WorldWideScience

Sample records for plants miljoeeffekter av

  1. Environmental effects of large discharges of cooling water. Experiences from Swedish nuclear power plants; Miljoeeffekter av stora kylvattenutslaepp. Erfarenheter fraan de svenska kaernkraftverken

    Energy Technology Data Exchange (ETDEWEB)

    Ehlin, Ulf; Lindahl, Sture; Neuman, Erik; Sandstroem, Olof; Svensson, Jonny

    2009-07-15

    Monitoring the environmental effects of cooling water intake and discharge from Swedish nuclear power stations started at the beginning of the 1960s and continues to this day. In parallel with long-term monitoring, research has provided new knowledge and methods to optimise possible discharge locations and design, and given the ability to forecast their environmental effects. Investigations into the environmental effects of cooling-water are a prerequisite for the issuing of power station operating permits by the environmental authorities. Research projects have been carried out by scientists at universities, while the Swedish Environmental Protection Agency, the Swedish Board of Fisheries, and the Swedish Meteorological and Hydrological Institute, SMHI, are responsible for the greater part of the investigations as well as of the research work. The four nuclear power plants dealt with in this report are Oskarshamn, Ringhals, Barsebaeck and Forsmark. They were taken into operation in 1972, 1975, 1975 and 1980 resp. - a total of 12 reactors. After the closure of the Barsebaeck plants in 2005, ten reactors remain in service. The maximum cooling water discharge from the respective stations was 115, 165, 50 and 135 m3/s, which is comparable to the mean flow of an average Swedish river - c:a 150 m3/s. The report summarizes studies into the consequences of cooling water intake and discharge. Radiological investigations made at the plants are not covered by this review. The strategy for the investigations was elaborated already at the beginning of the 1960s. The investigations were divided into pre-studies, baseline investigations and monitoring of effects. Pre-studies were partly to gather information for the technical planning and design of cooling water intake and outlet constructions, and partly to survey the hydrographic and ecological situation in the area. Baseline investigations were to carefully map the hydrography and ecology in the area and their natural

  2. Environmental effects of the use of polymers in the biogas industry - Pre study; Miljoeeffekter av polymerer inom biogasbranschen - Foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Henriksson, Gunilla; del Pilar Castillo, Maria; Jakubowicz, Ignacy; Enocksson, Haakan; Ascue Contreras, Johnny; Lundgren, Per; Engstroem, Thomas

    2011-07-01

    Avfall Sverige - Swedish Waste Management's Steering Group for certification of digestate [1] got an inquiry from the biogas industry if the use of polymers as additive in the biogas process is allowed. A requirement according to the certification system is that any additive used must be free from negative effects on the digestate or the soil quality. This study is initiated because of the limited knowledge of how the use of polymers affects the environment. The study is intended to be used as a basis for a decision by the Steering Group concerning the use of polymers in digestate and for an approval by the agri-food industry. The purpose of this study is to gather basic knowledge on the polymers used in dewatering and to identify polymer candidates and analytical methods for further studies of degradation, accumulation and toxicity. The project is limited to include a literature review, a survey concerning the use of polymers at biogas and sewage treatment plants, an impact analysis and a compilation of relevant laws and directives through contacts with authorities. No laboratory or field tests are included in this study. Sewage treatment plants (STPs) were included in the survey as they have been using polymers for dewatering of sewage sludge for many years and therefore should have substantial knowledge about polymers and their environmental effects. According to the literature, the side chains of polyacrylamide (PAM) can be degraded both aerobically and anaerobically. However, the polymer backbone degrades slowly or not at all in the environment, possibly leading to accumulation. Reported effects of PAM on the biogas process are conflicting, showing both inhibitory effects and no effects on the biogas process. Knowledge about the environmental impacts to be expected from spreading polymer amended bio-manure or sewage sludge is limited. The authorities have not handled the issue before and have no further information. Polymer amended sewage sludge has been

  3. On evaluation of climate- and environmental effects in connection with implementation of new technology; Om vurdering av klima- og miljoeeffekter ved innfoering av ny teknologi

    Energy Technology Data Exchange (ETDEWEB)

    Aunan, Kristin; Fuglestvedt, Jan S.; Aaheim, H. Asbjoern

    1997-12-31

    This document was motivated by a proposal to establish a cogeneration plant at a Norwegian factory. The document briefly discusses the environmental impact of new technology. Normally new technology implies better solutions, including economy and environmental considerations. When a proposed project is being evaluated, all alternatives and their consequences should be studied. When emissions to air are considered, all relevant constituent components must be considered and seen in relationship to their total effect. This means that changes in the emission of the various components must be evaluated by considering the effects of existing pollution and the presence of long-range transported pollution in the region. As for the global environmental impact, the project and the alternatives must be seen in the light of the country`s commitment to international agreements. 2 refs.

