.; Zachow, C.; Berg, G.; Elsas, van J.D.; Sessitsch, A.

    2006-01-01

    1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4

  14. Induced micro-mutations in Solanum khasianum Clarke

    International Nuclear Information System (INIS)

    Bhattacharyya, B.; Borua, P.K.; Talukdar, P.

    1996-01-01

    Extent of genetic variability for plant height, branches/plant, leaves/plant, spines/leaf, fruits/plant, seeds/fruit, fresh weight of fruits/plant and dry weight of fruits/plant was studied in spined and spineless strains of Solanum khasianum Clarke, following exposure of seeds to seven doses of gamma rays. Gamma ray treatments induced sufficient genetic variability in M 2 generation for the characters particularly in spined strain. Genotypic and phenotypic coefficient of variation and heritability in broad sense were high for spines/leaf, fruits/plant, fresh and dry weight of fruits/plant. High heritability was accompanied by high genetic advance for fresh and dry weight of fruits/plant, seeds/fruit and fruits/plant. Spineless strain was found to be more sensitive to increased gamma ray exposure in comparison to spined strain. (author). 7 refs., 4 tabs

  15. The variability of leaf anatomical characteristics of Solanum nigrum L. (Solana-les, Solanaceae) from different habitats

    OpenAIRE

    Krstić Lana N.; Merkulov Ljiljana S.; Boža Pal P.

    2002-01-01

    In Europe on the whole as well as in Yugoslavia, the most widespread weed species from the genus Solanum is Solanum nigrum L. Since this species inhabits different habitats, it developed several ways of adaptation to environmental conditions. The influence of ecological factors on plant organism and resulting plant adaptations are most evident in leaf morphology and anatomy. Therefore, the anatomical structure of leaves and leaf epidermal tissue of S. nigrum was analyzed and compared among pl...

  16. Evaluación de la densidad de siembra y el tamaño del tubérculo semilla en la producción de semilla básica de papa criolla, variedad «yema de huevo» (Solanum phureja Juz. et Buk. Effect of plant density and tuber-seed size in basic seed production of creole potato «yema de huevo» cultivars (Solanum phureja luz. el Buk.

    Directory of Open Access Journals (Sweden)

    Cotes T. Jose M

    2000-12-01

    Full Text Available La producción de semilla básica es fundamental en la cadena de producción de semillas de alta calidad. En Solanum phureja Juz. el Buk., los factores densidad de siembra y tamaño de tubérculo semilla óptimos para su producción no han sido evaluados hasta el momento. El presente trabajo tuvo como objetivo evaluar estos dos factores en condiciones de la Estación Experimental San Jorge JCA. La investigación se realizó bajo un Diseño en Bloques Completos al Azar con arreglo factorial 4 x 3. Se encontró que las distancias entre plantas evaluadas (15; 20; 25 y 30 cm no afectan la producción de semilla por unidad de área y que la utilización de tubérculos-semilla entre 1,27 y 2,00 cm de diámetro es la más recomendada.The production ofbasic seed is a very important factor, for the seed production chain looking for high quality. The sowing density and the tuber size have not been researched for Solanum phureja Juz. el Buk. The evaluation ofthese factors was conducted at Experimental Center San Jorge - JCA. Randomized Complete Block Design with factorial array (4x3 was used in this assay. It was found that the distance among plants (15; 20; 25 and 30 cm did not modify the seed production per unit of area. The tuber diameter between 1,27 to 2,00 cm., is the best choose in production of basic seed.

  17. Cryopreservation techniques and their application in vegetatively propagated crop plants in Finland

    Directory of Open Access Journals (Sweden)

    A. NUKARI

    2008-12-01

    Full Text Available Cryopreservation protocols have been introduced as techniques for germplasm preservation of vegetatively propagated horticultural and staple food crops. In Finland, cryopreservation has been studied since 1990’s, beginning with cryopreservation of forest tree breeding material and since 2004 on cryopreservation of genetic resources of horticultural plants and potato. Priority was given to cryopreservation of raspberry (Rubus ideaus L., strawberry (Fragaria x ananassa Duch. and potato (Solanum tuberosum L. and the possibility to use cryotherapy in eradication of raspberry bushy dwarf virus (RBDV from in vitro cultures were studied on raspberry. Modified droplet vitrification cryopreservation protocols were designed for raspberry and strawberry and cryotherapy combined with thermotherapy was proven to be a successful application to eliminate RBDV from infected raspberries. Cryotherapy method can be applied for a large scale elimination of viruses from plant germplasm and from candidate nuclear stock in a certified plant production scheme. Routine use of cryotechniques in germplasm preservation of vegetatively propagated horticultural plants was started. Besides for long term germplasm preservation, cryopreservation techniques can be applied also for maintenance of mother stocks in certified plant production schemes and in commercial plant production. Cryopreservation of potato shoot tips needs additional detailed research to obtain sufficient recovery and regrowth rates.;

  18. Activity of the promoter of the Lhca3.St.1 gene, encoding the potato apoprotein 2 of the light-harvesting complex of Photosystem I, in transgenic potato and tobacco plants

    NARCIS (Netherlands)

    Nap, Jan; VANSPANJE, M; Dirkse, W.G.; BAARDA, G; Mlynarova, L; Loonen, A.; GRONDHUIS, P; STIEKEMA, WJ

    We have isolated cDNA and genomic clones for the potato (Solanum tuberosum) apoprotein 2 of the light harvesting complex of Photosystem 1, designated Lhca3.St.l. The protein shows all characteristics of the family of chlorophyll a/b-binding proteins. Potato Lhca3.1 gene expression occurs

  19. The Physiological and Biochemical Mechanisms Providing the Increased Constitutive Cold Resistance in the Potato Plants, Expressing the Yeast SUC2 Gene Encoding Apoplastic Invertase

    Directory of Open Access Journals (Sweden)

    A.N. Deryabin

    2016-05-01

    Full Text Available The expression of heterologous genes in plants is an effective method to improve our understanding of plant resistance mechanisms. The purpose of this work was to investigate the involvement of cell-wall invertase and apoplastic sugars into constitutive cold resistance of potato (Solanum tuberosum L., cv. Dйsirйe plants, which expressed the yeast SUC2 gene encoding apoplastic invertase. WT-plants of a potato served as the control. The increase in the essential cell-wall invertase activity in the leaves of transformed plants indicates significant changes in the cellular carbohydrate metabolism and regulatory function of this enzyme. The activity of yeast invertase changed the composition of intracellular sugars in the leaves of the transformed potato plant. The total content of sugars (sucrose, glucose, fructose in the leaves and apoplast was higher in the transformants, in comparison by WT-plants. Our data indicate higher constitutive resistance of transformants to severe hypothermia conditions compared to WT-plants. This fact allows us to consider cell-wall invertase as a enzyme of carbohydrate metabolism playing an important regulatory role in the metabolic signaling upon forming increased plant resistance to low temperature. Thus, the potato line with the integrated SUC2 gene is a convenient tool to study the role of the apoplastic invertase and the products of its activity during growth, development and formation constitutive resistance to hypothermia.

  20. Alkaloids in Solanum torvum Sw (Solanaceae): (With 2 Tables & 1 Figure)

    OpenAIRE

    Pérez-Amador, MC; Muñoz Ocotero, V; García Castañeda, JM; González Esquinca, AR

    2007-01-01

    A comparison was made between plants of Solanum torvum Sw that grow in Chiapas, Mexico, and plants of the same species originating from India. This was effected to establish either similarities or differences between these plants in total alkaloid contents and presence of solasodine, an important alkaloid for the partial synthesis of steroids. The total alkaloid content (0.12%) of the plants coming from Chiapas and India was the same. However, solasodine was found only in the plants of Chiapa...

  1. Note rétrospective sur l'histoire de la pomme de terre Solarium tuberosum dans l'Est du Zaïre

    Directory of Open Access Journals (Sweden)

    Ngoy Kadiebwe, N.

    1993-01-01

    Full Text Available Retrospective note on history of the potato Solanum tuberosum in Eastern Zaire. Potato is after cassava and sweet potato, the third culture practished in Ituri area. In this respect, it highly contributes to the feeding of the population and at the same time is a source of their income. There is no indication as when potato culture has been broughtin Ituri. However, research works on this speculation have well begun in 1941 but were suspended in 1959 due to political crisis is... preceded our independance. They have effectively started again in the beginning of 1989, yet no result is given. Despite favorable ecological conditions its expansion is slow nowadays owing to difficulties such as insufficience of selected seeds as well as ignorance of conservation techniques.

  2. Hydroponic potato production on nutrients derived from anaerobically-processed potato plant residues

    Science.gov (United States)

    Mackowiak, C. L.; Stutte, G. W.; Garland, J. L.; Finger, B. W.; Ruffe, L. M.

    1997-01-01

    Bioregenerative methods are being developed for recycling plant minerals from harvested inedible biomass as part of NASA's Advanced Life Support (ALS) research. Anaerobic processing produces secondary metabolites, a food source for yeast production, while providing a source of water soluble nutrients for plant growth. Since NH_4-N is the nitrogen product, processing the effluent through a nitrification reactor was used to convert this to NO_3-N, a more acceptable form for plants. Potato (Solanum tuberosum L.) cv. Norland plants were used to test the effects of anaerobically-produced effluent after processing through a yeast reactor or nitrification reactor. These treatments were compared to a mixed-N treatment (75:25, NO_3:NH_4) or a NO_3-N control, both containing only reagent-grade salts. Plant growth and tuber yields were greatest in the NO_3-N control and yeast reactor effluent treatments, which is noteworthy, considering the yeast reactor treatment had high organic loading in the nutrient solution and concomitant microbial activity.

  3. Synthesis of hydroxylated sterols in transgenic Arabidopsis plants alters growth and steroid metabolism.

    Science.gov (United States)

    Beste, Lisa; Nahar, Nurun; Dalman, Kerstin; Fujioka, Shozo; Jonsson, Lisbeth; Dutta, Paresh C; Sitbon, Folke

    2011-09-01

    To explore mechanisms in plant sterol homeostasis, we have here increased the turnover of sterols in Arabidopsis (Arabidopsis thaliana) and potato (Solanum tuberosum) plants by overexpressing four mouse cDNA encoding cholesterol hydroxylases (CHs), hydroxylating cholesterol at the C-7, C-24, C-25, or C-27 positions. Compared to the wild type, the four types of Arabidopsis transformant showed varying degrees of phenotypic alteration, the strongest one being in CH25 lines, which were dark-green dwarfs resembling brassinosteroid-related mutants. Gas chromatography-mass spectrometry analysis of extracts from wild-type Arabidopsis plants revealed trace levels of α and β forms of 7-hydroxycholesterol, 7-hydroxycampesterol, and 7-hydroxysitosterol. The expected hydroxycholesterol metabolites in CH7-, CH24-, and CH25 transformants were identified and quantified using gas chromatography-mass spectrometry. Additional hydroxysterol forms were also observed, particularly in CH25 plants. In CH24 and CH25 lines, but not in CH7 ones, the presence of hydroxysterols was correlated with a considerable alteration of the sterol profile and an increased sterol methyltransferase activity in microsomes. Moreover, CH25 lines contained clearly reduced levels of brassinosteroids, and displayed an enhanced drought tolerance. Equivalent transformations of potato plants with the CH25 construct increased hydroxysterol levels, but without the concomitant alteration of growth and sterol profiles observed in Arabidopsis. The results suggest that an increased hydroxylation of cholesterol and/or other sterols in Arabidopsis triggers compensatory processes, acting to maintain sterols at adequate levels.

  4. Genomics of biotrophic, plant-infecting plasmodiophorids using in vitro dual cultures.

    Science.gov (United States)

    Bulman, Simon; Candy, Judith M; Fiers, Mark; Lister, Ros; Conner, Anthony J; Eady, Colin C

    2011-07-01

    The plasmodiophorids are a phylogenetically distinct group of parasitic protists that infect plants and stramenopiles, causing several important agricultural diseases. Because of the obligate intracellular part of their lifecycle, none of the plasmodiophorids has been axenically cultured. Further, the molecular biology of the plasmodiophorids is poorly understood because pure cultures are not available from any species. We report on an in-vitro dual culture system of the plasmodiophorids Plasmodiophora brassicae and Spongospora subterranea with their respective plant hosts, Brassica rapa and Solanum tuberosum. We show that these plasmodiophorids are capable of initiating and maintaining stable, long-term plant cell callus cultures in the absence of exogenous plant growth regulators. We show that callus cultures harbouring S. subterranea provide an excellent starting material for gene discovery from this organism by constructing a pilot-scale DNA library. Bioinformatic analysis of the sequences established that almost all of the DNA clones from this library were from S. subterranea rather than the plant host. The Spongospora genome was found to be rich in retrotransposable elements, and Spongospora protein-coding genes were shown to contain introns. The sequence of a near full-length non-LTR retrotransposon was obtained, the first transposable element reported from a cercozoan protist. Copyright © 2010 Elsevier GmbH. All rights reserved.

  5. The use of antigibberelins with different mechanisms of action on morphogenesis and production process regulation in the plant Solanum melongena (Solanaceae

    Directory of Open Access Journals (Sweden)

    V. G. Kuriata

    2016-03-01

    Full Text Available The influence of antigibberelin on the growth, development and productivity of eggplant was investigated. It was established that the use of tebuconazole and chlormequat chloride is a highly effective tool for regulation of morphogenesis and productivity of eggplant. We found that retardants slowed the growth of plants, and increased the number of leaves and leaf area and dry substance weight of the whole plant. Under the influence of Esfon ethylene producers the inhibition of the growth process was not accompanied by increase of the number, weight and area of leaves.Antigibberelin agents caused the thickening of chlorenchyma and the growth of the columnar cells and cell sizes of spongy parenchyma. Under the action of agents the thickness of the upper and lower epidermis of the leaf increased. As a result of mesostructural and morphometric changes of leaf structure under the influence of retardants the leaf index and specific leaf surface density increased.The growth inhibitory agents increased the chlorophyll content in leaves and caused the growth of chlorophyll index in crops.Retardants reduced the content of sugar and starch in leaves because of their enhanced outflow to fruits, the amount of which was predicted to be greater. Under the influence of Esfon the flow of carbohydrates to the acceptor areas was slower.The use of retardants of triazole and onium origin positively influenced the formation of productivity elements of the culture, which led to increase in the fruit yield. The use of tebuconazole was found to be the most effective.

  6. Synthesis of Hydroxylated Sterols in Transgenic Arabidopsis Plants Alters Growth and Steroid Metabolism1[C][W][OA

    Science.gov (United States)

    Beste, Lisa; Nahar, Nurun; Dalman, Kerstin; Fujioka, Shozo; Jonsson, Lisbeth; Dutta, Paresh C.; Sitbon, Folke

    2011-01-01

    To explore mechanisms in plant sterol homeostasis, we have here increased the turnover of sterols in Arabidopsis (Arabidopsis thaliana) and potato (Solanum tuberosum) plants by overexpressing four mouse cDNA encoding cholesterol hydroxylases (CHs), hydroxylating cholesterol at the C-7, C-24, C-25, or C-27 positions. Compared to the wild type, the four types of Arabidopsis transformant showed varying degrees of phenotypic alteration, the strongest one being in CH25 lines, which were dark-green dwarfs resembling brassinosteroid-related mutants. Gas chromatography-mass spectrometry analysis of extracts from wild-type Arabidopsis plants revealed trace levels of α and β forms of 7-hydroxycholesterol, 7-hydroxycampesterol, and 7-hydroxysitosterol. The expected hydroxycholesterol metabolites in CH7-, CH24-, and CH25 transformants were identified and quantified using gas chromatography-mass spectrometry. Additional hydroxysterol forms were also observed, particularly in CH25 plants. In CH24 and CH25 lines, but not in CH7 ones, the presence of hydroxysterols was correlated with a considerable alteration of the sterol profile and an increased sterol methyltransferase activity in microsomes. Moreover, CH25 lines contained clearly reduced levels of brassinosteroids, and displayed an enhanced drought tolerance. Equivalent transformations of potato plants with the CH25 construct increased hydroxysterol levels, but without the concomitant alteration of growth and sterol profiles observed in Arabidopsis. The results suggest that an increased hydroxylation of cholesterol and/or other sterols in Arabidopsis triggers compensatory processes, acting to maintain sterols at adequate levels. PMID:21746809

  7. SolRgene: an online database to explore disease resistance genes in tuber-bearing Solanum species

    Directory of Open Access Journals (Sweden)

    Vleeshouwers Vivianne GAA

    2011-08-01

    Full Text Available Abstract Background The cultivated potato (Solanum tuberosum L. is an important food crop, but highly susceptible to many pathogens. The major threat to potato production is the Irish famine pathogen Phytophthora infestans, which causes the devastating late blight disease. Potato breeding makes use of germplasm from wild relatives (wild germplasm to introduce resistances into cultivated potato. The Solanum section Petota comprises tuber-bearing species that are potential donors of new disease resistance genes. The aim of this study was to explore Solanum section Petota for resistance genes and generate a widely accessible resource that is useful for studying and implementing disease resistance in potato. Description The SolRgene database contains data on resistance to P. infestans and presence of R genes and R gene homologues in Solanum section Petota. We have explored Solanum section Petota for resistance to late blight in high throughput disease tests under various laboratory conditions and in field trials. From resistant wild germplasm, segregating populations were generated and assessed for the presence of resistance genes. All these data have been entered into the SolRgene database. To facilitate genetic and resistance gene evolution studies, phylogenetic data of the entire SolRgene collection are included, as well as a tool for generating phylogenetic trees of selected groups of germplasm. Data from resistance gene allele-mining studies are incorporated, which enables detection of R gene homologs in related germplasm. Using these resources, various resistance genes have been detected and some of these have been cloned, whereas others are in the cloning pipeline. All this information is stored in the online SolRgene database, which allows users to query resistance data, sequences, passport data of the accessions, and phylogenic classifications. Conclusion Solanum section Petota forms the basis of the SolRgene database, which contains a

  8. Impact of application of zinc oxide nanoparticles on callus induction, plant regeneration, element content and antioxidant enzyme activity in tomato (Solanum lycopersicum Mill. under salt stress

    Directory of Open Access Journals (Sweden)

    Alharby Hesham F.

    2016-01-01

    Full Text Available The properties of nanomaterials and their potential applications have been given considerable attention by researchers in various fields, especially agricultural biotechnology. However, not much has been done to evaluate the role or effect of zinc oxide nanoparticles (ZnO-NP in regulating physiological and biochemical processes in response to salt-induced stress. For this purpose, some callus growth traits, plant regeneration rate, mineral element (sodium, potassium, phosphorous and nitrogen contents and changes in the activity of superoxide dismutase (SOD and glutathione peroxidase (GPX in tissues of five tomato cultivars were investigated in a callus culture exposed to elevated concentrations of salt (3.0 and 6.0 g L-1NaCl, and in the presence of zinc oxide nanoparticles (15 and 30 mg L-1. The relative callus growth rate was inhibited by 3.0 g L-1 NaCl; this was increased dramatically at 6.0 g L-1. Increasing exposure to NaCl was associated with a significantly higher sodium content and SOD and GPX activities. Zinc oxide nanoparticles mitigated the effects of NaCl, and in this application of lower concentrations (15 mg L-1 was more effective than a higher concentration (30 mg L-1. This finding indicates that zinc oxide nanoparticles should be investigated further as a potential anti-stress agent in crop production. Different tomato cultivars showed different degrees of tolerance to salinity in the presence of ZnO-NP. The cultivars Edkawy, followed by Sandpoint, were less affected by salt stress than the cultivar Anna Aasa.

  9. Molecular characterisation of resistance against potato wart races 1, 2, 6 and 18 in a tetraploid population of potato (Solanum tuberosum subsp. tuberosum).