  4. Pollen transmission of asparagus virus 2 (AV-2) may facilitate mixed infection by two AV-2 isolates in asparagus plants.

    Science.gov (United States)

    Kawamura, Ryusuke; Shimura, Hanako; Mochizuki, Tomofumi; Ohki, Satoshi T; Masuta, Chikara

    2014-09-01

    Asparagus virus 2 (AV-2) is a member of the genus Ilarvirus and thought to induce the asparagus decline syndrome. AV-2 is known to be transmitted by seed, and the possibility of pollen transmission was proposed 25 years ago but not verified. In AV-2 sequence analyses, we have unexpectedly found mixed infection by two distinct AV-2 isolates in two asparagus plants. Because mixed infections by two related viruses are normally prevented by cross protection, we suspected that pollen transmission of AV-2 is involved in mixed infection. Immunohistochemical analyses and in situ hybridization using AV-2-infected tobacco plants revealed that AV-2 was localized in the meristem and associated with pollen grains. To experimentally produce a mixed infection via pollen transmission, two Nicotiana benthamiana plants that were infected with each of two AV-2 isolates were crossed. Derived cleaved-amplified polymorphic sequence analysis identified each AV-2 isolate in the progeny seedlings, suggesting that pollen transmission could indeed result in a mixed infection, at least in N. benthamiana.

  5. Valuation of environmental effects long into the future; Verdsetting av miljoeeffekter langt fram i tid

    Energy Technology Data Exchange (ETDEWEB)

    Vennemo, Haakon

    1997-12-31

    This report documents a study of how long-time environmental effects can be valued within an economic calculation and why these effects often obtain low values. The first part of the report describes how to value long-time effects in the analysis. The second part discusses the results of an enquiry called ``Your attitude to discounting``, in which economists, natural scientists, engineers and other people were asked how, on behalf of society, they would assess various investment projects with and without environmental effects. They were also asked about their opinion on discounting and discount rate. Economists are found to give priority to environmental investments differently from other people and for two reasons. They know little about long-term environmental effects, and they differ in opinion from other people about how serious the long-term environmental effects really are. This may explain why many economic analyses value long-time environmental effects lower than non-economists think would be right. Non-economists, on the other hand, have a strong opinion on the basic environmental issues, but they are not familiar with valuation considerations and external conditions, shadow prices etc. Of the natural scientists, 75% suggested the optimum discount rate should be set to zero; although zero is hardly manifest in their selection among the suggested investment projects. The report concludes that the economists have work to do in communicating the finely differentiated possibilities of the pricing system in handling long-time environmental effects. 27 refs., 1 fig.

  6. Mine tailings - Environmental effects and need for measures; Gruvavfall - Miljoeeffekter och behov av aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Oeberg, K.; Lindahl, L.Aa.; Westin, E.

    1998-12-01

    The environmental effects of mining wastes is thoroughly treated. The main emphasis have been laid on what the present handling of mining wastes means with respect to leakage of metals, and what consequences to be expected in a longer perspective With 5 page summary in English. 37 refs, 5 figs, 4 tabs, 7 appendixes

  7. Cyclic operation of power plant; Cyklisk drift av kraftvaermeverk

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan

    2007-12-15

    The great majority of power plants are designed for base load operation with a relatively small number of starts and stops per year. Therefore, there has been no need to consider fatigue at design. Over the last few years operation with more frequent starts and stops exists as a consequence of swinging electricity prices that has become common. This involves significantly higher frequency of damages; not least fatigue relates damages, and the number of severe failures in components that never before have had damage problems may increase as well. In the present work the different types of component that may suffer from cyclic operation related damage are gathered by a literature survey and described as follows: - where and how the damages comes up, - constructions that should be avoided, - non-destructive testing (NDT) for damage that may come up under cyclic operation, - calculation and assessment of integrity of critical components - areas where continued research would be valuable. Recommendations have been put together to be used to prevent cyclic operation related damage and to detect it in time. The target group for this study is i) plant owners of plants where cyclic operation is or may be present, ii) researchers in the area, and, iii) inspectors and NDT-operators. There are quite a number of components where cyclic operation has been found to significantly influence the lift time. Some of these components are described in many papers whereas occasional papers have been found for others. The amount of information that is possible to get for a certain component is likely related to its significance for cyclic operation damage. The most frequently reported problem is ligament cracking of high temperature headers. Other components where extensive studies have been done are: wall panels, creep-fatigue loaded welds and turbine components

  8. Silencing of the AV2 gene by antisense RNA protects transgenic plants against a bipartite begomovirus

    Directory of Open Access Journals (Sweden)

    Zafar Yusuf

    2007-01-01

    Full Text Available Abstract Whitefly-transmitted geminiviruses (genus Begomovirus are phytopathogens that cause heavy losses to crops worldwide. Efforts to engineer resistance against these viruses are focused mainly on silencing of complementary-sense virus genes involved in virus replication. Here we have targeted a virion-sense gene (AV2 to develop resistance against Tomato leaf curl New Delhi virus, a bipartite begomovirus prevalent throughout the Indian subcontinent. We show that tobacco plants transformed with an antisense construct targeting this gene are resistant to the virus. Following challenged with the virus, transgenic plants remained symptomless, although viral DNA could be detected in some plants by PCR. This is the first report of transgenic resistance against a bipartite begomovirus obtained by targeting a virion-sense gene. The relatively conserved nature of the gene suggests that the technology may be useful to develop broad-spectrum resistance which is required because of the fact that plants are often infected with multiple begomoviruses in the field.

  9. Mercury emissions from crematories - distribution, environmental effects and effects of selenium addition; Emissioner av kvicksilver fraan krematorier - spridning, miljoeeffekter och effekter av selentillsats

    Energy Technology Data Exchange (ETDEWEB)

    Munthe, J.; Pleijel, K.; Schager, P.; Peterson, P.; Kindbom, K.

    1997-08-01

    The aim of this study was to evaluate possible effects of selenium additions on emissions of mercury from crematories and to assess the environmental impact of mercury emissions from crematories. Measurements were performed during 3 days under which time period 18 cremations were performed. Emissions of mercury were measured and compared to the input of mercury to each cremation to be able to calculate the method efficiency. At 10 of the cremations, selenium ampoules were added. The retention of mercury varied considerably between the individual cremations but no effects of the selenium additions could be found. The results show that out of the total emissions of mercury from crematories of 150-300 kg, 25-50 kg are deposited in Sweden and the remainder is transported out of the country. An estimate of the crematories contribution to the total deposition of mercury indicates that the crematories contribute 0,3-1 % of the total deposition of mercury in Sweden, of which a major part is attributable to emissions outside the Swedish borders. A calculation was also performed assuming that flue gas cleaning was installed on the 20 largest crematories in Sweden. The cleaning efficiency was set to 90 % of the in going mercury. For this scenario, the total atmospheric emissions will be 70-149 kg out of which 12-25 kg will be deposited in Sweden. This corresponds to 0,1-0,3 % of the total atmospheric load. Based on the results of the study presented above it is concluded that the contribution of the crematories to the total atmospheric deposition of mercury is small and that further measures to control emissions should be preceded by a discussion on priorities. 6 refs, 8 figs, 9 tabs

  10. Alternatives for handling of digestate from large biogas plants; Foeraedling av roetrest fraan storskaliga biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Aarsrud, Peter (Kretsloppskontoret Goeteborg (Sweden)); Bisaillon, Mattias (Profu (Sweden)); Hellstroem, Hanna; Henriksson, Gunilla (SP, Boraas (Sweden)); Jakobsson, Emma; Jarlsvik, Tisse; Martinsson, Ulf (Goeteborg Energi (Sweden)); Jensen, Carl (Renova (Sweden)); Johansson, Lars-Gunnar (Biogas Vaest/LRF (Sweden)); Kanerot, Mija (Boraas Energi och Miljoe (Sweden)); Ling, Daniel (Laeckeby Water (Sweden))

    2010-07-01

    Biogas plants located in city environments are becoming increasingly common in Sweden. More and more municipalities are electing to collect food waste for treatment in a biogas plant. The environment target of treating 35 % all organic waste biologically try to obtain from municipalities. Certain demands are placed on biogas plants and their system environments if they are to be able to treat food waste successfully. Firstly, there needs to be a use for the nutrient-rich biofertilizer product, and secondly it must be possible to clean the reject water before it is released to the recipient. The goal of the project is to conduct a system analysis from the economic and environmental perspectives to investigate what is the best alternative for dealing with the digestate and reject water for two biogas plants located in city environments. The plants used as the point of departure for the study are a planned biogas plant in Gothenburg and an existing biogas plant in Boraas. The plant in Boraas is planned to be included in an energy combine with ethanol production. The target group for the project comprises biogas plants built in city environments with the purpose of treating food waste, but also other plants that treat organic waste in a digester, e.g., sludge from sewage treatment works. Table 1 below shows the results for each technology studied. [Table 1 Results from system analysis.] The results of the system analysis show that the best alternative for Gothenburg, both from an economical point of view and when considering the climate impact, is to transport and spread the un-dewatered digestate directly onto arable land. On the basis of acidification and eutrophication potentials, the best alternative is to treat the reject water with the DeAmmon process. From the economic perspective, the best alternative for Boraas is to continue with the treatment method used today at the plant, that is, SBR. From the perspective of climate impact, the best alternative is to