    Science.gov (United States)

    Groth, Jennifer; Song, Yesu; Kellermann, Adolf; Schwarzfischer, Andrea

    2013-05-01

    Potato wart is caused by the obligate biotrophic fungus Synchytrium endobioticum, which is subject to quarantine regulations due to the production of long persisting spores in the soil and the lack of effective fungicides. The objective of this study was to identify quantitative trait loci (QTL) for resistance against potato wart races (R) 1, 2, 6 and 18 in a tetraploid potato population developed by crossing cv. Saturna (resistant to R1) with cv. Panda (resistant to R1, R2, R6, R18). A total of 92 progenies were used for phenotyping and genotyping. Resistance tests were performed for races 1 and 18 in 2 years and for races 2 and 6 in 1 year on 10 to 20 eyepieces per genotype. Based on amplified fragment length polymorphism (AFLP) and simple sequence repeat (SSR) markers, linkage maps were established for the female and male parent, respectively. Single marker analysis followed by a multiple regression analysis revealed initial marker-trait associations. The interval mapping routine of TetraploidMap was applied for QTL analysis. A major QTL for resistance against race 1 explaining between 46 % and 56 % of the phenotypic variation was identified near Sen1, a known resistance locus for potato wart race 1 on chromosome XI. Other resistance QTL were detected on chromosomes I (to R2), II (to R6, 18), VI (to R1, 2, 6, 18), VII (to R2, 6, 18), VIII (to R1, 2, 6, 18), X (to R2, 6, 18), XI (to R2, 6, 18) and on an unknown linkage group (to R18) explaining minor to moderate effects of the phenotypic variation. Resistance QTL against different potato wart races often overlapped, particularly concerning races 2, 6 and 18. Overall, this study gives a valuable insight into the complex inheritance of resistance against potato wart.

  10. Cercospora apii causing leaf spots on two Brazilian toxic weeds: solanum glaucophyllum and Xanthium strumarium

    Directory of Open Access Journals (Sweden)

    Fabiano Branco Rocha

    2007-03-01

    Full Text Available Samples of two toxic weeds, Solanum glaucophyllum and Xanthium strumarium, bearing leaf spots symptoms were found. Cercospora apii was found associated to these leaf spots in both plants. These are the first reports of this fungus on these hosts in Brazil and its first report on S. glaucophyllum worldwide.Foram encontrados plantas das espécies Solanum glaucophyllum e Xanthium strumaruium apresentando sintomas de manchas foliares. Cercospora apii foi encontrado associado lesões foliares em ambas as plantas. Estes são os primeiros relatos desse fungo nestes hospedeiros no Brasil e o primeiro relato de sua ocorrência em S. glaucophyllum no mundo.

  11. RNA sequencing on Solanum lycopersicum trichomes identifies transcription factors that activate terpene synthase promoters

    NARCIS (Netherlands)

    Spyropoulou, E.A.; Haring, M.A.; Schuurink, R.C.

    2014-01-01

    BACKGROUND: Glandular trichomes are production and storage organs of specialized metabolites such as terpenes, which play a role in the plant's defense system. The present study aimed to shed light on the regulation of terpene biosynthesis in Solanum lycopersicum trichomes by identification of

  12. The development of FISH tools for genetic, phylogenetic and breeding studies in tomato (Solanum lycopersicum)

    NARCIS (Netherlands)

    Szinay, D.

    2010-01-01

    In this thesis various fluorescence in situ hybridization (FISH) technologies are described to support genome projects, plant breeding and phylogenetic analysis on tomato (Solanum lycopersicum, 2n=24). Its genome is 980 Mb and only 30 % are single copy sequences, which are mostly found in the

  13. Induction of cell death on Plasmodium falciparum asexual blood stages by Solanum nudum steroids

    DEFF Research Database (Denmark)

    López, Mary Luz; Vommaro, Rossiane; Zalis, Mariano

    2010-01-01

    Solanum nudum Dunal (Solanaceae) is a plant used in traditional medicine in Colombian Pacific Coast, from which five steroids denominated SNs have been isolated. The SNs compounds have antiplasmodial activity against asexual blood stages of Plasmodium falciparum strain 7G8 with an IC50 between 20...

  14. Ethnopharmacological survey about medicinal plants utilized by herbalists and traditional practitioner healers for treatments of diarrhea in the West Bank/Palestine.

    Science.gov (United States)

    Jaradat, Nidal Amin; Ayesh, Ola Ibrahim; Anderson, Cynthia

    2016-04-22

    Folk herbal medicine knowledge and its utilization by aboriginal cultures are not only useful for conservation of cultural traditions and biodiversity, but also useful for community healthcare and drug discovery in the present and in the future. Using a semi-structured questionnaire, an ethnopharmacological survey of medicinal plants used for treatment of diarrhea in the West Bank/Palestine was investigated. Information about fifty medicinal plants used for treatment of diarrhea, including the names of plants, parts used, mode and methods of preparation was obtained from 100 traditional healers and herbalists. This research is the first scientific work in the Middle East to collect data about plants used by traditional healers for treatments of diarrhea and their evidence based effects against this disease. The fidelity levels were 97% for Salvia fruticosa, Teucrium polium and Musa paradisiaca, 95% for Camellia sinensis and Aegle marmelos, 79% for Oryza sativa and Solanum tuberosum, 77% for Quercus boissieri, 66% for Psidium guajava, 56% for Anthemis palestina, 54% for Solanum nigrum and 52% for Juglans regia while the highest use and choice values were for S. fruticosa, T. polium and M. paradisiaca as well as the factor of informant's consensus for medicinal plants used for treatment of diarrhea was 0.505.The leaves were the most commonly used parts, followed by fruits, roots and rhizomes, while decoctions and infusions are the preferred methods of preparation. The Palestinian traditional medicine is rich with herbal remedies for treatment of diarrhea in comparison with other countries, but most of these herbal remedies lack standard in-vitro and in-vivo evaluations to establish their antidiarrheal effects. Therefore, the information obtained can serve as a basis for further phytochemical and pharmacological studies to determine their efficacy and safety which might contribute to a better integration of Palestinian traditional medicine into the national health

  15. DNA damage in potato plants induced by cadmium, ethyl methanesulphonate and gama-rays

    Czech Academy of Sciences Publication Activity Database

    Gichner, Tomáš; Patková, Zdeňka; Száková, J.; Žnidar, I.; Mukherjee, A.

    2008-01-01

    Roč. 62, č. 2 (2008), s. 113-119 ISSN 0098-8472 R&D Projects: GA ČR GA521/05/0500 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje Keywords : Comet assay * Solanum tuberosum L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.301, year: 2008

  16. Experimental evaluation of admission and disposition of artificial radionuclides including transuranium elements in agricultural plants

    Energy Technology Data Exchange (ETDEWEB)

    Kozhakhanov, T.; Lukashenko, S. [Institute of radiation safety and ecology (Kazakhstan)

    2014-07-01

    Processes of radionuclides migration and transfer to agricultural plants are quite well developed worldwide, but the information on character of accumulation of {sup 241}Am and {sup 239+240}Pu transuranium radionuclides in agricultural plants is still fragmentary. Even in generalized materials of worldwide studies, IAEA guide, accumulation coefficient (AC) can have wide range of values (5-6 orders), no data exists on radionuclides' distribution in different organs of plants and they are given for joined groups of plants and types of soils. That is why the main aim of this work was to obtain basic quantitative parameters of radionuclides' migration in 'soil-plant' system, and firs of all- for transuranium elements.. In 2010 a series of experiments with agricultural plants was started at the territory of the former Semipalatinsk Test Site aimed to investigate entry of artificial radionuclides by crop products in natural climatic conditions. To conduct the experiment for study of coefficient of radionuclides' accumulation by agricultural corps, there was chosen a land spot at the STS territory, characterized by high concentration of radionuclides: {sup 241}Am - n*10{sup 4} Bq/kg, {sup 137}Cs - n*10{sup 3} Bq/kg, {sup 90}Sr - n*10{sup 3} Bq/kg and {sup 239+240}Pu- n*10{sup 5} Bq/kg. As objects of investigation, cultures, cultivated in Kazakhstan have been selected: wheat (Triticum vulgare), barley (Hordeum vulgare), oat (Avena sativa L.), water melon (Citrullus vulgaris), melon (Cucumis melo), potato (Solanum tuberosum), eggplant (Solanum melongena), pepper (Capsicum annuum), tomato (Solanum lycopersicum), sunflower (Helianthus cultus), onion (Allium cepa), carrot (Daucus carota), parsley(Petroselinum vulgare)and cabbage (Brassica oleracea). Investigated plants have been planted within the time limits, recommended for selected types of agricultural plants. Cropping system included simple agronomic and amelioration measures. Fertilizers were not

  17. Modeling and control for closed environment plant production systems

    Science.gov (United States)

    Fleisher, David H.; Ting, K. C.; Janes, H. W. (Principal Investigator)

    2002-01-01

    A computer program was developed to study multiple crop production and control in controlled environment plant production systems. The program simulates crop growth and development under nominal and off-nominal environments. Time-series crop models for wheat (Triticum aestivum), soybean (Glycine max), and white potato (Solanum tuberosum) are integrated with a model-based predictive controller. The controller evaluates and compensates for effects of environmental disturbances on crop production scheduling. The crop models consist of a set of nonlinear polynomial equations, six for each crop, developed using multivariate polynomial regression (MPR). Simulated data from DSSAT crop models, previously modified for crop production in controlled environments with hydroponics under elevated atmospheric carbon dioxide concentration, were used for the MPR fitting. The model-based predictive controller adjusts light intensity, air temperature, and carbon dioxide concentration set points in response to environmental perturbations. Control signals are determined from minimization of a cost function, which is based on the weighted control effort and squared-error between the system response and desired reference signal.

  18. Antimicrobial Effect of Leaves of Phyllanthus niruri and Solanum nigrum on Caries Causing Bacteria: An In vitro Study.

    Science.gov (United States)

    Sunitha, J; Krishna, Swathy; Ananthalakshmi, R; Jeeva, J Sathiya; Girija, As Smiline; Jeddy, Nadeem

    2017-06-01

    Solanum nigrum and Phyllanthus niruri are common herbs which are indigeneous to India. Solanum nigrum commonly called 'manathakkali Keerai' in Tamil, forms an indispensable part of South Indian diet. Phyllanthus niruri (keezhanelli in Tamil) is a widely used medicinal plant, the leaves of which have been used extensively in Ayurveda and native medicine to cure various liver ailments. The herbs Solanum nigrum and Phyllanthus niruri have been found to be effective against numerous enteropathogens in various in vitro studies. To assess and compare the antibacterial efficacy of the crude alcoholic extract of the leaves of Solanum nigrum and Phyllanthus niruri against five cariogenic organisms. Standard strains of the micro-organisms were obtained from ATCC (American Type Culture Collection) and MTCC (Microbial Type Culture Collection) which comprised of Streptococcus mutans MTCC no. 890, Streptococcus oralis MTCC no 2696, Lactobacillus acidophillus MTCC no. 10307, Streptococcus sanguis ATCC no. 10556 and Streptococcus salivarius ATCC no. 13419. The organisms obtained were revived and lawn cultured on Trypticase Soy Agar-Blood Agar (TSA-BA) and de Man, Rogosa and Sharpe (MRS) agar media. The antibacterial effect of the dried and powdered leaves of Solanum nigrum and Phyllanthus niruri was tested using agar well diffusion method. The zones of inhibition obtained after incubation were measured and tabulated. The antibacterial activity for the two herbs was compared using the Mann-Whitney test. The antibacterial zones of inhibition obtained for the herb Solanum nigrum was in the range of 12.3-14.6 mm and ranged from 9.7-11.6 mm for the herb Phyllanthus niruri . When the zones of inhibition were compared for the herbs, Solanum nigrum showed significantly greater zones of inhibition compared to Phyllanthus niruri for the organisms Streptococcus sanguis , Streptococcus salivarius , Streptococcus oralis and Streptococcus mutans (p-valuecariogenic organisms, with Solanum nigrum

  19. Hybrid proline-rich proteins: novel players in plant cell elongation?

    Science.gov (United States)

    Dvořáková, Lenka; Srba, Miroslav; Opatrny, Zdenek; Fischer, Lukas

    2012-01-01

    Background and Aims Hybrid proline-rich proteins (HyPRPs) represent a large family of putative cell-wall proteins characterized by the presence of a variable N-terminal domain and a conserved C-terminal domain that is related to non-specific lipid transfer proteins. The function of HyPRPs remains unclear, but their widespread occurrence and abundant expression patterns indicate that they may be involved in a basic cellular process. Methods To elucidate the cellular function of HyPRPs, we modulated the expression of three HyPRP genes in tobacco (Nicotiana tabacum) BY-2 cell lines and in potato (Solanum tuberosum) plants. Key Results In BY-2 lines, over-expression of the three HyPRP genes with different types of N-terminal domains resulted in similar phenotypic changes, namely increased cell elongation, both in suspension culture and on solid media where the over-expression resulted in enhanced calli size. The over-expressing cells showed increased plasmolysis in a hypertonic mannitol solution and accelerated rate of protoplast release, suggesting loosening of the cell walls. In contrast to BY-2 lines, no phenotypic changes were observed in potato plants over-expressing the same or analogous HyPRP genes, presumably due to more complex compensatory mechanisms in planta. Conclusions Based on the results from BY-2 lines, we propose that HyPRPs, more specifically their C-terminal domains, represent a novel group of proteins involved in cell expansion. PMID:22028464

  20. Holiday Plants with Toxic Misconceptions

    Directory of Open Access Journals (Sweden)

    Zabrina N. Evens

    2012-12-01

    Full Text Available Several plants are used for their decorative effect during winter holidays. This review explores the toxic reputation and proposed management for exposures to several of those, namely poinsettia (Euphorbia pulcherrima, English holly (Ilex aquifolium, American holly (Ilex opaca,bittersweet (Solanum dulcamara, Jerusalem cherry (Solanum pseudocapsicum, Americanmistletoe (Phoradendron serotinum, and European mistletoe (Viscum album.

  1. Circumscription of the anthracnose pathogens Colletotrichum lindemuthianum and C. nigrum

    NARCIS (Netherlands)

    Liu, F.; Cai, L.; Crous, P.W.; Damm, U.

    2013-01-01

    The anthracnose pathogen of common bean (Phaseolus vulgaris) is usually identified as Colletotrichum lindemuthianum, while anthracnose of potato (Solanum tuberosum), peppers (Capsicum annuum), tomato (S. lycopersicum) and several other crop plants is often attributed to C. coccodes. In order to

  2. Callus induction and growth in transgenic potato genotypes

    African Journals Online (AJOL)

    Administrator

    Solanum tuberosum L.). This has resulted in a range of protocols and procedures being established by researchers since tissue culture gained an importance in plant propagation, conservation and breeding (Ahloowalia 1982; Wareh et al., 1989).

  3. Efeito da substituição parcial da farinha de trigo por farinha de casca de batata (Solanum Tuberosum Lineu Effect of the partial replacement of wheat flour for potato skin flour (Solanum Tuberosum L.

    Directory of Open Access Journals (Sweden)

    Anderson Felicori Fernandes

    2008-12-01

    Full Text Available O aproveitamento dos subprodutos da agroindústria de alimentos diminui os custos da produção, aumenta o aproveitamento total do alimento e reduz o impacto que esses subprodutos podem causar ao serem descartados no ambiente. Dessa forma, alguns subprodutos da batata são aproveitados e transformados em ingredientes alimentícios, como é o caso da casca. Neste estudo utilizou-se a casca de batata para produção de farinha visando a sua utilização em produtos de panificação, sendo utilizadas as seguintes porcentagens na composição da farinha mista: 0-50-50%; 3-47-50%; 6-44-50%; 9-41-50% e 12-38-50% de farinha de casca de batata, farinha de trigo branca e farinha de trigo integral, respectivamente. Foram realizadas análises físico-químicas na farinha de casca de batata, análises físicas na farinha de casca, nas farinhas de trigo branca e integral e análises reológicas nas farinhas mistas. A farinha de casca de batata apresentou bons teores de fibras e minerais, e dentro deste último, destacam-se os teores de fósforo, cálcio e magnésio. Quanto à granulometria e à diferença de cor, as farinhas de casca de batata e a farinha de trigo integral apresentaram valores mais próximos uma da outra. À medida que se aumentou a substituição da farinha de trigo branca pela farinha de casca de batata, as análises reológicas indicaram uma queda na qualidade tecnológica das massas.Reusing some agro-industrial food by-products lower the production costs, increase efficient food utilization, and reduce the impact that these sub-products cause if discarded in the environment. Thus, some potato by-products are reused utilized and transformed into food ingredients, such as potato skin. In this study, potato skin was utilized for the production of flour to be used in bakery products. The following percentages were utilized in the composition of the mixed flour: 0-50-50%; 3-47-50%; 6-44-50%; 9-41-50%, and 12-38-50% of potato skin flour, white wheat flour, and whole wheat flour, respectively. Physicochemical analyses of the potato skin flour, physical analyses of the skin flour, white, and whole wheat flours, and rheological analyses of the mixed flours were performed. The potato skin flour presented relatively high contents of fibers and minerals especially phosphorus, calcium, and magnesium. Regarding grain size and color difference, the potato skin and whole wheat flour presented similar values. With the increase of the ratio of white wheat flour replacement level for potato skin flour, the rheological analyses indicated a reduction in the technological quality of the dough.

  4. Variations observed in the respiratory activity of potato tubers (Solanum tuberosum L.) after a treatment with gamma radiation; Variaciones observadas en la actividad respiratoria de tuberculos de patata (Solanum tuberosum L.) despues de un tratamiento con radiacion GAMMA

    Energy Technology Data Exchange (ETDEWEB)

    Mazon Matanzo, M P; Fernandez Gonzalez, J

    1976-07-01

    The present work studies the variations in the respiratory activity of irradiated and IPC treated potato tubers during a storage period of five months. By immediate effect of gamma radiation we can observe an increase in the oxygen consumption of the parenchyma in relation with the control tubers, such increase persists even fours months after gamma radiation. The respiratory activity is reduced in the IPC treated tubers. In the tissues cultivated in vitro the respiratory activity increases at the end of the cultivation period, not only in the control tissues but also in the irradiated ones, though this increase is greater in the control tissues. (Author) 15 refs.

  5. Six cultivars of Solanum macrocarpon (Solanaceae in Ghana

    Directory of Open Access Journals (Sweden)

    Z. R. Bukenya

    1987-10-01

    Full Text Available The  Solanum macrocarpon complex (the cultivated egg plant has been studied in Ghana using morphological and experimental methods. Six cultivars belonging to the S.  macrocarpon complex have been recognized and described. The cultivars are  S. macrocarpon ‘Gboma’,  S. macrocarpon ‘Mankessim’,  S. macrocarpon ‘Akwaseho’,  S. macrocarpon ‘Kade’,  S. macrocarpon ‘Sarpeiman’ and  S. macrocarpon ‘Bui’. The very spiny, hairy plant traditionally called S. dasyphyllum is regarded as the wild ancestor from which the cultivars have been derived through a process of crop evolution. The variation within S. macrocarpon complex is attributable to genotypic differences and environmental factors.

  6. Identication of potivirus present in lulo (solanum quitoense lam

    Directory of Open Access Journals (Sweden)

    J. Vaca

    1999-07-01

    Full Text Available The Solanaceous fruit Solanum quitoense Lam, is originally from Andean región of South America. This fruit has commercial prospective. The Leaf Yellowing Disease in Lulo (Solanum quitoense Lam was first described by Zuluaga in 1991. It causes economically losses and has been associated with a virus attack. The disease's symptoms included stunting, yellow streaking or mosaic patterns in leaves, often with a curling of the leaf margins. In order to diagnostic the presence of virus, we applied two different strategies. The first one consisted of a modified technique of RNA double strand isolation (Morris and Dodds, 1979. The second one consisted on applying RT-PCR system using specific "primers" designed to amplify cDNA fragments spaning the 3'-terminal part of the Nlb cistron and the 5'-terminal part of the potyvirus CP cistron (Langeveld et al 1991. By applying the modified method of Morris and Dodds, it was possible to observe characteristic bands of double strand RNA. Amplification with "primers" POT1 and POT2 yielded a fragment of about 1 Kpb, whose length was in agreement with the known sequences of potyvirus. Here we report by the first time a potyvirus presence in Lulo plants affected with leaf yellowing disease, identified by dsRNA analysis and RT-PCR procedure.