  11. Increased utilisation of existing biogas plants; Oekat utnyttjande av befintliga biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Lantz, Mikael

    2007-09-15

    The purpose of this study is to analyse how existing biogas plants in Sweden could be utilised more efficiently, by increase the organic loading rate, and to calculate the cost efficiency of such measures. Biogas plants treating sewage sludge are currently operated with low organic loading rates and it is likely that there could be a considerable potential of increased utilisation of existing capacity. However, disposal costs of digested sewage sludge have a great impact on the economic result. Thus, the cost must be low, below 200 - 850 SEK/tonne DS, for co-digestion of sewage sludge and organic household waste to be economic competitive, compared to building of a new reactor. For co-digestion plants, using manure and organic waste as feedstock, it is not possible to say whether it is more economic to increase the utilisation of existing capacity or to increase the reactor volume. Therefore, more specific studies are required for individual plants and cases. Regarding the need for a more sophisticated monitoring and control of the biogas process, it can be established that the utilisation of sewage sludge digestion plants could be increased considerably without exceptionally high organic loading rates, thus probably without any additional monitoring and control. However, indicated prices for such applications are probably acceptable compared to establishing a new reactor. For co-digestion plants, the scope for investments is smaller and more dependent on the alternative cost for new reactors. Also, any process disturbances, which may appear even at low organic loading rates, could be very costly and result in costs in the same range as for monitoring and control equipment. Finally, the reader should observe that the analyses conducted here assume that funding and physical space for additional reactors is available at the existing site. If not, there could be situations where it is economic interesting to increase the organic loading rate although cost estimates

  12. More Electricity. Methodical survey of existing plants; Mer El. Metodisk genomgaang av befintliga anlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Baafaelt, Martin [Carl Bro Energikonsult AB, Malmoe (Sweden); Ifwer, Karin; Svensson, Niclas; Oehrstroem, Anna [AaF-Process AB, Stockholm (Sweden); Johansson, Inge [S.E.P. Scandinavian Energy Project AB, Goeteborg (Sweden)

    2006-11-15

    The interest in production of electricity has increased the last years as a consequence of the increased price. A high production of electricity is of interest for all kinds of CHP-plants. For large biofuel fired CHP-plants typical electrical efficiency is 35 %, for incineration plants the electrical efficiency is about 28 %. A number of reasons why it is not higher, for example corrosion, fouling, erosion, limited and varying need for heat, flue gas condensation etc, exist. A number of these reasons have earlier been studied in different Vaermeforsk reports. The results from these studies give to some extent solutions and understanding for how the production of electricity can be increased. There is however no report that has the overall picture of what actions are realistic, most cost effective, what areas need more research and gives the most benefit of allocated funds. The aim of this report is to identify the technical limitations and propose measures for increased electricity production at CHP-plants using biofuel and waste. A method for identification of the most suitable actions for each plant is also presented. The idea is to take every conceivable factor that affects electricity production into consideration and to be able to make a relevant comparison of the factors. This report doesn't take new solutions/measures and means of control into consideration. The method used is called 'Weighted Sum Method'. Every action is assessed in the means of different criteria as for example how it affects the environment, if it is profitable, if it means more maintenance etc. An extensive checklist for different conceivable measures for increased electricity production has been created. The checklist includes measures from the fuel storage to the chimney and makes a good guidance when making a review of a biofuel or incineration CHP-plant. Some of the measures can be eliminated immediately at review since they not are applicable or have already been done

  13. Availability assessment and risk assessment regarding handling and preparation of biomass in combustion plants; Tillgaenglighets- och riskbedoemning av system foer hantering och beredning av biobraensle i foerbraenningsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Biguen, Helen; Bodlund, Gunnar; Dahlloef, Lars; Pettersson, Lars [SwedPower, Stockholm (Sweden)

    2005-04-01

    In the design of new, or refurbishment of old, bio-fuel fired plants, the design of the fuel-handling systems is often based on experiences from existing plants. The size of the bio-fuel storage is decided from fuel consumption during a long holiday with no transports, and available storage area on the site. Auxiliary capacities and redundancies in the bio-fuel handling systems are often determined by investment costs rather than by life-cycle costs. Risk analyses are realized according to Swedish legislation for Occupation and Health and its regulations for work in environment with risk of explosion. The plant is designed to minimize the risk for explosion and also to minimize the consequences of an explosion. The plant is provided with fire protection functions according to applicable legislations and regulations. Safety functions can either be passive as physical separations or active as different kinds of detecting and consequence reducing systems. The aim of this report is to emphasize the use of quantitative tools for analysis to evaluate alternative system designs from the viewpoint of availability and risk. The availability analysis gives the opportunity to quantitatively analyse suggested alternative solutions of a system and to study the influence of redundant system functions, storage volumes etceteras. The analysis also gives the opportunity to evaluate effects on manning, work on three shifts or daytime with extra duty on call, as well as the optimization of spare parts toward delivery times and agreements for service. The probabilistic risk analysis gives opportunities to place in order of precedence and quantitatively evaluate the effect on total risk from suggested passive protective measures and different types of active protection functions such as fire sprinkling. The methods of analysis are above all an aid and support to optimize system design and life cycle cost during the design phase. During continuous operation the quantitative analyses are

  14. Follow-up of availability for cogeneration- and heating plants - a joint platform of experiences; Uppfoeljning av tillgaenglighet inom vaerme- och kraftvaermeverk - en branschgemensam plattform av erfarenheter

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Mats; Sfiris, George [Vattenfall Utveckling AB, Stockholm (Sweden); Andersson, Sven-Olof; Pettersson, Lasse [Vattenfall Energisystem AB, Stockholm (Sweden)

    2000-01-01

    The report before is a co-operation between Vattenfall Utveckling AB and Vattenfall Energisystem AB. Together with five biomass fueled heat plants or combined heat and power plants a database of operating experience from the operating seasons 1997-98 was built up. The plants that have contributed to the project are Haesselby Kraftvaermeverk, Naessjoe Kraftvaermeverk, Motala Vaermeverk, Kraftvaermeverket Heden 2 in Karlstad and Flintraennans Fjaerrvaermecentral in Malmoe. Even though all plants are biomass fueled, they still represent different techniques and sizes. With support of the data program TGU (Till Gaenglighets Uppfoeljning = Availability Follow-up) all faults that have an effect on the availability performance are registered by the staff on each plant. The data has been sent to Vattenfall where all fault events have been translated from the locally used terms to a common system standard according to the German KKS (Kraftwerk-Kennenzeichensystem). The data has been entered into a joint Microsoft Access database where all fault events from all plants can be saved and compared. The database also presents various search and report possibilities. The overall goal with this project was to create a platform to be able to structurally analyze unavailability and thereby on the long run increase the profitability for the owners of the plants. Even if the contents of the database still not are sufficient to draw any general conclusions from, the goals have been met. In spite of the fact that there have been problems in the course of the project, a functioning working routine has been prepared. If more plants will join in the second stage of the project, surely more valuable experiences will be brought back to the owners of the plants. The report period include all 1997 and 1998 (for Flintraennan and Motala only 1998). The observation period was 51,312 hours counted as calendar time, excluding revision periods. During that time a total of 201 faults have occurred

  15. Investigation of the responsibility for decommissioning of the Ranstad plant; Utredning av ansvaret foer Ranstadsverkets avveckling

    Energy Technology Data Exchange (ETDEWEB)

    Svensson, Haakan; Grundfelt, Bertil [Kemakta Konsult AB, Stockholm (Sweden); Froeberg, Magnus [Froeberg och Lundholm Advokatbyraa AB, Stockholm (Sweden)

    2010-11-15

    The issue of decommissioning, including demolition, of the nuclear facility at the Ranstad plant was raised gradually during 2006-2008. It was then found that it was unclear which company or companies that could be responsible for this decommissioning, economically as well as for the implementation. During this time and until the end of 2009, the concerned authorities, notably Swedish Nuclear Power Inspectorate and SSM, collected a large amount of facts as a basis for assessing liability. This material now needed to be systematized and compiled in order to effectively be utilized in such an assessment. SSM also thought that it would be helpful if an independent party with experience in similar issues could contribute to the interpretation of the legal situation. These were the given conditions of the mission which Kemakta Konsult AB, with the assistance of lawyer Magnus Froeberg, were given by SSM in the autumn of 2009. The results are presented in this final report.