  7. Expression of two functionally distinct plant endo-beta-1,4-glucanases is essential for the compatible interaction between potato cyst nematode and its hosts.

    Science.gov (United States)

    Karczmarek, Aneta; Fudali, Sylwia; Lichocka, Malgorzata; Sobczak, Miroslaw; Kurek, Wojciech; Janakowski, Slawomir; Roosien, Jan; Golinowski, Wladyslaw; Bakker, Jaap; Goverse, Aska; Helder, Johannes

    2008-06-01

    For the proliferation of their feeding sites (syncytia), the potato cyst nematode Globodera rostochiensis is thought to recruit plant endo-beta-1,4-glucanases (EGases, EC. 3.2.1.4). Reverse-transcription polymerase chain reaction experiments on tomato (Solanum lycopersicum) indicated that the expression of two out of the at least eight EGases, namely Sl-cel7 and Sl-cel9C1, is specifically upregulated during syncytium formation. In situ hybridization and immunodetection studies demonstrated that both EGases are specifically expressed inside and adjacent to proliferating syncytia. To assess the importance of Sl-cel7 and Sl-cel9C1 for nematode development, we decided to knock them out individually. Sl-cel9C1 probably is the only class C EGase in tomato, and we were unable to regenerate Sl-cel9C1-silenced plants. Potato (S. tuberosum), a close relative of tomato, harbors at least two class C EGases, and St-cel7-or St-cel9C1-silenced potato plants showed no obvious aberrant phenotype. Infection with potato cyst nematodes resulted in a severe reduction of the number of adult females (up to 60%) and a sharp increase in the fraction of females without eggs (up to 89%). Hence, the recruitment of CEL7, an enzyme that uses xyloglucan and noncrystalline cellulose as natural substrates, and CEL9C1, an enzyme that uses crystalline cellulose, is essential for growth and development of potato cyst nematodes.

  8. Variations observed in the respiratory activity of potato tubers (Solanum tuberosum L.) after a treatment with gamma radiation

    International Nuclear Information System (INIS)

    Mazon Matanzo, M. P.; Fernandez Gonzalez, J.

    1976-01-01

    The present work studies the variations in the respiratory activity of irradiated and IPC treated potato tubers during a storage period of five months. By immediate effect of gamma radiation we can observe an increase in the oxygen consumption of the parenchyma in relation with the control tubers, such increase persists even fours months after gamma radiation. The respiratory activity is reduced in the IPC treated tubers. In the tissues cultivated in vitro the respiratory activity increases at the end of the cultivation period, not only in the control tissues but also in the irradiated ones, though this increase is greater in the control tissues. (Author) 15 refs

  9. Effect of the gamma radiation on the preservation pf potato tubers (Solanum tuberosum L.) during the storing period

    International Nuclear Information System (INIS)

    Mazon matanzo, M.P.; Fernandez Gonzalez, J.

    1976-01-01

    The effect of the gamma radiation on the preservation of potato tubers stored during a period of six months is described by evaluating the loss by sprouting, transpiration and infections. The dose of 9 Krad inhibits sprouting with independence of the epoch in wich the treatment is made, on the other hand a dose of 6 Krad inhibits sprouting only if the tubers are irradiated during the resting period. The treatment with IPC gave similar results to those obtained with a dose of 9 Krad. (author) [es

  10. Appropriateness of culinary preparations of potato (Solanum tuberosum L.) varieties and relation to sensory and physicochemical properties.

    Science.gov (United States)

    Seefeldt, Helene F; Tønning, Erik; Wiking, Lars; Thybo, Anette K

    2011-02-01

    Appropriateness of potatoes for culinary preparations is defined as the optimal use of a given variety for a specific culinary preparation. The aim of this study was to examine the sensory attributes and physicochemical characteristics (dry matter content, starch properties, instrumental texture) of 11 potato varieties in relation to their appropriateness for boiling, oven-frying or mashing. The reproducibility of appropriateness was studied by including the effect of two growing conditions and yearly variation combined with internal references. The potato varieties, tested by 31 evaluators in two years, showed three groupings differing in appropriateness, which could be explained by a few sensory attributes: yellowness, mealiness, creaminess and butter taste. The physicochemical data showed a large variation of 23-25% in dry matter content, amylose content and starch granule size and an extreme variation in texture hardness. High reproducibility was found in the ranking of potatoes across years and culinary preparations. Hence, if a variety was judged well appropriate for boiled potatoes, it was also judged well appropriate as mashed or oven-fried potatoes. This study showed the relevance of using sensory descriptors appropriateness in an objective manner. A few sensory descriptors can be used in consumer-labelling appropriateness of potatoes. 2010 Society of Chemical Industry.

  11. Effect of potato (Solanum tuberosum addition on dough properties, sensory qualities and resistant starch content of bread

    Directory of Open Access Journals (Sweden)

    Maria Lidia IANCU

    2015-08-01

    Full Text Available The aim of this study is to assess the effects of adding different varieties of boiled potatoes-pasta (PP, Impala (I and Orchestra (O, to wheat flour in bread making. These potato varieties were used to replace wholemeal 1250 type flour (F1 and hard wheat semolina flour (F2 in different concentrations: 5%, 10%, 20%, 30%. The rheological properties of dough with added potato were assessed by means of the flour-graphic technique. The study also determined the amount of resistant starch (RS, non-resistant starch (n-RS, total starch (TS and moisture content of the potato bread. The results showed that the water absorption (WA in the potato dough containing salt and yeast decreased by 28.8% (F2-I-PP, and by 41.2% (F1-I-PP respectively. The same happened with the dough development time, dough stability and quality number. We found out that the degree of dough softening was increased, as was the moisture content of the bread, which went from 47.7% (O-PP-F2 to 50.3% (I-PP-F1. The level of the ten analyzed sensory properties led to the conclusion that, by adding up to 20% PP, we enhance the bread quality. The RS content increased by 5.1 g/100 g d.m. for F1 bread for the 30% (O-PP-F2 potato content batch. In F2 bread, the RS content increased by up to 5.11g/100 g d.m. for the 30% (O-PP-F2 potato content batch. Given the method of analysis, RS may be a mixture of RS2 (natural granule starch and RS3 (retrograde or non crystalline retrograde. Therefore, potato bread is very healthy and recommended for its nutritional benefits.

  12. Molecular and biological characterisation of two novel pomo-like viruses associated with potato (Solanum tuberosum) fields in Colombia.

    Science.gov (United States)

    Gil, Jose Fernando; Adams, Ian; Boonham, Neil; Nielsen, Steen Lykke; Nicolaisen, Mogens

    2016-06-01

    Potato is the fourth most important crop worldwide that is used as a staple food, after rice, wheat and maize. The crop can be affected by a large number of pathogens, including fungi, oomycetes, bacteria and viruses. Diseases caused by viruses are among the most important factors contributing to reduced quality and yield of the crop. Potato mop-top virus (genus Pomovirus) induces necrotic flecks in the tuber flesh and skin of potato in temperate countries. Spongospora subterranea is the vector of PMTV. Both the virus and its vector cause disease in potato. In Colombia, PMTV has been detected throughout the country together with a novel pomo-like virus in the centre (Cundinamarca and Boyacá) and south west (Nariño) of the country. We studied the molecular and biological characteristics of this novel virus. Its genome resembles those of members of the genus Pomovirus, and it is closely related to PMTV. It induces mild systemic symptoms in Nicotiana benthamiana (mosaic, branch curling), but no symptoms in N. tabacum, N. debneyi and Chenopodium amaranticolor. The proposed name for the virus is "Colombian potato soil-borne virus" (CPSbV). Additionally, another pomo-like virus was identified in Nariño. This virus induces severe systemic stem declining and mild mosaic in N. benthamiana. The tentative name "soil-borne virus 2" (SbV2) is proposed for this virus. No vectors have been identified for these viruses despite several attempts. This work focused on the characterisation of CPSbV. The risk posed by these viruses if they are introduced into new territories is discussed.

  13. Influence of low dose {gamma} radiation on the dormancy, growth and physiological activity of seed potato (solanum tuberosum L.)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J. S.; Lee, Y. K.; Lee, H. Y.; Baek, M. H.; Yoo, Z. C. [KAERI, Taejon (Korea, Republic of)

    2002-05-01

    To observe the stimulating effect of low dose {gamma} radiation on the dormancy breaking and growth of potato with different storage duration and conditions, potato were irradiated with the dose of 1 {approx} 16 Gy. Though varied with storage duration and conditions, sprouting rate of potato stored at 5 .deg. C in the dark was promoted at the 8 and 16 Gy irradiation group compared to 20 .deg. C in the light. The field growth of potato stored at 5 .deg. C in the dark was highly increased at the 2, 4, 8 Gy irradiation group. The CAT activity of potato was increased by about 20% at 1,8 and 16 Gy irradiation group. POD activity was also increased by 7 {approx} 16% at 1, 8 and 16 Gy irradiation group compared to the control. Fv/Fm was not changed by the low dose {gamma} radiation. However, the effective quantum yield of PSII was slightly increased by about 12% at 1 and 16 Gy irradiation group. Seedling irradiated with low dose {gamma} radiation showed the lower excitation pressure on PSII (1- {sub q}P), while NPQ was greatly increased by 45% at 4 Gy irradiation group. These results clearly showed the positive effect of low dose {gamma} radiation on the seedling growth of potato via increasing photoprotective capacities of photosynthetic apparatus.

  14. Isolation and chemoenzymatic treatment of glycoalkaloids from green, sprouting and rotting Solanum tuberosum potatoes for solanidine recovery.

    Science.gov (United States)

    Koffi, Grokoré Yvonne; Remaud-Simeon, Magali; Due, Ahipo Edmond; Combes, Didier

    2017-04-01

    The estimation of glycoalkaloids in the flesh of different types of decayed potatoes was evaluated. The results showed that turned green and also sprouting or rotting potato flesh contain high amounts of toxic solanine and chaconine, exceeding by 2-5-fold the recommended limit, and ranging from 2578±86mg/kg to 5063±230mg/kg of dry weight potato flesh. For safety consideration, these decayed potatoes should be systematically set aside. To avoid a net economic loss and encourage the removal of this hazardous food, a recycling process was investigated to generate added-value compounds from the toxic glycoalkaloids. A simple chemo-enzymatic protocol comprising a partial acidic hydrolysis followed by an enzymatic treatment with the β-glycosidase from Periplaneta americana allowed the efficient conversion of α-chaconine to solanidine. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Data on the sensory evaluation of potatoes (Solanum tuberosum) from different areas of Hokkaido, Japan, performed by untrained young adults.

    Science.gov (United States)

    Sato, Hiroaki; Koizumi, Ryosuke; Nakazawa, Yozo; Yamazaki, Masao; Itoyama, Ryuichi; Ichisawa, Megumi; Negishi, Junko; Sakuma, Rui; Furusho, Tadasu; Sagane, Yoshimasa; Takano, Katsumi

    2017-12-01

    This data article describes a sensory evaluation of potatoes used in food processing from the Tokachi, Kamikawa, and Abashiri geographic areas of Hokkaido, Japan, performed by untrained young adults. We gathered sensory data on potatoes from the four cultivars 'Toyoshiro,' 'Kitahime,' 'Snowden,' and 'Poroshiri.' The sensory evaluation was performed on steamed potatoes from each cultivar; these potatoes were harvested from each of the three geographic areas. Table 1 provides the data from the evaluation of the five basic tastes (sweet, salty, sour, bitter, and umami), as well as the evaluation of the egumi taste, which is a Japanese term indicating a taste that is acrid, astringent, and slightly bitter.

  16. The relationship between sap flow and commercial soil water sensor readings in irrigated potato (Solanum tuberosum L.) production

    Science.gov (United States)

    Many irrigation scheduling methods utilized in commercial production settings rely on soil water sensors that are normally purchased as off-the-shelf technology or through contracted services that install and monitor readings throughout the season. These systems often assume a direct relationship be...

  17. The combined effect of CO2 and ethylene sprout inhibitor on the fry colour of stored potatoes (Solanum tuberosum L.)

    NARCIS (Netherlands)

    Daniels-Lake, B.J.

    2013-01-01

    Recently, it has been shown that the darkening of potato processing colour attributable to a trace concentration of ethylene gas is more severe when CO2 is also elevated. In view of the increasing use of ethylene gas for sprout suppression in potato storage facilities, it was considered important to

  18. Development of technique on the induction and selection of in vitro mutant lines(Potato, Solanum tuberosum L.)

    International Nuclear Information System (INIS)

    Hong, Joo Bong; Lee, Young Il; Song, Hee Sup; Kim, Jae Sung; Byun, Myung Woo; Lee, Young Keun; Shin, In Chul; Lee, Sang Jae; Lee, Ki Woon; Lim, Yong Taek

    1992-08-01

    The radiosensitivity and salt resistance on the single cell and callus of potato, mass production method of plantlet and microtuber of potato by in vitro culture and microtuber formation from the stem irradiated with radiation were investigated to obtain a optimum condition for selection of mutant cell line. (Author)

  19. The effect of mineral fertilization on fungi colonizing potato (Solanum tuberosum L. tubers after harvest and after storage

    Directory of Open Access Journals (Sweden)

    Bożena Cwalina-Ambroziak

    2012-12-01

    Full Text Available The paper presents the results of a three-year exact experiment conducted in Bałcyny, in which a late potato cultivar, Jasia, was grown. The objective of the study was to determine the effect of different levels of mineral fertilization: A (N 80 kg × ha-1 P 80 kg × ha-1 K120 kg × ha-1 and B (N 120 kg × ha-1 P 144 kg × ha-1 K156 kg × ha-1, and foliar fertilization (Basfoliar 12-4-6, ADOB Mn and Solubor DF on the quantitative and qualitative composition of fungal populations colonizing potato tubers. Fungi were isolated immediately after harvest and after a five-month storage period. After seven days of incubation, fungal colonies were transferred onto agar slants for microscopic identification. Over the entire experimental period, more pathogenic fungi were obtained from potato tubers analyzed after storage (62.9% of the total fungal population after storage than from those analyzed immediately after harvest (39.1%, and the greatest number of fungi was reported in 2004. Rhizoctonia solani was isolated most frequently, followed by Colletotrichum coccodes and Alternaria alternata. Pathogens of the genus Fusarium and the species Helminthosporium solani were not numerous. In the treatment A with soil mineral fertilization with lower NPK rates, larger numbers of pathogenic fungi were noted in 2004 after harvest and after five-month storage, and in 2005 after harvest. At the remaining dates of analysis, pathogens were more frequently isolated from potato tubers in experimental variant B with higher NPK rates. Immediately after harvest, the highest number of pathogenic fungi was isolated in the treatment with foliar application of ADOB Mn and Basfoliar 12-4-6. After five-month storage, pathogens most often colonized potato tubers in experimental variant B with foliar application of Solubor DF, Solubor DF and ADOB Mn, and in experimental variant A with a combination of fertilizers. In the other fertilization variants, including in the control treatment, the population size of pathogenic agents remained at a similar level.

  20. Yield and Nitrogen Assimilation of Potato Varieties (Solanum tuberosum L.) as Affected by Saline Water Irrigation and Organic Manure

    International Nuclear Information System (INIS)

    Hamdy, A.; Gadalla, A.M.; El-Kholi, A.F.; Galal, Y.G.M.; Ismail, M.M.

    2008-01-01

    The experiment was carried out in lysimeter under controlled greenhouse conditions. Saline water was applied in different levels, i.e. fresh water, 3 and 6 dS/m. Organic manure were applied to soil at rates of 0, 2.6 and 5.2 kg/m2. Basal recommended doses of P and K were applied. Labelled urea (10% a.e.) was applied at rate of 200 kg N/ha. 15 N technique was used to evaluate N-uptake and fertilizer efficiency. Comparison held between the two potato varieties indicated that higher reduction in shoot dry weight was recorded with Nicola variety than Spunta one which irrigated with 6 dS/m water salinity level. Addition of 2.6 kg/m 2 organic rate induced an increase in N uptake with fresh water and 3 dS/m salinity then tended to decrease with 6 dS/m level as compared to the untreated control. Concerning the nitrogen fertilization, data of 15 N analysis showed that, water salinity levels combined with organic addition rates were frequently affected the nitrogen derived from fertilizer and consequently the fertilizer use efficiency. Most of nitrogen was derived from the applied nitrogen fertilizer with maximum accumulation in tuber rather than shoots or roots of both potato varieties. Gradual increase of tuber starch with increasing salinity levels was noticed with addition of 2.6 kg/m 2 of organic matter. In general, Spunta variety showed some superiority in tuber starch over those of Nicola variety tuber

  1. Variations observed in the respiratory activity of potato tubers (Solanum tuberosum L.) after a treatment with gamma radiation

    International Nuclear Information System (INIS)

    Mazon Matanzo, M.P.; Fernandez Gonzalez, J.

    1976-01-01

    The variations in the respiratory activity of irradiated and IPC treated potato tubers during a storage period of five months have been studied. By immediate effect of gamma radiation, an increase in the oxigen consumption of the parenchyma in relation with the control tubers has been observed. Such increase persits even four months after gamma radiation. The respiratory activity is reduced in the IPC treated tubers. In the tissues cultivated ''in vitro'' the respiratory activity increases at the end of the cultivation period, not only in the control tissues but also in the irradiated ones, though this increase is greater in the control tissues.(author) [es

  2. Phenolic compounds with antioxidant capacity of the native Andean potato ( Solanum tuberosum L. Huagalina variety in La Libertad - Peru

    Directory of Open Access Journals (Sweden)

    Carmen Rojas-Padilla

    2016-01-01

    Full Text Available Potato is grown and consumed throughout the world for their particular calori fi c nutritional value and vitamin C, but it also contai ns phytochemicals (secondary metabolites that have been studied and found to have positive effects in preventing degenerative diseases in human health, such as hypertensive activity , and also atherosclerosis , type 2 diabetes, liver fibrosis, Alzheimer's d isease, macular degeneration and cancer. We aimed to identify and quantify p henolic compounds in potatoes grown on El Zuro (EZ and Huayatan Alto (HA in Santiago de Chuco, La Libertad, Peru. The field trials were carried out in EZ (altitude 3750 m.a.s.l. and HA (altitude 3150 m.a.s.l. employing organic and inorganic fertilization respectively. Ext raction from the peel and flesh was obtained separately , with the following solution: 50% methanol, 50% deionized water and 0.5% acetic acid. The sample was inj ected into the system UPLC - MS / MS, using ESI ionization ( Electrospray Ionization and fifteen external reference standards. Thirteen metabolites were detected in the flesh and potato peel. The highest content of secondary metabolites (mg/100 g DW were: Chlorogenic acid (476.82 ± 63.58, neochlorogenic acid (87.90 ± 19.42 caffeic acid (77.53 ± 14.49 and vanillin (11.52 ± 1.38. The PCA ( Principal Components Analysis scores show that the highest concentration of metabolites was found in the peel of bot h cultivars. We concluded that the native potato Huagalina contains the genes expressed in different biosynthetic pathways of the metabolites found in this study .

  3. Quality evaluation of stiff porridges prepared from Irish potato (Solanum tuberosum) and pigeon pea (Cajanus cajan) starch blends.

    Science.gov (United States)

    Abu, Joseph Oneh; Enyinnaya, Chinma Chiemela; James, Samaila; Okeleke, Ezinne

    2012-06-01

    Quality attributes of stiff porridges prepared from Irish potato and pigeon pea starch blends were studied. Starches were extracted from Irish potato and pigeon pea using a wet extraction method. Various ratios of the starches were mixed and analyzed for chemical, functional and pasting properties. The starch blends were then prepared into stiff porridges for sensory evaluation using a 20-man sensory panel. Substitution of Irish potato starch with pigeon pea starch led to increases in protein (0.15 to 1.2%), fat (0.26 to 0.56%) and ash (0.30 to 0.69%) while the amylose content of the starch blends decreased (from 23.8 to 18.4%) respectively. Functional properties such as bulk density (0.75 to 0.60 g/cm(3)), water absorption capacity (3.1 to 2.6 g water/ g sample) and dispersibility (58.6 to 42.7%) decreased significantly (P pigeon pea starch respectively. Pasting properties such as peak, breakdown, final and setback viscosities increased with increasing levels of pigeon pea starch while peak time and pasting temperature decreased. The sensory attributes of stiff porridges were not adversely affected by pigeon pea starch inclusion. Therefore it should be possible to incorporate up to 50% of low digestible pigeon pea starch into Irish potato starch from legumes such as pigeon pea as alternatives to cassava starch in the preparation of stiff porridges. Such porridges made from Irish potato and legume starches could provide additional incentive for individuals requiring decreased and or slow starch digestibility such as diabetics.

  4. Combined Amendments of Nano-hydroxyapatite Immobilized Cadmium in Contaminated Soil-Potato (Solanum tuberosum L.) System.

    Science.gov (United States)

    Liu, Chang; Wang, Lei; Yin, Jiang; Qi, Lipan; Feng, Yan

    2018-04-01

    The toxicity of cadmium (Cd) has posed major public health concern in crops grown in the Cd-contaminated soils. The effects of five amendments, nano-hydroxyapatite (n-HA) and it combined with lime, zeolite, bone mill and fly ash on Cd immobilization in soils and uptake in potatoes, were investigated in a contaminated soil by pot experiments. The result showed that the applications of combined amendments significantly decreased the bioavailable Cd concentrations extracted by TCLP, DTPA-TEA and MgCl 2 in the contaminated soils, and changed the soluble and exchangeable and specifically sorbed fractions to oxide-bound and organic-bound fractions. Compared to the control group, the concentrations of Cd in the potato tubers grown in n-HA, n-HA + Fly ash, n-HA + Lime, n-HA + Bone mill and n-HA + Zeolite soil were reduced 17.4%, 20.7%, 15.2%, 32.6% and 39.1%, respectively. Nano-hydroxyapatite combined amendments was more effective in reducing bioavailable Cd concentrations and Cd accumulations in potatoes, especially for n-HA + Z.

  5. In-season heat stress compromises postharvest quality and low-temperature sweetening resistance in potato (Solanum tuberosum L.).

    Science.gov (United States)

    Zommick, Daniel H; Knowles, Lisa O; Pavek, Mark J; Knowles, N Richard

    2014-06-01

    The effects of soil temperature during tuber development on physiological processes affecting retention of postharvest quality in low-temperature sweetening (LTS) resistant and susceptible potato cultivars were investigated. 'Premier Russet' (LTS resistant), AO02183-2 (LTS resistant) and 'Ranger Russet' (LTS susceptible) tubers were grown at 16 (ambient), 23 and 29 °C during bulking (111-164 DAP) and maturation (151-180 DAP). Bulking at 29 °C virtually eliminated yield despite vigorous vine growth. Tuber specific gravity decreased as soil temperature increased during bulking, but was not affected by temperature during maturation. Bulking at 23 °C and maturation at 29 °C induced higher reducing sugar levels in the proximal (basal) ends of tubers, resulting in non-uniform fry color at harvest, and abolished the LTS-resistant phenotype of 'Premier Russet' tubers. AO02183-2 tubers were more tolerant of heat for retention of LTS resistance. Higher bulking and maturation temperatures also accelerated LTS and loss of process quality of 'Ranger Russet' tubers, consistent with increased invertase and lower invertase inhibitor activities. During LTS, tuber respiration fell rapidly to a minimum as temperature decreased from 9 to 4 °C, followed by an increase to a maximum as tubers acclimated to 4 °C; respiration then declined over the remaining storage period. The magnitude of this cold-induced acclimation response correlated directly with the extent of buildup in sugars over the 24-day LTS period and thus reflected the effects of in-season heat stress on propensity of tubers to sweeten and lose process quality at 4 °C. While morphologically indistinguishable from control tubers, tubers grown at elevated temperature had different basal metabolic (respiration) rates at harvest and during cold acclimation, reduced dormancy during storage, greater increases in sucrose and reducing sugars and associated loss of process quality during LTS, and reduced ability to improve process quality through reconditioning. Breeding for retention of postharvest quality and LTS resistance should consider strategies for incorporating more robust tolerance to in-season heat stress.

  6. Influence of low dose γ radiation on the dormancy, growth and physiological activity of seed potato (solanum tuberosum L.)

    International Nuclear Information System (INIS)

    Kim, J. S.; Lee, Y. K.; Lee, H. Y.; Baek, M. H.; Yoo, Z. C.

    2002-01-01

    To observe the stimulating effect of low dose γ radiation on the dormancy breaking and growth of potato with different storage duration and conditions, potato were irradiated with the dose of 1 ∼ 16 Gy. Though varied with storage duration and conditions, sprouting rate of potato stored at 5 .deg. C in the dark was promoted at the 8 and 16 Gy irradiation group compared to 20 .deg. C in the light. The field growth of potato stored at 5 .deg. C in the dark was highly increased at the 2, 4, 8 Gy irradiation group. The CAT activity of potato was increased by about 20% at 1,8 and 16 Gy irradiation group. POD activity was also increased by 7 ∼ 16% at 1, 8 and 16 Gy irradiation group compared to the control. Fv/Fm was not changed by the low dose γ radiation. However, the effective quantum yield of PSII was slightly increased by about 12% at 1 and 16 Gy irradiation group. Seedling irradiated with low dose γ radiation showed the lower excitation pressure on PSII (1- q P), while NPQ was greatly increased by 45% at 4 Gy irradiation group. These results clearly showed the positive effect of low dose γ radiation on the seedling growth of potato via increasing photoprotective capacities of photosynthetic apparatus

  7. Chlorogenic acid, anthocyanin and flavan-3-ol biosynthesis in flesh and skin of Andean potato tubers (Solanum tuberosum subsp. andigena).

    Science.gov (United States)

    Valiñas, Matías Ariel; Lanteri, María Luciana; Ten Have, Arjen; Andreu, Adriana Balbina

    2017-08-15

    Natural variation of Andean potato was used to study the biosynthesis of phenolic compounds. Levels of phenolic compounds and corresponding structural gene transcripts were examined in flesh and skin of tubers. Phenolic acids, mainly chlorogenic acid (CGA), represent the major compounds, followed by anthocyanins and flavan-3-ols. High-anthocyanin varieties have high levels of CGA. Both metabolite and transcript levels were higher in skin than in flesh and showed a good correspondence. Two hydroxycinnamoyl-CoA transferases (HCT/HQT) have been involved in CGA production, of which HCT reflects CGA levels. Catechin was found in pigmented tissues whereas epicatechin was restricted to tuber skin. Transcripts of leucoanthocyanidin reductase (LCR), which generates catechin, could not be detected. Anthocyanidin reductase (ANR) transcripts, the enzyme responsible for epicatechin production, showed similar levels among samples. These data suggest that the biosynthesis of flavan-3-ols in potato tuber would require ANR but not LCR and that an epimerization process is involved. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Mapping Loci That Control Tuber and Foliar Symptoms Caused by PVY in Autotetraploid Potato (Solanum tuberosum L.).

    Science.gov (United States)

    da Silva, Washington L; Ingram, Jason; Hackett, Christine A; Coombs, Joseph J; Douches, David; Bryan, Glenn J; De Jong, Walter; Gray, Stewart

    2017-11-06

    Potato tuber necrotic ringspot disease (PTNRD) is a tuber deformity associated with infection by the tuber necrotic strain of Potato virus Y (PVY NTN ). PTNRD negatively impacts tuber quality and marketability, and poses a serious threat to seed and commercial potato production worldwide. PVY NTN symptoms differ in the cultivars Waneta and Pike: Waneta expresses severe PTNRD and foliar mosaic with vein and leaf necrosis, whereas Pike does not express PTNRD and mosaic is the only foliar symptom. To map loci that influence tuber and foliar symptoms, 236 F 1 progeny of a cross between Waneta and Pike were inoculated with PVY NTN isolate NY090029 and genotyped using 12,808 potato SNPs. Foliar symptom type and severity were monitored for 10 wk, while tubers were evaluated for PTNRD expression at harvest and again after 60 d in storage. Pairwise correlation analyses indicate a strong association between PTNRD and vein necrosis (τ = 0.4195). QTL analyses revealed major-effect QTL on chromosomes 4 and 5 for mosaic, 4 for PTNRD, and 5 for foliar necrosis symptoms. Locating QTL associated with PVY-related symptoms provides a foundation for breeders to develop markers that can be used to eliminate potato clones with undesirable phenotypes, e.g. , those likely to develop PTNRD or to be symptomless carriers of PVY. Copyright © 2017 Silva et al.

  9. Comparative shoot proteome analysis of two potato (Solanum tuberosum L.) genotypes contrasting in nitrogen deficiency responses in vitro.

    Science.gov (United States)

    Meise, Philipp; Jozefowicz, Anna Maria; Uptmoor, Ralf; Mock, Hans-Peter; Ordon, Frank; Schum, Annegret

    2017-08-23

    Aiming at a better understanding of the physiological and biochemical background of nitrogen use efficiency, alterations in the shoot proteome under N-deficiency were investigated in two contrasting potato genotypes grown in vitro with 60 and 7.5mM N, respectively. A gel based proteomic approach was applied to identify candidate proteins associated with genotype specific responses to N-deficiency. 21% of the detected proteins differed in abundance between the two genotypes. Between control and N-deficiency conditions 19.5% were differentially accumulated in the sensitive and 15% in the tolerant genotype. 93% of the highly N-deficiency responsive proteins were identified by MALDI TOF/TOF mass spectrometry. The major part was associated with photosynthesis, carbohydrate metabolism, stress response and regulation. Differential accumulation of enzymes involved in the Calvin cycle and glycolysis suggest activation of alternative carbohydrate pathways. In the tolerant genotype, increased abundance under N-deficiency was also found for enzymes involved in chlorophyll synthesis and stability of enzymes, which increase photosynthetic carbon fixation efficiency. Out of a total of 106 differentially abundant proteins, only eight were detected in both genotypes. Our findings suggest that mutually responsive proteins reflect universal stress responses while adaptation to N-deficiency in metabolic pathways is more genotype specific. Nitrogen losses from arable farm land considerably contribute to environmental pollution. In potato, this is a special problem due cultivation on light soils, irrigation and the shallow root system. Therefore, breeding of cultivars with improved nitrogen use efficiency and stable yields under reduced N fertilization is an important issue. Knowledge of genotype dependent adaptation to N-deficiency at the proteome level can help to understand regulation of N efficiency and development of N-efficient cultivars. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. PHYTOSOCIOLOGY OF WEEDS AFTER POTATO CULTIVATION (Solanum tuberosum L. IN THE VENEZUELAN ANDES:AN AGROECOLOGICAL APPROACH

    Directory of Open Access Journals (Sweden)

    Pedro Manuel Villa

    2017-08-01

    Full Text Available Weeds represent one problem for potato cultivation in the Venezuelan Andes; however ecological studies to improve their management are limited. This study has aimed to carry out a phytosociological survey of weed community after potato cultivation in Mérida, Mérida state, Venezuela. The experiment was carried out under a completely randomized design with 20 plots (2x2 m. The weeds surveys were conducted at two month intervals, randomly selecting five plots per session during June 2006 and February 2007, to 60 days after cultivation (DDC, 120, 180, and 240 DDC. The phytosociological survey was performed involving identification and quantification of numbers of individuals the weeds in each plot. After were estimated of phytosociological parameters such as density, frequency, abundance to calculate the importance value index. A multivariate non-metric multidimensional scaling (NMDS was performed using species abundances; also was used the unweighted pair group method with arithmetic mean (UPGMA with presence absence data. Seventeen families, 32 genera and 35 species of weeds were identified, with the Asteraceae, Fabaceae and Poaceae families showed higher importance within the community. The most important species in the all stages were Pennisetum clandestinum, Paspalum decumbens, Desmodium adscendens, Aldama dentata, Borreria laevis, and Jaegeria hirta. Significant differences in phytosociological parameters were observed among weed species at each stage and among the different stages after potato cultivation.

  11. CCD-Based Skinning Injury Recognition on Potato Tubers (Solanum tuberosum L.): A Comparison between Visible and Biospeckle Imaging.

    Science.gov (United States)

    Gao, Yingwang; Geng, Jinfeng; Rao, Xiuqin; Ying, Yibin

    2016-10-18

    Skinning injury on potato tubers is a kind of superficial wound that is generally inflicted by mechanical forces during harvest and postharvest handling operations. Though skinning injury is pervasive and obstructive, its detection is very limited. This study attempted to identify injured skin using two CCD (Charge Coupled Device) sensor-based machine vision technologies, i.e., visible imaging and biospeckle imaging. The identification of skinning injury was realized via exploiting features extracted from varied ROIs (Region of Interests). The features extracted from visible images were pixel-wise color and texture features, while region-wise BA (Biospeckle Activity) was calculated from biospeckle imaging. In addition, the calculation of BA using varied numbers of speckle patterns were compared. Finally, extracted features were implemented into classifiers of LS-SVM (Least Square Support Vector Machine) and BLR (Binary Logistic Regression), respectively. Results showed that color features performed better than texture features in classifying sound skin and injured skin, especially for injured skin stored no less than 1 day, with the average classification accuracy of 90%. Image capturing and processing efficiency can be speeded up in biospeckle imaging, with captured 512 frames reduced to 125 frames. Classification results obtained based on the feature of BA were acceptable for early skinning injury stored within 1 day, with the accuracy of 88.10%. It is concluded that skinning injury can be recognized by visible and biospeckle imaging during different stages. Visible imaging has the aptitude in recognizing stale skinning injury, while fresh injury can be discriminated by biospeckle imaging.

  12. Transcriptomics of the interaction between the monopartite phloem-limited geminivirus tomato yellow leaf curl Sardinia virus and Solanum lycopersicum highlights a role for plant hormones, autophagy and plant immune system fine tuning during infection.

    Directory of Open Access Journals (Sweden)

    Laura Miozzi

    Full Text Available Tomato yellow leaf curl Sardinia virus (TYLCSV, a DNA virus belonging to the genus Begomovirus, causes severe losses in tomato crops. It infects only a limited number of cells in the vascular tissues, making difficult to detect changes in host gene expression linked to its presence. Here we present the first microarray study of transcriptional changes induced by the phloem-limited geminivirus TYLCSV infecting tomato, its natural host. The analysis was performed on the midrib of mature leaves, a material naturally enriched in vascular tissues. A total of 2206 genes were up-regulated and 1398 were down-regulated in infected plants, with an overrepresentation of genes involved in hormone metabolism and responses, nucleic acid metabolism, regulation of transcription, ubiquitin-proteasome pathway and autophagy among those up-regulated, and in primary and secondary metabolism, phosphorylation, transcription and methylation-dependent chromatin silencing among those down-regulated. Our analysis showed a series of responses, such as the induction of GA- and ABA-responsive genes, the activation of the autophagic process and the fine tuning of the plant immune system, observed only in TYLCSV-tomato compatible interaction so far. On the other hand, comparisons with transcriptional changes observed in other geminivirus-plant interactions highlighted common host responses consisting in the deregulation of biotic stress responsive genes, key enzymes in the ethylene biosynthesis and methylation cycle, components of the ubiquitin proteasome system and DNA polymerases II. The involvement of conserved miRNAs and of solanaceous- and tomato-specific miRNAs in geminivirus infection, investigated by integrating differential gene expression data with miRNA targeting data, is discussed.

  13. Phytonutrient analysis of Solanum sisymbriifolium Lam. berries

    Science.gov (United States)

    Solanum sisymbriifolium Lam. (Litchi tomato) is grown ornamentally, and in Europe it is used as a trap crop for management of the potato cyst nematode (PCN). Its berries are edible, but little is known about their nutritional content. If more was known about their nutritional value this could provid...

  14. Mechanism and control of Solanum lycocarpum

    NARCIS (Netherlands)

    Pinto, L.V.A.; Silva, Da E.A.A.; Davide, A.C.; Mendes de Jesus, V.A.; Toorop, P.E.; Hilhorst, H.W.M.

    2007-01-01

    Background Solanaceae seed morphology and physiology have been widely studied but mainly in domesticated crops. The present study aimed to compare the seed morphology and the physiology of germination of Solanum lycocarpum, an important species native to the Brazilian Cerrado, with two species with

  15. Molecular Characterization of a Trisegmented Mycovirus from the Plant Pathogenic Fungus Colletotrichum gloeosporioides

    Directory of Open Access Journals (Sweden)

    Jie Zhong

    2016-09-01

    Full Text Available A novel double-stranded RNA (dsRNA mycovirus, consisting of three dsRNA genome segments and possibly belonging to the family Chrysoviridae, was isolated from the filamentous phytopathogenic fungus Colletotrichum gloeosporioides and designated as Colletotrichum gloeosprioides chrysovirus 1 (CgCV1. The three dsRNAs of the CgCV1 genome with lengths of 3397, 2869, and 2630 bp (dsRNAs1–3 were found to contain a single open reading frame (ORF putatively encoding the RNA-dependent RNA polymerase (RdRp, a capsid protein, and a protease, respectively, all of which exhibited some degree of sequence similarity to the comparable putative proteins encoded by the genus Chrysovirus. The 5′- and 3′-untranslated regions in each dsRNA segment contained similar sequences that were strictly conserved at the termini. Moreover, isometric virus-like particles (VLPs with a diameter of approximately 40 nm were extracted from fungal mycelia. Phylogenetic analysis based on the conserved dsRNA1-encoded RdRp showed that CgCV1 is a new virus belonging to the Chrysoviridae family. BLAST analysis revealed the presence of CgCV1-like sequences in the chromosomes of Medicago truncatula and Solanum tuberosum. Moreover, some sequences in the transcriptome shotgun assembly (TSA library and expressed sequence tag database (ESTdb of other eudicot and monocot plants were also found to be related to CgCV1.