  16. Availability assessment and risk assessment regarding handling and preparation of biomass in combustion plants; Tillgaenglighets- och riskbedoemning av system foer hantering och beredning av biobraensle i foerbraenningsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Biguen, Helen; Bodlund, Gunnar; Dahlloef, Lars; Pettersson, Lars [SwedPower, Stockholm (Sweden)

    2005-04-01

    In the design of new, or refurbishment of old, bio-fuel fired plants, the design of the fuel-handling systems is often based on experiences from existing plants. The size of the bio-fuel storage is decided from fuel consumption during a long holiday with no transports, and available storage area on the site. Auxiliary capacities and redundancies in the bio-fuel handling systems are often determined by investment costs rather than by life-cycle costs. Risk analyses are realized according to Swedish legislation for Occupation and Health and its regulations for work in environment with risk of explosion. The plant is designed to minimize the risk for explosion and also to minimize the consequences of an explosion. The plant is provided with fire protection functions according to applicable legislations and regulations. Safety functions can either be passive as physical separations or active as different kinds of detecting and consequence reducing systems. The aim of this report is to emphasize the use of quantitative tools for analysis to evaluate alternative system designs from the viewpoint of availability and risk. The availability analysis gives the opportunity to quantitatively analyse suggested alternative solutions of a system and to study the influence of redundant system functions, storage volumes etceteras. The analysis also gives the opportunity to evaluate effects on manning, work on three shifts or daytime with extra duty on call, as well as the optimization of spare parts toward delivery times and agreements for service. The probabilistic risk analysis gives opportunities to place in order of precedence and quantitatively evaluate the effect on total risk from suggested passive protective measures and different types of active protection functions such as fire sprinkling. The methods of analysis are above all an aid and support to optimize system design and life cycle cost during the design phase. During continuous operation the quantitative analyses are

  17. Optimized production of vehicle gas - an environmental and energy system analyses of Soederaasens biogas plant.; Systemoptimerad produktion av fordonsgas - En miljoe- och energisystemanalys av Soederaasens biogasanlaeggning

    Energy Technology Data Exchange (ETDEWEB)

    Lantz, Mikael; Ekman, Anna; Boerjesson, Paal

    2009-06-15

    In this study, an environmental and energy system analysis for a specific biogas plant is presented as well as suggestions and cost calculations for measures that could be implemented in order to optimise the system. The overarching purpose is also to present a model for similar studies of specific biogas plants. The analysis performed includes direct effects such as use of energy and emissions from the production of biogas, upgrading to vehicle gas, transport of substrate and digestate and storage and handling of digestate. Furthermore, indirect effects such as reduced methane leaching from conventional storage of manure, replacement of mineral fertilizers with digestate etc. are included as well. The energy balance for production and distribution of vehicle gas from Soederaasens biogas plant is calculated to 5,5 which could be compared to the energy balance for ethanol from wheat which is normally between 2 and 3. The greenhouse gas emissions are 16 gram CO{sub 2}-ekv./kWh, approximately 95 % lower compared to gasoline. In comparison, ethanol from wheat and RME reduce the emissions with some 80 % and 65 % respectively. The result is mainly affected of the methane leakage from the upgrading plant, reduced emissions of N{sub 2}O when digestate replaces mineral fertilizers and the assumptions made of how the electricity used in the system was produced. Regarding eutrophication, the emissions are calculated to 6 gram NO{sub 3}--ekv./kWh, primarily originating from storage and handling of digestate, which is somewhat lower than the reported emissions from production of ethanol and RME. Covering the digestate storages and produce process heat with wood chips, measures estimated to be cost neutral or even profitable for the biogas producer, is calculated to reduce the emissions of greenhouse gases to -13 gram/kWh. If all measures identified would be implemented, the emissions are reduced with 120 % with an extra cost of some 0.01 SEK/kWh vehicle gas

  18. Evaluation and development of methods for determining methane emissions from biogas plants - Literature Study; Vaerdering och utveckling av maetmetoder foer bestaemning av metanemissioner fraan biogasanlaeggningar - Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Holmgren, Magnus Andreas (SP, Boraas (Sweden)); Willen, Agnes; Rodhe, Lena (JTI, Uppsala (Sweden))

    2011-11-15

    Previous work in areas such as framework of voluntary commitment shows that there is a need for techniques for measurement of methane and other greenhouse gases from various sources in the handling of organic residuals. There are no established methods for determining for instance emissions of methane from open or partially open tanks and cisterns, typically residue storage and the like. This report gives results from Phase 1 of this project, in which literary studies, market research studies, interviews and site visits have been made to identify a number of methods applied for the determination of emissions from open areas, such as liquid surfaces, but also land. Focus is on methods that can be applied to plants for biological treatment, which also includes the water treatment process at the treatment plants, but also the procedures used in measurements on land, landfills and processing plants are studied. First, the report gives a brief overview of a large number of measurement methods, where more detailed descriptions of four methods are given. The four methods are considered to be the most promising to pursue in the following phases of the project: - chamber technology; - sampling hood; - plume measurement with DIAL (Differential Absorption Lidar); - air input in a covered storage.