  16. Protein (Viridiplantae): 816753 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available e Solanum tuberosum MIDEVKEEWPETPSFLNPETPNSQNPETPTFSNPESPTFSKSETPTFSMPETPTFSKPETPSFSKPETPSFSKPET...PSSQKLEASTFSKTETPTFSKLETPSFSKLETPISPNPETPTFSKPKTPSFSKPEIPSFSKPKTPSFSKSETPTLSKPETPSSPKPETPNSPKIEAPSFSKPETPSFSKPET...PTFSNPETLSSPKSETLTFQKPEIPSSPKLETQSSSKPETPSFSKPETPTFSKSKTPSSSKPEMPSSPKPETPSFSKPEILTFSKPKTPSFSKPETPSFSKPETPSFSRPET...PSFSNPETPSSSKPEPETLSSPKPKTPSSAKLETPSFSKLETPSFSKPETPSSLKPETPSFSKPET...PSSPNPKTPSSPKSETPSFSKPKTPSFSKPETPSSSKLETPNFLKPETPSSLKLEAPPTFLKPETSSSTKPKTPSFSTPETPTFSKPETPTFSKSETPSFSKSETPSSFKPETPSFSKPETPSSPKFETPSSPKPETPSSPKT

  17. Protein (Viridiplantae): 816755 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available e Solanum tuberosum MAQHYKLSSILLLAFIYFIHDHMITTITARRILQTPSFSTPTTPSFSMPTTPSFSKSPGVSKPASPSFSNSPSLSKPET...PSFSKSETLSFSKPETPSFSTSETPSFSKPETPSFSKPETPSFSKPEIPSFSKPETPSSPRLETPIFIKPETPTFSKPETPTFSKPKTPSLLKPETPSSQKPETPTFSKPET...PIFSKSETHSFSKPETPTSPNPETPTFSKPETPSSPKPETPSFSKPETSSFSKPETPTFSKPETPSSPKSETPSFSKPETPTFSKPET...PSSPKSETPTFPKPKIPSSLKPETPSSPNLETPSFLKPETPIFSKPETPSFSKPEMPSSTKPETPIPQSPRPLLSQSLKSQILQTPRPQLETSSFSKPET...PSFSKPETPSSSKPEAPSSPTPEMQSFTKPETPSFSKPETPNSPKPETPSFPKPETSTFSKPQTSNSPKSETSSSPKPETSSFSKSETPSFSKPEMPSSPTPETPNFSKPET

  18. Enhanced salt stress tolerance in transgenic potato plants expressing IbMYB1, a sweet potato transcription factor.

    Science.gov (United States)

    Cheng, Yu-Jie; Kim, Myoung-Duck; Deng, Xi-Ping; Kwak, Sang-Soo; Chen, Wei

    2013-12-01

    IbMYB1, a transcription factor (TF) for R2R3-type MYB TFs, is a key regulator of anthocyanin biosynthesis during storage of sweet potatoes. Anthocyanins provide important antioxidants of nutritional value to humans, and also protect plants from oxidative stress. This study aimed to increase transgenic potatoes' (Solanum tuberosum cv. LongShu No.3) tolerance to environmental stress and enhance their nutritional value. Transgenic potato plants expressing IbMYB1 genes under the control of an oxidative stress-inducible peroxidase (SWPA2) promoter (referred to as SM plants) were successfully generated through Agrobacterium-mediated transformation. Two representative transgenic SM5 and SM12 lines were evaluated for enhanced tolerance to salinity, UV-B rays, and drought conditions. Following treatment of 100 mM NaCl, seedlings of SM5 and SM12 lines showed less root damage and more shoot growth than control lines expressing only an empty vector. Transgenic potato plants in pots treated with 400 mM NaCl showed high amounts of secondary metabolites, including phenols, anthocyanins, and flavonoids, compared with control plants. After treatment of 400 mM NaCl, transgenic potato plants also showed high DDPH radical scavenging activity and high PS II photochemical efficiency compared with the control line. Furthermore, following treatment of NaCl, UV-B, and drought stress, the expression levels of IbMYB1 and several structural genes in the flavonoid biosynthesis such as CHS, DFR, and ANS in transgenic plants were found to be correlated with plant phenotype. The results suggest that enhanced IbMYB1 expression affects secondary metabolism, which leads to improved tolerance ability in transgenic potatoes.

  19. First report of Potato virus V and Peru tomato mosaic virus on tamarillo (Solanum betaceum) orchards of Ecuador

    Science.gov (United States)

    In Ecuador, tamarillo (Solanum betaceum) represents an important cash crop for hundreds of small farmers. In 2013, leaves from tamarillo plants showing severe virus-like symptoms (mosaic, mottling and leaf deformation) were collected from old orchards in Pichincha and Tungurahua. Double-stranded RN...

  20. Effects of recurrent irradiation and cross fertilization on improvement of cultivated tomato (Solanum lycopersicon L.) and wild tomato (Solanum pimpinellifolium L.)

    International Nuclear Information System (INIS)

    Nunoo, J.

    2010-01-01

    Two separate experiments were conducted to determine the effects of recurrent irradiation and cross fertilization on the improvement of fruit quality and plant architecture of two tomato species (Solanum lycopersicon L.) and (Solanum pimpinellifolium L.) in Ghana. In the first experiment, a variant line of the wild tomato (Solanum pimpinellifolium L.) (SP 300/30.4.2.4) previously obtained through irradiation with gamma rays at 300 Gy was re-irradiated with gamma rays at 150 Gy and 300 Gy using gamma irradiation. The second experiment involved hybridization of the same variant line (SP 300/30.4.2.4) with five cultivars of the cultivated tomato (Solanum lycopersicon L). Progeny were assessed in both M1 and M2 generations for the first experiment but only at the F 2 generation for the second experiment. Significant variations were observed in number of days to first flowering and 50% fruiting. Fruit size increased from 1.36 g and 1.67 g to 1.77 g and 2.66 g in the M 1 and M 2 generations respectively following re-irradiation at 300 Gy. Three 150 Gy treated plants at the M 1 generation and two 300 Gy treated plants at the M 2 generations exhibited erect growth habit compared to the parental line (SP 300/30.4.2.4) which was sprawling. A variant line among the 300 Gy treated plants had a fused fruit of fruit weight of 3.57 g with four locules. Also, hybridization involving five cultivars of the cultivated tomato (S. lycopersicon L.) as female parents and the variant line (SP 300/30.4.2.4) generated variability in several traits including plant architecture, days to flowering and fruiting, fruit weight and number of seeds per fruit in the F 2 generation. Variations in style-length, number of locules, fruit shape and colour were also observed among the plants in the F 2 generation. Generally, significant improvements were obtained with respect to plant architecture (that is reduced plant height), earliness and fruit quality (that is fruit size and colour). Although no

  1. Extrafloral nectar secretion from wounds of Solanum dulcamara.

    Science.gov (United States)

    Lortzing, Tobias; Calf, Onno W; Böhlke, Marlene; Schwachtje, Jens; Kopka, Joachim; Geuß, Daniel; Kosanke, Susanne; van Dam, Nicole M; Steppuhn, Anke

    2016-04-25

    Plants usually close wounds rapidly to prevent infections and the loss of valuable resources such as assimilates(1). However, herbivore-inflicted wounds on the bittersweet nightshade Solanum dulcamara appear not to close completely and produce sugary wound secretions visible as droplets. Many plants across the plant kingdom secrete sugary nectar from extrafloral nectaries(2) to attract natural enemies of herbivores for indirect defence(3,4). As ants forage on wound edges of S. dulcamara in the field, we hypothesized that wound secretions are a form of extrafloral nectar (EFN). We show that, unlike EFN from known nectaries, wound secretions are neither associated with any specific structure nor restricted to certain locations. However, similar to EFN, they are jasmonate-inducible and the plant controls their chemical composition. Wound secretions are attractive for ants, and application of wound secretion mimics increases ant attraction and reduces herbivory on S. dulcamara plants in a natural population. In greenhouse experiments, we reveal that ants can defend S. dulcamara from two of its native herbivores, slugs and flea beetle larvae. Since nectar is defined by its ecological function as a sugary secretion involved in interactions with animals(5), such 'plant bleeding' could be a primitive mode of nectar secretion exemplifying an evolutionary origin of structured extrafloral nectaries.

  2. Plant Regeneration and Genetic Transformation in Eggplant ...

    African Journals Online (AJOL)

    Dr Harmander Gill

    2014-02-05

    Feb 5, 2014 ... Review. Plant regeneration in eggplant (Solanum melongena L.): A review ... and development of somatic hybrids, efficient plant regeneration ... was first reported in eggplant from immature seed embryos .... Hormone free MS.

  3. Chemical constituents of Solanum buddleifolium Sendtn

    International Nuclear Information System (INIS)

    Pinto, Francisco das Chagas L.; Torres, Maria da conceicao M.; Silveira, Edilberto R.; Pessoa, Otilia Deusdenia L.; Braz-Filho, Raimundo; Guedes, Maria Lenise da Silva

    2013-01-01

    The chemical investigation of the stem EtOH extract of S. buddleifolium resulted in the isolation of terpenoids, amides, lignans and a steroidal alkaloid. Based on HRMS, IR and 1 H and 13 C NMR data analysis, the structures of the isolated compounds were identified as: 13-hydroxysolavetivone, betulinic acid, N-trans-caffeoyltyramine, N-trans-feruloyldopamine, N-trans-p-cumaroyltyramine, N-trans-feruloyltyramine, N-trans-feruloyl- 3’-O-methoxydopamine, alangilignoside C, isolariciresinol, polistachiol, (+)-(8R,7’S,8’S)-3α-O-(β-D-glucopiranosyl)-lioniresinol, (-)-(8S,7’R,8’R)-3α-O-(β-D-glucopiranosyl)-lioniresinol and solamargine. The occurrence of terpenoids and amides is common in Solanum, unlike lignans which are rare. The isolated lignans described in this work are reported for the first time in the genus Solanum. (author)

  4. Comparative genetics of hybrid incompatibility: sterility in two Solanum species crosses.

    Science.gov (United States)

    Moyle, Leonie C; Nakazato, Takuya

    2008-07-01

    The genetic basis of hybrid sterility can provide insight into the genetic and evolutionary origins of species barriers. We examine the genetics of hybrid incompatibility between two diploid plant species in the plant clade Solanum sect. Lycopersicon. Using a set of near-isogenic lines (NILs) representing the wild species Solanum pennellii (formerly Lycopersicon pennellii) in the genetic background of the cultivated tomato S. lycopersicum (formerly L. esculentum), we found that hybrid pollen and seed infertility are each based on a modest number of loci, male (pollen) and other (seed) incompatibility factors are roughly comparable in number, and seed-infertility QTL act additively or recessively. These findings are remarkably consistent with our previous analysis in a different species pair, S. lycopersicum x S. habrochaites. Data from both studies contrast strongly with data from Drosophila. Finally, QTL for pollen and seed sterility from the two Solanum studies were chromosomally colocalized, indicating a shared evolutionary history for these QTL, a nonrandom genomic distribution of loci causing sterility, and/or a proclivity of certain genes to be involved in hybrid sterility. We show that comparative mapping data can delimit the probable timing of evolution of detected QTL and discern which sterility loci likely evolved earliest among species.

  5. Solanum americanum: reservoir for Potato virus Y and Cucumber mosaic virus in sweet pepper crops

    Directory of Open Access Journals (Sweden)

    Monika Fecury Moura

    2014-03-01

    Full Text Available Weeds can act as important reservoirs for viruses. Solanum americanum (Black nightshade is a common weed in Brazil and samples showing mosaic were collected from sweet pepper crops to verify the presence of viruses. One sample showed mixed infection between Cucumber mosaic virus (CMV and Potato virus Y (PVY and one sample showed simple infection by PVY. Both virus species were transmitted by plant extract and caused mosaic in tomato (Solanum lycopersicum cv. Santa Clara, sweet pepper (Capsicum annuum cv. Magda, Nicotiana benthamiana and N. tabaccum TNN, and local lesions on Chenopodium quinoa, C. murale and C. amaranticolor. The coat protein sequences for CMV and PVY found in S. americanum are phylogenetically more related to isolates from tomato. We conclude that S. americanum can act as a reservoir for different viruses during and between sweet pepper crop seasons.

  6. The combined use of Pochonia chlamydosporia and plant defence activators - a potential sustainable control strategy for Meloidogyne chitwoodi

    Directory of Open Access Journals (Sweden)

    Maria Clara VIEIRA DOS SANTOS

    2014-05-01

    Full Text Available Sustainable strategies are required for control of the root-knot nematode Meloidogyne chitwoodi to reduce dependence on toxic chemical pesticides. The efficacy of the nematophagous fungus Pochonia chlamydosporia in biocontrol could be enhanced by integration with control measures that reduce initial nematode infestations. The use of foliar sprays with plant defence activators can reduce the susceptibility of potato plants to M. chitwoodi. This study assessed effects of combined soil application of P. chlamydosporia with foliar sprays of benzothiadiazole (BTH or cis-jasmone on infection of potatoes by M. chitwoodi. Solanum tuberosum, cv. Désirée plants were grown in soil mixed with 5000 chlamydospores g-1 of soil, sprayed twice with BTH or cis-jasmone and inoculated with 300 M. chitwoodi second-stage juveniles. Forty-five days after inoculation, nematode reproduction, numbers of colony-forming units of the fungus g-1 of soil and g-1 of root, and egg parasitism were assessed by standard techniques. Foliar sprays of BTH or cis-jasmone combined with the fungus reduced nematode reproduction (P<0.05, LSD. The presence of the fungus slightly increased the efficacy of cis-jasmone, as the number of eggs per egg mass was less in plants treated both with cis-jasmone and the fungus than in the plants treated only with the defence activator. The proportion of parasitized eggs was greater in the cis-jasmone treatment where rhizosphere colonisation was less, suggesting that P. chlamydosporia became a poorer rhizosphere coloniser but a more efficient nematode parasite. The addition of P. chlamydosporia to soil in combination with application of inducers of plant defence could be an alternative control strategy to be used against M. chitwoodi in potato.

  7. Detection of new viruses in alfalfa, weeds and cultivated plants growing adjacent to alfalfa fields in Saudi Arabia.

    Science.gov (United States)

    Al-Shahwan, I M; Abdalla, O A; Al-Saleh, M A; Amer, M A

    2017-09-01

    A total of 1368 symptomatic plant samples showing different virus-like symptoms such as mottling, chlorosis, mosaic, yellow mosaic, vein clearing and stunting were collected from alfalfa, weed and cultivated plant species growing in vicinity of alfalfa fields in five principal regions of alfalfa production in Saudi Arabia. DAS-ELISA test indicated occurrence of 11 different viruses in these samples, 10 of which were detected for the first time in Saudi Arabia. Eighty percent of the alfalfa samples and 97.5% of the weed and cultivated plants samples were found to be infected with one or more of these viruses. Nine weed plant species were found to harbor these viruses namely, Sonchus oleraceus, Chenopodium spp., Hibiscus spp., Cichorium intybus , Convolvulus arvensis , Malva parviflora , Rubus fruticosus , Hippuris vulgaris , and Flaveria trinervia . These viruses were also detected in seven cultivated crop plants growing adjacent to the alfalfa fields including Vigna unguiculata , Solanum tuberosum , Solanum melongena , Phaseolus vulgaris , Cucurbita maxima , Capsicum annuum , and Vicia faba . The newly reported viruses together with their respective percent of detection in alfalfa, and in both weeds and cultivated crop plant species together were as follows: Bean leaf roll virus (BLRV) {12.5 and 4.5%}, Lucerne transient streak virus (LTSV) {2.9 and 3.5%}, Bean yellow mosaic virus (BYMV) {1.4 and 4.5%}, Bean common mosaic virus (BCMV) {1.2 and 4.5%}, Red clover vein mosaic virus (RCVMV) {1.2 and 4%}, White clover mosaic virus (WCIMV) {1.0 and 5%}, Cucumber mosaic virus (CMV) {0.8 and 3%}, Pea streak virus (PeSV) {0.4 and 4.5%} and Tobacco streak virus (TSV) {0.3 and 2.5%}. Alfalfa mosaic virus (AMV), the previously reported virus in alfalfa, had the highest percentage of detection in alfalfa accounting for 58.4% and 62.8% in the weeds and cultivated plants. Peanut stunt virus (PSV) was also detected for the first time in Saudi Arabia with a 66.7% of infection in 90

  8. Detection of new viruses in alfalfa, weeds and cultivated plants growing adjacent to alfalfa fields in Saudi Arabia

    Directory of Open Access Journals (Sweden)

    I.M. Al-Shahwan

    2017-09-01

    Full Text Available A total of 1368 symptomatic plant samples showing different virus-like symptoms such as mottling, chlorosis, mosaic, yellow mosaic, vein clearing and stunting were collected from alfalfa, weed and cultivated plant species growing in vicinity of alfalfa fields in five principal regions of alfalfa production in Saudi Arabia. DAS-ELISA test indicated occurrence of 11 different viruses in these samples, 10 of which were detected for the first time in Saudi Arabia. Eighty percent of the alfalfa samples and 97.5% of the weed and cultivated plants samples were found to be infected with one or more of these viruses. Nine weed plant species were found to harbor these viruses namely, Sonchus oleraceus, Chenopodium spp., Hibiscus spp., Cichorium intybus, Convolvulus arvensis, Malva parviflora, Rubus fruticosus, Hippuris vulgaris, and Flaveria trinervia. These viruses were also detected in seven cultivated crop plants growing adjacent to the alfalfa fields including Vigna unguiculata, Solanum tuberosum, Solanum melongena, Phaseolus vulgaris, Cucurbita maxima, Capsicum annuum, and Vicia faba. The newly reported viruses together with their respective percent of detection in alfalfa, and in both weeds and cultivated crop plant species together were as follows: Bean leaf roll virus (BLRV {12.5 and 4.5%}, Lucerne transient streak virus (LTSV {2.9 and 3.5%}, Bean yellow mosaic virus (BYMV {1.4 and 4.5%}, Bean common mosaic virus (BCMV {1.2 and 4.5%}, Red clover vein mosaic virus (RCVMV {1.2 and 4%}, White clover mosaic virus (WCIMV {1.0 and 5%}, Cucumber mosaic virus (CMV {0.8 and 3%}, Pea streak virus (PeSV {0.4 and 4.5%} and Tobacco streak virus (TSV {0.3 and 2.5%}. Alfalfa mosaic virus (AMV, the previously reported virus in alfalfa, had the highest percentage of detection in alfalfa accounting for 58.4% and 62.8% in the weeds and cultivated plants. Peanut stunt virus (PSV was also detected for the first time in Saudi Arabia with a 66.7% of infection in 90

  9. Fluoride-induced foliar injury in Solanum pseudo-capsicum: its induction in the dark and activation in the light

    Energy Technology Data Exchange (ETDEWEB)

    MacLean, D.C.; Schneider, R.C.; Weinstein, L.H.

    1982-09-01

    The differential responses of plants exposed to hydrogen fluoride (HF) in continuous light or darkness were investigated in Jerusalem cherry Solanum pseudo-capsicum L. Plants exposed to HF in the dark develop few, if any, foliar symptoms by the end of the exposure period, but severe foliar injury develops rapidly upon transfer to the light after exposure. The results suggest that light is required for the expression of responses induced by exposure to HF in the dark.

  10. Fluoride-induced foliar injury in Solanum pseudo-capsicum: its induction in the dark and activation in the light

    Energy Technology Data Exchange (ETDEWEB)

    MacLean, D.C.; Schneider, R.E.; Weinstein, L.H.

    1982-01-01

    The differential responses of plants exposed to hydrogen fluoride (HF) in continuous light or darkness were investigated in Jerusalem cherry Solanum pseudo-capsicum L. Plants exposed to HF in the dark develop few, if any, foliar symptoms by the end of the exposure period, but severe folia injury develops rapidly upon transfer to the light after exposure. The results suggest that light is required for the expression of responses induced by exposure to HF in the dark.

  11. The Effect of Shoot/Root Competition of Black night shade (Solanum nigrum on Growth and Seed Yield of Mung Bean (Vigna radiate L.

    Directory of Open Access Journals (Sweden)

    M Goldani

    2015-04-01

    Full Text Available In order to study the competition effects of Solanum nigrum on Vigna radiate yield, an additive experiment was conducts at Ferdowsi University of Mashhad experimental Greenhouse. The type of design was completely randomized block. Treatments included three density of Solanum nigrum (2, 4, and 6 plants m-2 and three types of competition (root, shoot and both of them planted at constant density of Vigna radiate plus weed free check in each block. The results indicated that competitions had significant effects (P

  12. Genetic diversity of the African hexaploid species Solanum scabrum Mill. and S. nigrum L. (Solanaceae)

    NARCIS (Netherlands)

    Manoko, M.L.K.; Berg, van den R.G.; Feron, R.M.C.; Weerden, van der G.M.; Mariani, C.

    2008-01-01

    Two hexaploid species of Solanum sect. Solanum are present in Africa: Solanum scabrum and S. nigrum. Solanum scabrum is a widely cultivated species and is used as a leafy vegetable, as a source of medicine and as a source of ink dye. In previous studies a wide range of morphological diversity has

  13. Composite potato plants with transgenic roots on non-transgenic shoots: a model system for studying gene silencing in roots.