  19. Cleaning of condensate from flue gas condensing plants at co-combustion of waste fuels. Follow-up of emissions; Rening av kondensat fraan roekgaskondenseringsanlaeggningar vid samfoerbraenning av avfallsbraenslen. Uppfoeljning av utslaepp

    Energy Technology Data Exchange (ETDEWEB)

    Sundquist, Lena; Dejfors, Charlotte; Wrangensten, Lars [AaF Energikonsult AB, Stockholm (Sweden)

    2002-03-01

    Limits of discharges in waste water at flue gas cleaning are one of the fields included in the EC-directive (2000/76/EG) regarding combustion of waste from December 28th, 2000. The pollutants included in the limits are suspended material, Hg, Cd, Tl, As, Pb, Cr, Cu, Ni, Zn as well as dioxins and furans. The limits of the directive applies generally for plants with combustion of waste, regardless of type of waste fraction, the degree of admixture or if it is a so called co-combustion plant or not. For new plants, the limits shall be fulfilled within two years after the date of the directive whereas existing plants have another three years to meet the new demands. In this project, the condensate from the flue gas has been analysed at five different combustion plants. Samples of the fuel have also been analysed as a reference at the evaluation of the results. The results from the analysed condensate have then been compared and evaluated with regards to the limit values in the EC-directive. However, one exception is dioxins and furans that are not included in this study. The analysis of the pure condensate show that at most plants the content of pollutants is below, or in some cases well below, the limits of the EC-directive. At plants with co-combustion of recovered biofuels, even the contents of pollutants in the non-purified raw condensate are below the limits of the directive. This means that plants with co-combustion of recovered wood waste and biofuels most likely will meet the requirements for emissions to waste water in the EC-directive. The water treatment process in these plants normally consists of a pH-adjustment stage followed by adding of chemicals before the condensate enters into a sand filter. The cleaned condensate from the sand filter is normally released to a recipient whereas the dirty condensate goes through a lamell separator in order to separate rest sludge. The most polluted raw condensate was found at a plant with 100 % combustion of municipal

  20. Testing of energy assessment of technical plants, in accordance with the Energy Performance of Buildings Directive, EPBD; Testing av Energivurdering av tekniske anlegg iht Bygningsenergidirektivet, EPBD

    Energy Technology Data Exchange (ETDEWEB)

    Birkeland, Harald

    2008-06-15

    The consulting company Norwegian Energy has previously worked out proposals for inspection systems for technical plants, in accordance with the EU Energy Performance of Buildings Directive, abbreviated EPBD. This project has consisted in practice testing of the proposed inspection systems. In this respect agreements have been made with a number of companies working with heating boiler inspections as well as ventilation and cooling. Testing experiences have been summed up in this report. The most important experiences from this project concern practical matters: The main challenge is to find data and documentation on the plant. Use of time and resources is part of this challenge. The forms must be simplified, with less information to fill in. Some adjustments have been proposed to the previously proposed procedure. The content of the inspection should be clearly defined, without any options for simplifications. Eligibility requirements: There is clearly a need for training and certification procedures for companies/persons which are permitted to carry out inspections according to the EPBD. A proposal for such procedures has been worked out. The inspection should contain both a declaration of impartiality and a guarantee from the inspector that all identified points of improvement have been described. (EW)

  1. Peat 2003. Production, use, environmental impact; Torv 2003. Produktion, anvaendning, miljoeeffekter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-06-01

    This report discusses the use of peat for energy production and other purposes, laws and other regulations affecting peat production and use, environmental impact, market situation and international statistics regarding peat production. In Sweden, the extraction and use of peat for energy production is regulated by several laws. Harvesting concessions must be approved by the county council. All combustion plants must be reported, or verified by regional or central authorities, depending on the size of the plant. Most important in this process is to verify the maximum emission levels permitted for sulphur, nitrogen oxides, particles, etc. Since 1991, a law on municipal energy planning requires descriptions of environmental consequences. Thus, environmental considerations must govern energy planning. Energy taxation in Sweden was changed in 1993. At present, the sulphur tax on fuel peat amounts to SEK 30 per kg of sulphur. Nitrogen oxides are also subject to a tax of SEK 40 per emitted kg. For peat, energy and environmental taxes total SEK 0.02 per kWh, excluding VAT. Peat harvesting for the production of energy aroused interest in the early 1980s as a consequence of the increased energy prices. In 2003, about 2,628,000 cubic metres of fuel peat were harvested in Sweden. The fuel peat is used mainly for production of hot water in district heating plants. In 2003, the total use of fuel peat amounted to 4,0 TWh. In addition to fuel peat, about 1,825,000 cubic metres of peat litter (mainly for horticultural use) was produced. In 2003, imports amounted to 382,3000 metric tons or 1.3 million cubic metres of peat. Exports amounted to 103,000 metric tons, consisting primarily of peat for horticultural use. The peat market in Sweden is divided into the energy market and the cultivation market. Political decisions regarding combustion taxes have a great impact on the competitive advantages of different fuels. The major competitors to peat are coal, oil, and renewable energy