    Science.gov (United States)

    Horn, Patricia; Santala, Johanna; Nielsen, Steen Lykke; Hühns, Maja; Broer, Inge; Valkonen, Jari P T

    2014-12-01

    Composite potato plants offer an extremely fast, effective and reliable system for studies on gene functions in roots using antisense or inverted-repeat but not sense constructs for gene inactivation. Composite plants, with transgenic roots on a non-transgenic shoot, can be obtained by shoot explant transformation with Agrobacterium rhizogenes. The aim of this study was to generate composite potato plants (Solanum tuberosum) to be used as a model system in future studies on root-pathogen interactions and gene silencing in the roots. The proportion of transgenic roots among the roots induced was high (80-100%) in the four potato cultivars tested (Albatros, Desirée, Sabina and Saturna). No wild-type adventitious roots were formed at mock inoculation site. All strains of A. rhizogenes tested induced phenotypically normal roots which, however, showed a reduced response to cytokinin as compared with non-transgenic roots. Nevertheless, both types of roots were infected to a similar high rate with the zoospores of Spongospora subterranea, a soilborne potato pathogen. The transgenic roots of composite potato plants expressed significantly higher amounts of β-glucuronidase (GUS) than the roots of a GUS-transgenic potato line event. Silencing of the uidA transgene (GUS) was tested by inducing roots on the GUS-transgenic cv. Albatros event with strains of A. rhizogenes over-expressing either the uidA sense or antisense transcripts, or inverted-repeat or hairpin uidA RNA. The three last mentioned constructs caused 2.5-4.0 fold reduction in the uidA mRNA expression. In contrast, over-expression of uidA resulted in over 3-fold increase in the uidA mRNA and GUS expression, indicating that sense-mediated silencing (co-suppression) was not functional in roots. The results suggest that composite plants offer a useful experimental system for potato research, which has gained little previous attention.

  14. Cooperation and competition between adenylate kinase, nucleoside diphosphokinase, electron transport, and ATP synthase in plant mitochondria studied by 31P-nuclear magnetic resonance

    International Nuclear Information System (INIS)

    Roberts, J.K.M.; Aubert, S.; Gout, E.; Bligny, R.; Douce, R.

    1997-01-01

    Nucleotide metabolism in potato (Solanum tuberosum) mitochondria was studied using 31P-nuclear magnetic resonance spectroscopy and the O2 electrode. Immediately following the addition of ADP, ATP synthesis exceeded the rate of oxidative phosphorylation, fueled by succinate oxidation, due to mitochondrial adenylate kinase (AK) activity two to four times the maximum activity of ATP synthase. Only when the AK reaction approached equilibrium was oxidative phosphorylation the primary mechanism for net ATP synthesis. A pool of sequestered ATP in mitochondria enabled AK and ATP synthase to convert AMP to ATP in the presence of exogenous inorganic phosphate. During this conversion, AK activity can indirectly influence rates of oxidation of both succinate and NADH via changes in mitochondrial ATP. Mitochondrial nucleoside diphosphokinase, in cooperation with ATP synthase, was found to facilitate phosphorylation of nucleoside diphosphates other than ADP at rates similar to the maximum rate of oxidative phosphorylation. These results demonstrate that plant mitochondria contain all of the machinery necessary to rapidly regenerate nucleoside triphosphates from AMP and nucleoside diphosphates made during cellular biosynthesis and that AK activity can affect both the amount of ADP available to ATP synthase and the level of ATP regulating electron transport

  15. Effect of explant plant source and acetosyringone concentration on ...

    African Journals Online (AJOL)

    Jane

    2011-08-15

    Aug 15, 2011 ... a number of factors including tissue culture conditions, acetosyringone .... immature embryo culture, callus induction and in vitro salt stress. Plant Cell ... phenotypical characterization of transgenic tomato plants: Solanum.

  16. Green Algae from Coal Bed Methane Ponds as a Source of Fertilizer for Economically Important Plants of Montana

    Science.gov (United States)

    Ogunsakin, O. R.; Apple, M. E.; Zhou, X.; Peyton, B.

    2016-12-01

    The Tongue River Basin of northeastern Wyoming and southeastern Montana is the location of natural gas reserves and coal bed methane (CBM) acreage. Although the water that emanates from CBM extraction varies with site, it is generally of higher quality than the waters produced by conventional oil and gas wells, in part because it is low in volatile organic compounds. However, since CBM water contains dissolved solids, including sodium (Na), bicarbonate (HCO3) and chloride (Cl) ions, the water must be treated before it can be discharged into the river or wetlands, or used for stock ponds or irrigation. Several ponds have been constructed to serve as a holding facility for CBM water. Algae from the CBM ponds of the Tongue River Basin have the potential to be utilized as fertilizer on economically important plants of Montana. Two very important crop plants of Montana are wheat, Triticum aestivum, and potatoes, Solanum tuberosum. To explore this potential, isolates of unicellular green algae (Chlorella sp.) from the CBM ponds were cultured in aerated vessels with Bold's Basic Growth Medium and natural and/or supplemental light. Algal biomass was condensed in and collected from a valved funnel, after which cell density was determined via light microscopy and a hemacytometer. Algal/water slurries with known nutrient contents were added to seedlings of hard winter wheat, T.aestivum, grown in a greenhouse for three months before harves. When compared to wheat provided with just water, or with water and a commercially available fertilizer, the wheat fertilized with algae had a higher chlorophyll content, more tillers (side shoots), and a higher ratio of influorescences (groups of flowers) per stem. In a related experiment, Ranger Russet seed potatoes, S. tuberosum were given just water, water and Hoagland's nutrient solution, or water with algae in order to compare aboveground growth and potato production among the treatments. The results of this study suggest that

  17. Strategies for enhancing the phytoremediation of cadmium-contaminated agricultural soils by Solanum nigrum L

    International Nuclear Information System (INIS)

    Ji Puhui; Sun Tieheng; Song Yufang; Ackland, M. Leigh; Liu Yang

    2011-01-01

    Field trials contribute practical information towards the development of phytoremediation strategies that cannot be provided by laboratory tests. We conducted field experiments utilizing the Cd hyperaccumulator plant Solanum nigrum L., on farmland contaminated with 1.91 mg kg -1 Cd in the soil. Our study showed that S. nigrum has a relatively high biomass. Planting density had a significant effect on the plant biomass and thus on overall Cd accumulation. For double harvesting, an optimal cutting position influenced the amount of Cd extracted from soils. Double cropping was found to significantly increase the amount of Cd extracted by S. nigrum. Fertilizing had no significant effect on plant biomass or on the Cd remediation of the soil over the short-term period. Our study indicates that S. nigrum can accumulate Cd from soils where the concentrations are relatively low, and thus has application for use in decontamination of slightly to moderately Cd-contaminated soil. - Research highlights: →S. nigrum L. is an effective phytoremediation plant for Cd-polluted soils. →Agronomy practices that increase harvested biomass improve bioremediation efficiency. →Double cropping of S. nigrum L. is an effective phytoremediation strategy. →Field experiments are necessary to effectively assess phytoremediation techniques. - Agronomic practice for the phytoremediation potential of Solanum nigrum L. for Cd uptake was demonstrated in field contaminated soils.

  18. Strategies for enhancing the phytoremediation of cadmium-contaminated agricultural soils by Solanum nigrum L

    Energy Technology Data Exchange (ETDEWEB)

    Ji Puhui [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China); Sun Tieheng [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, Shenyang 110016 (China); Song Yufang, E-mail: jipuhui1983@163.com [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, Shenyang 110016 (China); Ackland, M. Leigh [School of Life and Environmental Sciences, Deakin University, Burwood 3125, Melbourne (Australia); Liu Yang [Key Laboratory of Terrestrial Ecological Process, Institute of Applied Ecology, Chinese Academy of Sciences, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China)

    2011-03-15

    Field trials contribute practical information towards the development of phytoremediation strategies that cannot be provided by laboratory tests. We conducted field experiments utilizing the Cd hyperaccumulator plant Solanum nigrum L., on farmland contaminated with 1.91 mg kg{sup -1} Cd in the soil. Our study showed that S. nigrum has a relatively high biomass. Planting density had a significant effect on the plant biomass and thus on overall Cd accumulation. For double harvesting, an optimal cutting position influenced the amount of Cd extracted from soils. Double cropping was found to significantly increase the amount of Cd extracted by S. nigrum. Fertilizing had no significant effect on plant biomass or on the Cd remediation of the soil over the short-term period. Our study indicates that S. nigrum can accumulate Cd from soils where the concentrations are relatively low, and thus has application for use in decontamination of slightly to moderately Cd-contaminated soil. - Research highlights: > S. nigrum L. is an effective phytoremediation plant for Cd-polluted soils. > Agronomy practices that increase harvested biomass improve bioremediation efficiency. > Double cropping of S. nigrum L. is an effective phytoremediation strategy. > Field experiments are necessary to effectively assess phytoremediation techniques. - Agronomic practice for the phytoremediation potential of Solanum nigrum L. for Cd uptake was demonstrated in field contaminated soils.

  19. Growth and yield of Solanum khasianum in Pinus roxburghii forest based silvi-medicinal system in mid hills of Indian Himalaya

    Directory of Open Access Journals (Sweden)

    Chandra Shekher Sanwal

    2016-08-01

    Full Text Available Background In mid hills of Western Himalayas, Himachal Pradesh India, growth, yield and economics of Solanum khasianum as a potential medicinal herb under Pinus roxburghii (Chir pine plantation has been studied for two consecutive years to assess the performance of Solanum khasianum in undercanopy of Pinus roxburghii for developing Solanum khasianum and Pinus roxburghii based innovative silvi-medicinal system. Methods Growth parameters such as plant height, number of branches per plant and leaf area index followed by yield were estimated after Solanum khasianum was grown on three topographical aspects as; Northern, North - western and Western at a spacing of 45 cm × 45 cm, followed by three tillage depths as; minimum (0 cm, medium (up to 10 cm and deep tillage (up to 15 cm, in open and below canopy conditions treatment. The study was conducted to explore the possibility of using Solanum khasianum based silvi-medicinal system to utilize the below canopy of Chir pine forest for enhancing the productivity of forests besides the conservation of the medicinal herb. Results The growth parameters such as plant height, number of branches per plant and leaf area index were non-significantly affected by topographical aspects and tillage practices, both below canopy and open conditions except fresh weight and dry weight of berries during harvesting stage. The maximum yield (0.61 t∙ha−1 was observed on Western aspect in open conditions as compared to below canopy of Chir pine. The highest gross returns were observed for the crop cultivated on Western aspect under deep tillage in open conditions than other aspect and tillage combinations. However the positive net returns from the crops raised in below canopy of Chir pine indicates its possible economic viability under agroforestry system as the gross returns was higher than the cost of cultivation. Conclusion Solanum khasianum when grown in below canopy of Pinus roxburghii, its growth and yield

  20. Chemical constituents of Solanum buddleifolium Sendtn; Constituintes quimicos de Solanum buddleifolium Sendtn

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Francisco das Chagas L.; Torres, Maria da conceicao M.; Silveira, Edilberto R.; Pessoa, Otilia Deusdenia L., E-mail: opessoa@ufc.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Centro de Ciencias. Dept. de Quimica Organica e Inorganica; Braz-Filho, Raimundo [Universidade Estadual do Norte Fluminense, Campos, RJ (Brazil). Dept. de Quimica; Guedes, Maria Lenise da Silva [Universidade Federal da Bahia (UFBA), Ondina, BA (Brazil). Inst. de Biologia. Dept. de Botanica

    2013-10-01

    The chemical investigation of the stem EtOH extract of S. buddleifolium resulted in the isolation of terpenoids, amides, lignans and a steroidal alkaloid. Based on HRMS, IR and {sup 1}H and {sup 13}C NMR data analysis, the structures of the isolated compounds were identified as: 13-hydroxysolavetivone, betulinic acid, N-trans-caffeoyltyramine, N-trans-feruloyldopamine, N-trans-p-cumaroyltyramine, N-trans-feruloyltyramine, N-trans-feruloyl- 3'-O-methoxydopamine, alangilignoside C, isolariciresinol, polistachiol, (+)-(8R,7'S,8'S)-3{alpha}-O-({beta}-D-glucopiranosyl)-lioniresinol, (-)-(8S,7'R,8'R)-3{alpha}-O-({beta}-D-glucopiranosyl)-lioniresinol and solamargine. The occurrence of terpenoids and amides is common in Solanum, unlike lignans which are rare. The isolated lignans described in this work are reported for the first time in the genus Solanum. (author)

  1. Influence of speciation on the radionuclide uptake of plants; Einfluss der Speziation auf die Radionuklidaufnahme von Pflanzen

    Energy Technology Data Exchange (ETDEWEB)

    Tawussi, Frank

    2017-01-25

    The bioavailability for plants and uptake of radionuclides depend on various factors. The knowledge of the chemical and physical processes serves as basis for the transfer to different plant parts and finally for the estimation of the ingestion dose after consumption by man. Within the scope of the present work, the uptake of radionuclides was investigated in pea plants (Pisum sativum), paprika plants (Capsicum annuum) and potato plants (Solanum tuberosum) at low concentration (10{sup -5} to 10{sup -7} mol l{sup -1} for uranium and 10{sup -7} to 10{sup -9} mol l{sup -1} for plutonium) in hydroponic solution. Particular attention was paid to the speciation of radionuclides within the solution which was measured by time-resolved laser-induced fluorescence spectroscopy (TRLFS), capillary electrophoresis coupled to inductively-coupled-plasma mass-spectrometry (CE-ICP-MS), and theoretically calculated by the speciation code PHREEQC. The speciation, the solubility and therefore the plant availability of radionuclides mainly depend on the pH value and the redox potential of the solution. These parameters were monitored regularly. During the contamination period, the redox potential did not chance significantly. In contrast, the pH value showed characteristic changes depending on plants species. Especially in case of potato plants, the dissolved radionuclide fraction correlated with the changes of the pH value. In the plant roots, high amounts of radionuclides (10% to 50% of the added total quantity) were measured. Besides the uptake in the roots, the radionuclides can also adsorb to the exterior root surface. The transfer factor, which describes the Pu uptake ratio from the nutrient solution into the plant parts (dry mass), showed for the potato tubers values between 0.03 and 0.80 (Bq kg{sup -1}/ Bq l{sup -1}), depending on the initial Pu concentration. In addition of the complexing agent EDTA in solution (10{sup -4} mol l{sup -1}), the plutonium uptake increases up to 58

  2. Occurrence of horse nettle (Solanum carolinense L.) in North Rhine-Westphalia

    OpenAIRE

    Klingenhagen, Günter; Wirth, Martin; Wiesmann, Bernd; Ahaus, Hermann

    2012-01-01

    In autumn 2008 during corn harvest (Zea mays L.), the driver of the combine harvester spotted an unfamiliar plant species in the field. It turned out that Solanum carolinense L. was the unknown weed species. The species had overgrown 40 % of the corn field which had a size of 10.2 ha. The farmer who usually effectively controls all weeds on his field had so far not noticed the dominance of the solanaceous herb species. From his point of view, the weed must have germinated after the corn had c...

  3. Molecular diversity among seven Solanum (eggplant and relatives ...

    African Journals Online (AJOL)

    Admin

    2012-11-08

    Nov 8, 2012 ... Seven Solanum species (eggplants) were investigated for molecular diversity. Besides its ... Eggplant comprises three closely related cultivated species .... generated with SSR data was submitted to 2-way Mantel test (Man-.

  4. Effect of acaricidal activity of Solanum nigrum on Tetranychus ...

    African Journals Online (AJOL)

    Effect of acaricidal activity of Solanum nigrum on Tetranychus urticae Koch under laboratory conditions. Stephanie Johana Numa Vergel, Lorena Rodríguez Coy, Daniel Rodríguez Caicedo, Ericsson Coy-Barrera ...

  5. An RNA-Seq transcriptome analysis of orthophosphate-deficient white lupin reveals novel insights into phosphorus acclimation in plants.

    Science.gov (United States)

    O'Rourke, Jamie A; Yang, S Samuel; Miller, Susan S; Bucciarelli, Bruna; Liu, Junqi; Rydeen, Ariel; Bozsoki, Zoltan; Uhde-Stone, Claudia; Tu, Zheng Jin; Allan, Deborah; Gronwald, John W; Vance, Carroll P

    2013-02-01

    Phosphorus, in its orthophosphate form (P(i)), is one of the most limiting macronutrients in soils for plant growth and development. However, the whole-genome molecular mechanisms contributing to plant acclimation to P(i) deficiency remain largely unknown. White lupin (Lupinus albus) has evolved unique adaptations for growth in P(i)-deficient soils, including the development of cluster roots to increase root surface area. In this study, we utilized RNA-Seq technology to assess global gene expression in white lupin cluster roots, normal roots, and leaves in response to P(i) supply. We de novo assembled 277,224,180 Illumina reads from 12 complementary DNA libraries to build what is to our knowledge the first white lupin gene index (LAGI 1.0). This index contains 125,821 unique sequences with an average length of 1,155 bp. Of these sequences, 50,734 were transcriptionally active (reads per kilobase per million reads ≥ 3), representing approximately 7.8% of the white lupin genome, using the predicted genome size of Lupinus angustifolius as a reference. We identified a total of 2,128 sequences differentially expressed in response to P(i) deficiency with a 2-fold or greater change and P ≤ 0.05. Twelve sequences were consistently differentially expressed due to P(i) deficiency stress in three species, Arabidopsis (Arabidopsis thaliana), potato (Solanum tuberosum), and white lupin, making them ideal candidates to monitor the P(i) status of plants. Additionally, classic physiological experiments were coupled with RNA-Seq data to examine the role of cytokinin and gibberellic acid in P(i) deficiency-induced cluster root development. This global gene expression analysis provides new insights into the biochemical and molecular mechanisms involved in the acclimation to P(i) deficiency.

  6. Steroidal glycoalkaloids and molluscicidal activity of Solanum asperum Rich. fruits

    OpenAIRE

    Silva, Tania M. S.; Camara, Celso A.; Freire, Kristerson R. L.; Silva, Thiago G. da; Agra, Maria de F.; Bhattacharyya, Jnanabrata

    2008-01-01

    Bioassay-guided fractionation of the alkaloidal extract of the green fruits of Solanum asperum afforded a new compound, solanandaine along with solasonine and solamargine. The total crude alkaloids as well as the isolated pure alkaloids exhibited significant molluscicidal activity. O fracionamento bio-monitorado do extrato alcaloídico dos frutos verdes de Solanum asperum forneceu um novo alcalóide esteroidal, denominado solanandaina, juntamente com a solasonina e a solamargina. Tanto o ext...

  7. Solanum paniculatum root extract reduces diarrhea in rats

    Directory of Open Access Journals (Sweden)

    Jonh A.B. Tenório

    Full Text Available Abstract Solanum paniculatum L., Solanaceae, locally known as "jurubeba", is widely used in Brazil for culinary purposes, and in folk medicine to treat of diverse disorder including gastric dysfunctions. In this study we investigated the antidiarrheal activity of S. paniculatum roots extract in rats at different concentrations (125, 250 and 500 mg/kg, p.o using different experimental models such as castor oil-induced diarrhea, enteropooling and gastrointestinal motility, determined by in vivo experimental models. The major compound of root extract was characterized as chlorogenic acid based in the IR, 1D and 2D NMR analysis. All the extract doses achieved antidiarrheal potency, as indicated by reduced weight of feces in castor oil-induced diarrhea, decreased intestinal motility and significantly inhibited castor oil-induced enteropooling compared to the vehicle group. The highest dose (500 mg/kg produced greater anti-motility effect and better reduction of enteropooling, similar to the reference drug Loperamide (5 mg/kg. Extract from S. paniculatum L. roots had antidiarrheal activity, as shown by the lower weight of the feces as well as decrease in the accumulation of intestinal fluid and slower transit, justifying the traditional use of plant for diarrhea.

  8. Cytological observation of solanum pimpinellifolium l. microspore development

    International Nuclear Information System (INIS)

    Qu, H.; Rylosona, J.S.

    2015-01-01

    Tomato (Solanum lycopersicum L.) is one of the most important horticultural crops worldwide, and has also been adapted as a model plant in a wide range of research disciplines. However, stamen development in tomato is less known than other model species, such as Arabidopsis thaliana and Oryza sativa L. (rice). In order to understand tomato flower development in more detail, the key goal of this study was to establish a precise correlation between visual morphological features and cytological events. To this end, we characterized a wild tomato species, S. pimpinellifolium (accession LA1585), to define stamen developmental stages using semi-thin sectioning. Based on distinct stages of flower development, S. pimpinellifolium anther/stamen development was divided into ten stages, and characteristic morphological and cytological features in stamens at each developmental stage were identified. In this way, flower characteristics and microspore development were correlated. In addition, specific cytological key events in S. pimpinellifolium were compared with those in A. thaliana and rice at corresponding stages, as well as with those in domesticated tomato (S. lycopersicum L.), and the differences are discussed. (author)

  9. Structure and histochemistry of medicinal species of Solanum

    Directory of Open Access Journals (Sweden)

    Laudineia J. Matias

    Full Text Available ABSTRACT Studies on native medicinal plants strengthen initiatives to preserve the environments where those species naturally occur, many of them already strongly menaced even before their potential to humankind is known. Root and stem barks, leaves, and pericarps samples of Solanum agrarium Sendtn., S. lycocarpum A. St.-Hil., S. palinacanthum Dunal, S. paniculatum L., and S. stipulaceum Roem. & Schult., species that occur in the Cerrado (Brazililan savanna were processed according to common light microscopy techniques for structural analysis, and histochemical tests were performed to locate and identify classes of chemical compounds. The distinctive features identified were low concentration of crystal sand in the root and stem, presence of terpene resin in the root, and absence of hypodermis in the leaf, in S. agrarium; bright spots (group of sclereids in the root, isobilateral mesophyll, thickened cell walls with hemicelluloses and strong aroma in the fruit, in S. lycocarpum; high concentration of crystal sand in the root and stem, oval-shaped limb, presence of isolated crystals in the exocarp, in S. palinacanthum; strong sclerification and rays with great height in the root and stem, in S. paniculatum; and accumulation of soluble protein in the root and stem, presence of conspicuous membranaceous stipules, absence of spiniform trichomes, in S. stipulaceum. This work identifies distinctive structural features, its ecological importance, and determines the distribution of secondary compounds associated with the medicinal properties reported for these species and contributes to the conservation of the natural environments where they occur.

  10. The Solanum lycopersicum WRKY3 Transcription Factor SlWRKY3 Is Involved in Salt Stress Tolerance in Tomato

    Czech Academy of Sciences Publication Activity Database

    Hichri, I.; Muhovski, Y.; Žižková, Eva; Dobrev, Petre; Gharbi, E.; Franco-Zorrilla, J.M.; Lopez-Vidriero, I.; Solano, R.; Clippe, A.; Errachid, A.; Motyka, Václav; Lutts, S.

    2017-01-01

    Roč. 8, JUL 31 (2017), č. článku 1343. ISSN 1664-462X R&D Projects: GA ČR(CZ) GA16-14649S Institutional support: RVO:61389030 Keywords : agrobacterium-mediated transformation * transgenic arabidopsis plants * dna-binding * salinity tolerance * defense responses * drought tolerance * abiotic stresses * water-stress * genes * tobacco * Solanum lycopersicum * SlWRKY3 * transcription factor * salinity tolerance * plant physiology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.298, year: 2016

  11. Palinologia de espécies de Solanum L. (Solanaceae A. Juss. ocorrentes nas restingas do Estado do Rio de Janeiro, Brasil Palynology of species of Solanum L. (Solanaceae A. Juss. from the restingas of Rio de Janeiro State, Brazil

    Directory of Open Access Journals (Sweden)

    Carla Patrícia Rodrigues Batista-Franklim

    2008-09-01

    Full Text Available Foram estudados 21 táxons de Solanum L., com o objetivo de caracterizá-los palinologicamente e, assim, contribuir para a elaboração de um catálogo polínico da flora das restingas do Estado do Rio de Janeiro. Os táxons examinados foram Solanum affine Sendtn., Solanum americanum Mill. var. americanum,Solanum argenteum Dunal ex Poir., Solanum aturense Dunal, Solanum caavurana Vell., Solanum capsicoides All., Solanum carautae Carv., Solanum cordifolium Dunal, Solanum curvispinum Dunal, Solanum echidnaeforme Dunal, Solanum gardneri Sendtn.,Solanum indigoferum A. St.-Hil., Solanum insidiosum Mart., Solanum mauritianum Scop., Solanum paludosum Moric., Solanum paniculatum L., Solanum paratyense Vell., Solanum pseudoquina A.St.-Hil., Solanum sisymbriifolium Lam., Solanum torvum Sw., Solanum velleum Sw. Os grãos de pólen foram acetolisados, mensurados, descritos e fotomicrografados. A análise sob microscopia eletrônica de varredura foi utilizada, em grãos de pólen não acetolisados, para confirmar as descrições feitas sob microscopia de luz e, em alguns casos para confirmar as descrições de abertura e ornamentação. Constatou-se que os grãos de pólen são pequenos ou médios, isopolares, subprolatos a oblato-esferoidais, 3-colporados, sexina granulada, rugulado-granulada ou escabrada. Pela análise dos resultados obtidos pôde-se concluir que os táxons analisados apresentam certa heterogeneidade polínica, quanto à forma, aos atributos das aberturas e à ornamentação da sexina, podendo-se usar estes caracteres na taxonomia do gênero.In this study 21 taxa of Solanum L. were investigated for palynological characterization and to contribute to the Pollen Catalog of the Flora of the Rio de Janeiro restingas. The taxa analysed were Solanum affine Sendtn., Solanum americanum Mill. var. americanum,Solanum argenteum Dunal ex Poir., Solanum aturense Dunal, Solanum caavurana Vell., Solanum capsicoides All., Solanum carautae Carv., Solanum

  12. Determinación cuantitativa de vitamina C y pigmentos y procesamiento de la papa criolla, variedad yema de huevo (Solanum phureja Juz et Buck

    Directory of Open Access Journals (Sweden)

    Isabel Alvarez G.

    2009-07-01

    Full Text Available Empleando papa pardo'pastusa (Solanum tuberosum como control, se determinó el contenido de Vitamina C total en la papa criolla, variedad Yema de Huevo (Solanum phureja, Juz et Buck y se evaluaron las pérdidas durante la cocción y el freído. Se utilizaron los métodos colorimétrico y densitométrico: el primero dio resultados altos debido a sustancias interferentes; el segundo reportó los siguientes valores: criolla 21 mg/100 g, pardo-pastusa 18 mg/100 g (para muestra fresca. Las pérdidas de Vitamina C de papa criolla con piel fueron durante la cocción {92°C durante 25' de 1 9 % y en el freído (175°C por 3' de 30%. También se analizaron los carotenos y xantofilas dando: carotenos en papa criolla, 1.5 mg/100 g, en pardo-pastusa 0.5 mg/100 g (muestra fresca y xantofilas en papa criolla 0.6 mg/100 g, en pardo-pastusa 0.13 mg/100 g. Se procesó en las siguientes formas no tradicionales: en harinas compuestas aceptadas por ios consumidores, en una sustitución del 2 0% con puré; frita en tajadas con piel y pasabocas de puré. El tiempo de vida fue para frita tres semanas a 16°C V más de una semana a 25°C; para pasabocas cinco semanas y media a 16 C y un mes a 30°C.

  13. Floral biology and the effects of plant-pollinator interaction on ...

    African Journals Online (AJOL)

    oyelana

    2012-10-18

    Oct 18, 2012 ... interaction on pollination intensity, fruit and seed set in. Solanum ... which plants offer rewards to flower visitors and they inadvertently ... fragmentation and extinction. Therefore, the ...... Plant resources of tropical Africa 2.

  14. The effector SPRYSEC-19 of Globodera rostochiensis suppresses CC-NB-LRR-mediated disease resistance in plants.

    Science.gov (United States)

    Postma, Wiebe J; Slootweg, Erik J; Rehman, Sajid; Finkers-Tomczak, Anna; Tytgat, Tom O G; van Gelderen, Kasper; Lozano-Torres, Jose L; Roosien, Jan; Pomp, Rikus; van Schaik, Casper; Bakker, Jaap; Goverse, Aska; Smant, Geert

    2012-10-01

    The potato cyst nematode Globodera rostochiensis invades roots of host plants where it transforms cells near the vascular cylinder into a permanent feeding site. The host cell modifications are most likely induced by a complex mixture of proteins in the stylet secretions of the nematodes. Resistance to nematodes conferred by nucleotide-binding-leucine-rich repeat (NB-LRR) proteins usually results in a programmed cell death in and around the feeding site, and is most likely triggered by the recognition of effectors in stylet secretions. However, the actual role of these secretions in the activation and suppression of effector-triggered immunity is largely unknown. Here we demonstrate that the effector SPRYSEC-19 of G. rostochiensis physically associates in planta with the LRR domain of a member of the SW5 resistance gene cluster in tomato (Lycopersicon esculentum). Unexpectedly, this interaction did not trigger defense-related programmed cell death and resistance to G. rostochiensis. By contrast, agroinfiltration assays showed that the coexpression of SPRYSEC-19 in leaves of Nicotiana benthamiana suppresses programmed cell death mediated by several coiled-coil (CC)-NB-LRR immune receptors. Furthermore, SPRYSEC-19 abrogated resistance to Potato virus X mediated by the CC-NB-LRR resistance protein Rx1, and resistance to Verticillium dahliae mediated by an unidentified resistance in potato (Solanum tuberosum). The suppression of cell death and disease resistance did not require a physical association of SPRYSEC-19 and the LRR domains of the CC-NB-LRR resistance proteins. Altogether, our data demonstrated that potato cyst nematodes secrete effectors that enable the suppression of programmed cell death and disease resistance mediated by several CC-NB-LRR proteins in plants.

  15. Detection and quantification of Spongospora subterranea f. sp. subterranea in bait plants and potato fields in Colombia using QPCR

    International Nuclear Information System (INIS)

    Garcia Bastidas, Nevar; Morales, Juan Gonzalo; Gonzalez Jaimes, Paola; Gutierrez, Pablo Andres; Marin Montoya, Mauricio

    2013-01-01

    In recent years, potato crops (Solanum tuberosum, S. phureja) have been seriously affected by powdery scab; a disease caused by Spongospora subterranea f.sp. subterranea (Sss). In Colombia, asymptomatic detection of Sss has been achieved with bait plants, PCR of its regions and ELISA tests. Unfortunately, these techniques have low sensitivity and may require long processing times. In this work, quantitative real time PCR (qPCR) was tested for detection of Sss using different sets of primers. Primers SsTQF1-SsTQR1, Spon421F-Spon494R and SscolF-SscolR (designed in this study), were tested using SYBR green, while primers sponfsponr were tested using the Taqman probe sponp. Primers Spon421F-Spon494R was discarded due to lack of specificity. Standard curves were obtained from serial dilutions of Cystosori. the 20 N. benthamiana and potato bait plants evaluated tested positive for Sss using primers SsTQF1-SsTQR1 (Ct: 10.57-29.34) and Sscolf-SscolR (Ct: 14.39-34.08) and 19 samples were positive with primers SponF-SponR-SponP, with Ct values ranging between 15,63 and 38,93. Sss was detected in 17 out of 20 root samples from potato crops in la Union (Antioquia) using primers SscolF-SscolRt with an estimated concentration of 6470 to 1,39x10 1 0 cystosori/ mL. these results suggest high levels of sss in the potato fields from this region and recall the importance of strengthening seed-certification programs in Colombia.

  16. Comprehensive identification and expression analysis of Hsp90s gene family in Solanum lycopersicum.

    Science.gov (United States)

    Zai, W S; Miao, L X; Xiong, Z L; Zhang, H L; Ma, Y R; Li, Y L; Chen, Y B; Ye, S G

    2015-07-14

    Heat shock protein 90 (Hsp90) is a protein produced by plants in response to adverse environmental stresses. In this study, we identified and analyzed Hsp90 gene family members using a bioinformatic method based on genomic data from tomato (Solanum lycopersicum L.). The results illustrated that tomato contains at least 7 Hsp90 genes distributed on 6 chromosomes; protein lengths ranged from 267-794 amino acids. Intron numbers ranged from 2-19 in the genes. The phylogenetic tree revealed that Hsp90 genes in tomato (Solanum lycopersicum L.), rice (Oryza sativa L.), and Arabidopsis (Arabidopsis thaliana L.) could be divided into 5 groups, which included 3 pairs of orthologous genes and 4 pairs of paralogous genes. Expression analysis of RNA-sequence data showed that the Hsp90-1 gene was specifically expressed in mature fruits, while Hsp90-5 and Hsp90-6 showed opposite expression patterns in various tissues of cultivated and wild tomatoes. The expression levels of the Hsp90-1, Hsp90-2, and Hsp90- 3 genes in various tissues of cultivated tomatoes were high, while both the expression levels of genes Hsp90-3 and Hsp90-4 were low. Additionally, quantitative real-time polymerase chain reaction showed that these genes were involved in the responses to yellow leaf curl virus in tomato plant leaves. Our results provide a foundation for identifying the function of the Hsp90 gene in tomato.

  17. An RNA-Seq Transcriptome Analysis of Orthophosphate-Deficient White Lupin Reveals Novel Insights into Phosphorus Acclimation in Plants1[W][OA

    Science.gov (United States)

    O’Rourke, Jamie A.; Yang, S. Samuel; Miller, Susan S.; Bucciarelli, Bruna; Liu, Junqi; Rydeen, Ariel; Bozsoki, Zoltan; Uhde-Stone, Claudia; Tu, Zheng Jin; Allan, Deborah; Gronwald, John W.; Vance, Carroll P.

    2013-01-01

    Phosphorus, in its orthophosphate form (Pi), is one of the most limiting macronutrients in soils for plant growth and development. However, the whole-genome molecular mechanisms contributing to plant acclimation to Pi deficiency remain largely unknown. White lupin (Lupinus albus) has evolved unique adaptations for growth in Pi-deficient soils, including the development of cluster roots to increase root surface area. In this study, we utilized RNA-Seq technology to assess global gene expression in white lupin cluster roots, normal roots, and leaves in response to Pi supply. We de novo assembled 277,224,180 Illumina reads from 12 complementary DNA libraries to build what is to our knowledge the first white lupin gene index (LAGI 1.0). This index contains 125,821 unique sequences with an average length of 1,155 bp. Of these sequences, 50,734 were transcriptionally active (reads per kilobase per million reads ≥ 3), representing approximately 7.8% of the white lupin genome, using the predicted genome size of Lupinus angustifolius as a reference. We identified a total of 2,128 sequences differentially expressed in response to Pi deficiency with a 2-fold or greater change and P ≤ 0.05. Twelve sequences were consistently differentially expressed due to Pi deficiency stress in three species, Arabidopsis (Arabidopsis thaliana), potato (Solanum tuberosum), and white lupin, making them ideal candidates to monitor the Pi status of plants. Additionally, classic physiological experiments were coupled with RNA-Seq data to examine the role of cytokinin and gibberellic acid in Pi deficiency-induced cluster root development. This global gene expression analysis provides new insights into the biochemical and molecular mechanisms involved in the acclimation to Pi deficiency. PMID:23197803

  18. Estudo farmacobotânico comparativo de folhas de Solanum crinitum Lam., Solanum gomphodes Dunal e Solanum lycocarpum A. St.-Hil., Solanaceae

    Directory of Open Access Journals (Sweden)

    Nathalia Diniz Araújo

    2010-09-01

    Full Text Available Neste trabalho realizou-se um estudo farmacobotânico de Solanum crinitum Lam., Solanum gomphodes Dunal e Solanum lycocarpum A. St-Hil, espécies pertencentes à Solanum sect. Crinitum Child, com o objetivo de efetuar morfodiagnoses macroscópicas e microscópicas que possibilitem suas caracterizações. As três espécies são conhecidas popularmente como "jurubeba", fruta-de-lobo" e "lobeira" e usadas na medicina popular contra o diabetes e também para outros fins. Essas espécies compartilham vários caracteres morfológicos, dentre os quais se destacam o hábito arbustivo a arbóreo, o indumento velutino às vezes cerdoso, a corola é pentagonal-estrelada, roxa a púrpura, e o fruto globoso acima de 5 cm de diâmetro. Entretanto, apesar da grande semelhança morfológica entre as espécies estudadas, destacaram-se como parâmetros distintivos: a morfologia do pecíolo, a base do limbo, o indumento da face adaxial, a anatomia do mesofilo, os tipos de estômatos e a morfologia do bordo foliar.

  19. Efectos del Almacenamiento y de la Cocción sobre el Contenido de Glicoialcaloides en Papa (Solanum Iuberosum

    Directory of Open Access Journals (Sweden)

    Villa Marín Héctor

    1989-06-01

    Full Text Available Los glicoalcaloides son O-glicósidos derivados de alcaloides 3 hidroxi-esteroides. Son bases débiles, ligeramente solubles en agua, solubles en ácidos débiles y alcoholes acidificados. Los que se encuentran en la papa (Solanum tuberosum son α-solanina y α-chaconina. A partir de ciertas concentraciones pueden manifestarse como mutagénicos, teratogénicos y carcinogénicos. Valores superiores a 1O mg/1OOg de tubérculo fresco imparten un sabor amargo. Contenidos de 20 mg/1OOg o más, dan sensación de quemadura. Se han reportado muertes a niveles de 30 mg/1OOg. Se estudiaron los efectos del almacenamiento y de la cocción sobre el contenido de glicoalcaloides totales (cuantitativo y el sabor amargo (cualitativo, en las dos variedades de papa de mayor consumo en Antioquia: ICA puracé y DIACOL capiro, bajo las condiciones de temperatura 16 y 21.5 °C. Los contenidos de glicoalcaloides totales fueron: 1.5 mg/1OOg en el tubérculo fresco variedad DIACOL capiro y 2.6 mg/1OOg para la variedad ICA puracé. Al pasar de 15 a 30 días el almacenamiento de las dos variedades a ambas temperaturas, se incrementaron los glicoalcaloides totales. No obstante, estos valores están por debajo de los niveles que inciden en el sabor amargo y más distantes aún de los considerados tóxicos. Con respecto a la cocción, hubo una clara reducción en el contenido de los glicoalcaloides. Para la variedad ICA puracé, hubo menores niveles de glicoalcaloides a la temperatura 21.5 °C, pero la variedad DIACOL capiro no mostró esa diferencia.

  20. Two new South American species of Solanum section Crinitum (Solanaceae

    Directory of Open Access Journals (Sweden)

    Frank Farruggia

    2010-11-01

    Full Text Available Two new species of Solanum section Crinitum are described here. Solanum falciforme Farruggia, sp. nov., closely resembles S. crinitum and S. lycocarpum, but differs by the presence of falcate trichomes on the young growth. It is endemic to the cerrado and adjacent woodlands of Distrito Federal, Bahia, Goiás and Minas Gerais, Brazil. The other species, Solanum pseudosycophanta Farruggia, sp.nov., has close affinities to S. sycophanta but differs from the latter inprominent long-stalked stellate hairs along the stem, calyx, petiole and the adaxial surface of the leaf, in contrast to S. sycophanta which is glabrous or pubescent with sessile to short-stalked multangulate hairs. This species is narrowly distributed in tropical montane forests of northern Peru and southern Ecuador.

  1. Chemical Constituents from Solanum glabratum Dunal var. sepicula

    Directory of Open Access Journals (Sweden)

    Essam Abdel-Sattar

    2015-01-01

    Full Text Available In the course of screening program of Saudi plants for their potential biological activity, the methanolic extract of Solanum glabratum Dunal var. sepicula as well as its different fractions were tested for its possible cytoxicity in prostate cancer (PC3 and colon cancer (HT29 cell lines using the MTT assay. In the present study, three spirostan saponins and one flavonoid glycoside were isolated from the active n-butanol fraction through a bio-guided fractionation approach. Two new saponin glycosides were identified as 23-β-D-glucopyranosyl (23S, 25R-spirost-5-en-3, 23 diol 3-O-α-L-rhamnopyranosyl-(1→2-O-[α-L-rhamnopyranosyl-(1→4]-β-D-glucopyranoside (2 and (25R-spirost-5-en-3-ol 3-O-α-L-rhamnopyranosyl-(1→2-O-[β-D-glucopyranosyl-(1→3]-β-D-galactopyranoside (3. In addition, two known compounds were also isolated and identified as isorhamnetin-3-O-α-L-rhamnopyranosyl (1→6 β-D-glucopyranoside (1 and (23S, 25R-spirost-5-en-3, 23 diol 3-O-α-L-rhamnopyranosyl-(1→2-O-[α-L-rhamnopyranosyl-(1→4]-β-D-glucopyranoside (4. The structures of the isolated compounds were elucidated based on their MS, one dimensional and extensive two dimensional NMR spectral data. Among the isolated metabolites, compound 3 showed the highest cytotoxic activity in both PC3 and HT29 cell lines with an IC 50 values of 14.8 and 19.5 m g/mL, respectively.

  2. Metabolism by grasshoppers of volatile chemical constituents from Mangifera indica and Solanum paniculatum leaves.

    Science.gov (United States)

    Ramos, Clécio S; Ramos, Natália S M; Da Silva, Rodolfo R; Da Câmara, Cláudio A G; Almeida, Argus V

    2012-12-01

    The chemical volatiles from plant leaves and their biological activities have been extensively studied. However, no studies have addressed plant-chemical volatiles after undergoing the digestive process in host insects. Here we describe for the first time chemical profiles of volatile constituents from Solanum paniculatum and Mangifera indica leaves metabolized by grasshoppers. Both profiles were qualitatively and quantitatively different from the profiles of non-metabolized leaves. The amount of nerolidol, the major constituent of S. paniculatum leaves, decreased and other sesquiterpenes, such as spathulenol, were formed during the digestive process of the grasshopper Chromacris speciosa. In M. indica, the presence of phenylpropanoids was observed (dillapiole, Z-asarone, E-asarone and γ-asarone) in the leaves metabolized by the grasshopper Tropidacris collaris, but these compounds were not found in the non-metabolized leaves. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Responses of grafted tomato (Solanum lycopersiocon L. to abiotic stresses in Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Abdulaziz Al-Harbi

    2017-09-01

    Full Text Available Quantity and quality of irrigation water are considered the most imperative limiting factors for plant production in arid environment. Adoptions of strategies can minimize crop water consumption while nonexistent yield reduction is considered challenge for scholars especially in arid environment. Grafting is regarded as a promising tool to avoid or reduce yield loss caused by abiotic stresses. Tomato (Solanum lycopersium Mill., commercial cultivar Faridah was grafted on Unifort rootstock and grown under regulated deficit irrigation (RDI (100%, 80% and 60% ETc, using two types of irrigation water, fresh (EC = 0.86 dS/m and brackish (EC = 3.52 dS/m. The effects of grafting and RDI on water use efficiency, vegetative growth, yield, fruit quality were investigated. Plant vegetative growth was reduced under water and salinity stresses. Grafting the plant significantly improves the vegetative growth under both conditions. The results showed that crop yield, Ca+2 and K+ were considerably increased in grafted tomato compared to non-grafted plants under water and salinity stresses. Grafted tomato plants accumulated less Na+ and Cl−, especially under high levels of salinity compared to non-grafted plants. Grafting tomato plants showed a slight decrease on the fruit quality traits such as vitamin C, titratable acidity (TA and total soluble solids (TSS. This study confirmed that grafted tomato plants can mitigate undesirable impact of salt stress on growth and fruit quality.

  4. Calcium absorption and calcium binding protein synthesis in the chick: evidence for a 1,25-dihydroxycholecalciferol-like factor in solanum malacoxylon

    Energy Technology Data Exchange (ETDEWEB)

    Wasserman, R H; Bar, A; Corradino, R A; Taylor, A N; Peterlik, M

    1974-01-01

    Some properties of the vitamin D dependent CaBP have been briefly summarized. In addition to providing possible insight into the molecular basis of vitamin D action, the measurement of intestinal CaBP in animals subjected to different conditions and treatments has proven useful in assessing the effective vitamin D status of that animal. Using measurements of both the degree of intestinal /sup 47/Ca absorption in situ and duodenal CaBP levels, some aspects of the vitamin D-like factor in the South American plant Solanum malacoxylon were investigated. A vitamin D assay based on CaBP as end point indicated that the plant contains about 1.3 x 10/sup 5/ IU vitamin D/sub 3/ equivalents per kg. The Solanum factor, together with an adequate calcium intake, are necessary conditions for the product of gross toxic symptoms in the chick. Using experimental conditions that inhibit the conversion of 25-(OH)D/sub 3/ to 1,25-(OH)/sub 2/D/sub 3/ by the kidney enzyme system (i.e., a high stable strontium diet), it was shown that the Solanum factor can cause a reversal of this inhibition. This suggested that the Solanum factor mimics the action of 1,25-(OH)/sub 2/D/sub 3/, and this was confirmed by Walling and Kimberg (personal communication) since, in their hands, the administration of S. malacoxylon extract to nephrectomized rats was able to stimulate intestinal calcium transport in vitro. Similar results were brought forth at this meeting by Dr. Mautalen of Argentina. The Solanum factor was effective in an intestinal organ culture system, indicating that the factor acts directly on the gut and, if modification of the factor is needed for biological activity, the necessary enzymes are present in the intestinal tissue.

  5. Decrease in spermatic parameters of mice treated with hydroalcoholic extract Tropaeolum tuberosum “mashua”

    Directory of Open Access Journals (Sweden)

    Jonathan H. Vásquez

    2012-10-01

    Full Text Available In this work, we provided a Tropaeolum tuberosum hydroalcoholic extract to male mice (780 mg kg-1 for 7, 14 and 21 days treatment, there was no significant difference in body weight gain, testes, epididymides and prostate weight (p> 0.05, nevertheless progressive motility decreased and immobile sperm count increased significantly after 21 days treatment (p <0.05. The sperm count in the epididymis cauda decreased in the 3 three assessments, concentration on 21 days treatment was significantly lower than those of 7 and 14 days treatments (p <0.05. Our results suggest, that T. tuberosum has a direct action on the male reproductive system decreasing spermatic parameters without exerting toxic effects on mice.

  6. Population structure and genetic diversity of native and invasive populations of Solanum rostratum (Solanaceae.

    Directory of Open Access Journals (Sweden)

    Jiali Zhao

    Full Text Available We investigate native and introduced populations of Solanum rostratum, an annual, self-compatible plant that has been introduced around the globe. This study is the first to compare the genetic diversity of Solanum rostratum between native and introduced populations. We aim to (1 determine the level of genetic diversity across the studied regions; (2 explore the likely origins of invasive populations in China; and (3 investigate whether there is the evidence of multiple introductions into China.We genotyped 329 individuals at 10 microsatellite loci to determine the levels of genetic diversity and to investigate population structure of native and introduced populations of S. rostratum. We studied five populations in each of three regions across two continents: Mexico, the U.S.A. and China.We found the highest genetic diversity among Mexican populations of S. rostratum. Genetic diversity was significantly lower in Chinese and U.S.A. populations, but we found no regional difference in inbreeding coefficients (F IS or population differentiation (F ST. Population structure analyses indicate that Chinese and U.S.A. populations are more closely related to each other than to sampled Mexican populations, revealing that introduced populations in China share an origin with the sampled U.S.A. populations. The distinctiveness between some introduced populations indicates multiple introductions of S. rostratum into China.

  7. Efficiency of Buzzing Bees in Fruit Set and Seed Set of Solanum violaceum in Sri Lanka

    Directory of Open Access Journals (Sweden)

    R. W. M. U. M. Wanigasekara

    2012-01-01

    Full Text Available Plant-pollinator interactions are often considered as tightly coevolved, mutualistic relationships. The present study aimed at determining the flower visiting bees of the vegetable crop, Solanum violaceum, and the efficiency of buzz pollination by bees on fruit and seed production in Sri Lanka. Seven bee species: Hoplonomia westwoodi, Amegilla comberi, Patellapis kaluterae, Xylocopa tenuiscapa, Apis dorsata, Trigona iridipennis, and Ceratina hieroglyphica visited the flowers of S. violaceum, and the first four species were buzzing bees. Buzzing bees were the first to visit Solanum flowers and were followed by nonbuzzing bees. Handling time of H. westwoodi and P. kaluterae varied with the availability of pollen in anthers that deplete with the age of flower and stayed longer at new flowers than at old flowers. Handling time of the larger buzzing bee, H. westwoodi, was higher than that of the smaller P. kaluterae. The fruit set, seed set, and seed germinability in flowers visited by buzzing bees were significantly higher than those of the flowers bagged to exclude pollinators.

  8. The Effector SPRYSEC-19 of Globodera rostochiensis Suppresses CC-NB-LRR-Mediated Disease Resistance in Plants1[C][W][OA

    Science.gov (United States)

    Postma, Wiebe J.; Slootweg, Erik J.; Rehman, Sajid; Finkers-Tomczak, Anna; Tytgat, Tom O.G.; van Gelderen, Kasper; Lozano-Torres, Jose L.; Roosien, Jan; Pomp, Rikus; van Schaik, Casper; Bakker, Jaap; Goverse, Aska; Smant, Geert

    2012-01-01

    The potato cyst nematode Globodera rostochiensis invades roots of host plants where it transforms cells near the vascular cylinder into a permanent feeding site. The host cell modifications are most likely induced by a complex mixture of proteins in the stylet secretions of the nematodes. Resistance to nematodes conferred by nucleotide-binding-leucine-rich repeat (NB-LRR) proteins usually results in a programmed cell death in and around the feeding site, and is most likely triggered by the recognition of effectors in stylet secretions. However, the actual role of these secretions in the activation and suppression of effector-triggered immunity is largely unknown. Here we demonstrate that the effector SPRYSEC-19 of G. rostochiensis physically associates in planta with the LRR domain of a member of the SW5 resistance gene cluster in tomato (Lycopersicon esculentum). Unexpectedly, this interaction did not trigger defense-related programmed cell death and resistance to G. rostochiensis. By contrast, agroinfiltration assays showed that the coexpression of SPRYSEC-19 in leaves of Nicotiana benthamiana suppresses programmed cell death mediated by several coiled-coil (CC)-NB-LRR immune receptors. Furthermore, SPRYSEC-19 abrogated resistance to Potato virus X mediated by the CC-NB-LRR resistance protein Rx1, and resistance to Verticillium dahliae mediated by an unidentified resistance in potato (Solanum tuberosum). The suppression of cell death and disease resistance did not require a physical association of SPRYSEC-19 and the LRR domains of the CC-NB-LRR resistance proteins. Altogether, our data demonstrated that potato cyst nematodes secrete effectors that enable the suppression of programmed cell death and disease resistance mediated by several CC-NB-LRR proteins in plants. PMID:22904163

  9. Integrated effect of nutrients from a recirculation aquaponic system and foliar nutrition on the yield of tomatoes Solanum lycopersicum L. and Solanum pimpinellifolium.

    Science.gov (United States)

    Gullian Klanian, Mariel; Delgadillo Diaz, Mariana; Aranda, Javier; Rosales Juárez, Carolina

    2018-04-20

    The objective of this study was to evaluate the potential of tomato plants to efficiently use the nitrogen (N) of a recirculation aquaponic system (RAS) and to evaluate the effects of foliar fertilization as a complement to the water nutrition on the growth of the two tomato cultivars. The significant effect of six macro- and seven micronutrients was evaluated on the plant growth and on the fruit yield. Two experiments were performed in a nutrient film aquaponic unit. The first experiment was designed to study the effects of foliar fertilization on the seedlings of two tomato cultivars Costoluto Genovese (CG) (Solanum lycopersicum L.) and Currant tomato (Ct) (Solanum pimpinellifolium) with 8% of weekly water exchange (WE8%-RAS). The foliar fertilizer was formulated with N restriction in the last 11 weeks (TF1). In the second experiment, two other foliar fertilization treatments (TF2 and TF3) were applied with a concentration of nutrients twice and triple that in TF1, but with a lower proportion of NPK ratio. These treatments were tested on the cultivar CG in a RAS with zero water exchange (WE0%-RAS). The data from the 1st experiment showed a positive effect of the foliar fertilization on the yield of both cultivars. The fertilization markedly influenced the dry matter weight of the CG; however, this effect was not observed in the Ct. The root length of both cultivars was positively influenced by the P content, whereas the plant height was affected by the excess of Co and S. According to the results from the 2nd experiment, the TF2 plants had the highest number of fruits with a high mean weight. The system was efficient in utilizing N from fish tank; the water K favored the yield of the CG fruit and the foliar K favored the growth of the TF2 plants. With a decrease in the foliar N, the CG plants were able to absorb 27.5% of the NO 3 - and 7.06% of total ammonia nitrogen from water. The absolute and relative growth rate of Nile tilapia was not affected by the rate

  10. In vitro trypanocidal activity of solamargine and extracts from Solanum palinacanthum and Solanum lycocarpum of brazilian cerrado

    OpenAIRE

    MOREIRA, RAQUEL R.D.; MARTINS, GILMARCIO Z.; MAGALHAES, NATHALIA O.; ALMEIDA, ADELIA E.; PIETRO, ROSEMEIRE C.L.R.; SILVA, FLAVIA A. J.; CICARELLI, REGINA M.B.

    2013-01-01

    O objetivo deste estudo foi avaliar a potencial atividade tripanocida do extrato bruto etanólico dos frutos de Solanum palinacanthum, Solanum lycocarpum e do glicoalcalóide solamargina. Pó do fruto seco de S. palinacanthum e S. lycocarpum foram submetidos a extracção por refluxo com etanol a 96% e solamargina foi isolada a partir do extrato bruto de S. palinacanthum. Foram determinadas de ambos os extratos e a solamargina a atividade tripanocida utilizando o ensaio colorimétrico MTT. O Extrat...

  11. Solanum sisymbriifolium (Lam.) : a trap crop for potato cyst nematodes

    NARCIS (Netherlands)

    Timmermans, B.G.H.

    2005-01-01

    Keywords:Solanumsisymbriifolium ,Globoderapallida ,Globoderarostochiensis ,

  12. Critical Period for Weed Removal in Garden Egg (Solanum Incanum ...

    African Journals Online (AJOL)

    Field experiments were conducted at the Teaching and Research Farm, Adeyemi College of Education, Ondo during the 2004 and 2005 cropping seasons to determine the extent of yield loss due to weed infestation and the critical time for weed removal in garden egg (Solanum incanum). The experiment which was ...

  13. Quantitative resistance to Botrytis cinerea from Solanum neorickii

    NARCIS (Netherlands)

    Finkers, H.J.; Bai, Y.; Berg, van den P.M.M.M.; Berloo, van R.; Meijer-Dekens, R.G.; Have, ten A.; Kan, van J.A.L.; Lindhout, P.; Heusden, van A.W.

    2008-01-01

    Tomato (Solanum lycopersicum) is susceptible to gray mold (Botrytis cinerea). Quantitative resistance to B. cinerea was previously identified in a wild relative, S. neorickii G1.1601. The 122 F3 families derived from a cross between the susceptible S. lycopersicum cv. Moneymaker and the partially

  14. New Solanum species from Tanzanian coastal forests may already ...

    African Journals Online (AJOL)

    The unusually long inflorescences with a dense covering of long straight prickles on the rachis distinguish S. ruvu from all other African species of spiny Solanum. Its likely affinities lie with another coastal forest species, S. zanzibarense, which exhibits a similar scandent habit, subentire leaves, thin stems, and prickles that ...

  15. Total lipid profile with aqueous fruit extract of Solanum macrocarpum ...

    African Journals Online (AJOL)

    Abstract. Studies were undertaken to investigate the effects of the aqueous fruit extract of Solanum macrocarpum Linn. on the total lipid profile: total cholesterol, triglycerides, high density lipoprotein-cholesterol (HDL-C) and low density lipoprotein-cholesterol (LDL-C) on hypercholesterolaemic rats. Total serum cholesterol ...

  16. Solanum cultivar responses to arbuscular mycorrhizal fungi: growth ...

    African Journals Online (AJOL)

    A greenhouse experiment was carried out in a sandy soil with a low available phosphorus to evaluate responsiveness of four Solanum aethiopicum cultivars to indigenous arbuscular mycorrhizal fungi. Results showed clear interaction between genetic variability of cultivars and fungal isolates on shoot biomass and on ...

  17. Cytogenetic studies on some Nigerian species of Solanum L ...

    African Journals Online (AJOL)

    Cytogenetic studies to determine the chromosome number, structure and behaviour of some species of Solanum in Nigeria were carried out. Attempt was also made to induce polyploidy in the species. Comparative analysis of the cytological behaviour of the diploid and polyploid cytotypes was made. The studies show that ...

  18. Potential economic pests of solanaceous crops: a new species of Solanum-feeding psyllid from Australia and first record from New Zealand of Acizzia solanicola (Hemiptera: Psyllidae).

    Science.gov (United States)

    Taylor, Gary S; Kent, Deborah S

    2013-02-11

    Acizzia credoensis sp. n. is described from a single population on the native plant, Solanum lasiophyllum, from semi-arid Western Australia. The host range of Acizzia solanicola Kent & Taylor, initially recorded as damaging eggplant, S. melongena, in commercial crops and gardens and on wild tobacco bush, S. mauritianum in eastern Australia, is expanded to include the following Solanaceae: rock nightshade, S. petrophilum, cape gooseberry, Physalis peruviana, and an undetermined species of angel's trumpet Brugmansia and Datura. New Zealand specimens of A. solanicola collected in early 2012 from S. mauritianum are the first record for this species from outside Australia, and possibly represent a very recent incursion. The potential for the solanaceous-inhabiting Psyllidae to vector Candidatus Liberibacter solanacearum, an economically important plant pathogen, on native Australian Solanaceae is discussed. The occurrence of A. credoensis and A. solanicola on native Australian Solanum supports the Australian origin for the solanaceous-inhabiting Acizzia psyllids.

  19. The variability of leaf anatomical characteristics of Solanum nigrum L. (Solana-les, Solanaceae from different habitats

    Directory of Open Access Journals (Sweden)

    Krstić Lana N.

    2002-01-01

    Full Text Available In Europe on the whole as well as in Yugoslavia, the most widespread weed species from the genus Solanum is Solanum nigrum L. Since this species inhabits different habitats, it developed several ways of adaptation to environmental conditions. The influence of ecological factors on plant organism and resulting plant adaptations are most evident in leaf morphology and anatomy. Therefore, the anatomical structure of leaves and leaf epidermal tissue of S. nigrum was analyzed and compared among plants that originated from different habitats, in order to determine leaf structural adaptations. S. nigrum lamina has the mesomorphic structure with some xero-heliomorphic adaptations. The differences in stomata number, number of hairs, thickness of lamina, palisade and spongy tissue, as well as the size of mesophyll cells have been noticed. The highest values for most of the parameters have been recorded for the plants from cultivated soil. Largest variations of the examined characters were found for the leaves from ruderal habitats, where environmental conditions are most variable.

  20. Influences of Biodynamic and Conventional Farming Systems on Quality of Potato (Solanum Tuberosum L.) Crops: Results from Multivariate Analyses of Two Long-Term Field Trials in Sweden.

    Science.gov (United States)

    Kjellenberg, Lars; Granstedt, Artur

    2015-09-15

    The aim of this paper was to present results from two long term field experiments comparing potato samples from conventional farming systems with samples from biodynamic farming systems. The principal component analyses (PCA), consistently exhibited differences between potato samples from the two farming systems. According to the PCA, potato samples treated with inorganic fertilizers exhibited a variation positively related to amounts of crude protein, yield, cooking or tissue discoloration and extract decomposition. Potato samples treated according to biodynamic principles, with composted cow manure, were more positively related to traits such as Quality- and EAA-indices, dry matter content, taste quality, relative proportion of pure protein and biocrystallization value. Distinctions between years, crop rotation and cultivars used were sometimes more significant than differences between manuring systems. Grown after barley the potato crop exhibited better quality traits compared to when grown after ley in both the conventional and the biodynamic farming system.