  2. Katodisk beskyttelse av umbilicals

    OpenAIRE

    Mjølhus, Bjarte

    2008-01-01

    Ulike sider ved bruk av sinkbånd til korrosjonsbeskyttelse av karbonstål umbilical er evaluert. Det er utført litteraturstudie ved gjennomgang av tidligere rapporter, sammenligning av standarder og artikkelsøk. Langtidsforsøk med egne korrosjonsceller ble utført over 2 måneder for å undersøke korrosjonsbeskyttelse ved 4 ulike temperaturer. Det ble også gjort undersøkelser av korrosjonsbelegg i SEM for å undersøke og sammenligne med publiserte data. Åpen krets potensialet viste seg å ligge ...

  3. Study of flue gas condensing for biofuel fired heat and power plants; Studie av roekgaskondensering foer biobraensleeldade kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Gustafsson, J.O.; Nystroem, Johan; Johansson, Kent

    2000-11-01

    This report considers questions regarding flue gas condensing plants connected to bio-fuelled heat and power plants. The report consists of two parts, one where nine existing plants are described regarding technical issues and regarding the experience from the different plants. Part two is a theoretical study where heat balance calculations are made to show the technical and economical performance in different plant configurations and operating conditions. Initially the different parts in the flue gas condensing plant are described. Tube, plate and scrubber condensers are described briefly. The different types of humidifiers are also described, rotor, cross-stream plate heat exchanger and scrubber. Nine flue gas-condensing plants have been visited. The plants where chosen considering it should be bio-fuel fired plant primarily heat and power plants. Furthermore we tried to get a good dissemination considering plant configuration, supplier, geographical position, operating situation and plant size. The description of the different plants focuses on the flue gas condenser and the belonging components. The fuel, flue gas and condensate composition is described as well as which materials are used in the different parts of the plant. The experience from operating the plants and the reasons of why they decided to chose the actual condenser supplier are reported.

  4. AVS on satellite

    Science.gov (United States)

    Zhao, Haiwu; Wang, Guozhong; Hou, Gang

    2005-07-01

    AVS is a new digital audio-video coding standard established by China. AVS will be used in digital TV broadcasting and next general optical disk. AVS adopted many digital audio-video coding techniques developed by Chinese company and universities in recent years, it has very low complexity compared to H.264, and AVS will charge very low royalty fee through one-step license including all AVS tools. So AVS is a good and competitive candidate for Chinese DTV and next generation optical disk. In addition, Chinese government has published a plan for satellite TV signal directly to home(DTH) and a telecommunication satellite named as SINO 2 will be launched in 2006. AVS will be also one of the best hopeful candidates of audio-video coding standard on satellite signal transmission.

  5. Optimal integration of energy at the Combined Energy Plant in Norrkoeping -Integration of steam, hot water and district heat to biogas plants; Optimal integrering av energianvaendningen vid energikombinatet i Norrkoeping -Integrering av aanga, hetvatten och fjaerrvaerme till biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Benjaminsson, Johan; Goldschmidt, Barbara; Uddgren, Roger

    2010-09-15

    The background of this report is to investigate and highlight the benefits of establishing a biogas plant nearby a combined energy plant where steam and district heat is available. By using heat from the combined energy plant, more biogas can be produced as vehicle fuel instead of being used as fuel to heat the digester, the biogas upgrading plant or the dryer. The project's objective is to analyze where it is interesting with integration of heat to the biogas plant and to compare alternative technologies and possible integration options. The stakeholders of the study are industries with access to organic matter for biogas production and heat producers who can deliver thermal energy into biogas plants. The project was implemented by collection of information from the Haendeloe combined energy plant outside Norrkoeping where there is a cogeneration plant, an ethanol plant and a biogas plant. Case studies for the study have been carried out with proposals regarding how heat flows from the power plant and ethanol plant can be further integrated with the biogas plant. As case studies, both the current design of the biogas plant, as well as a fictional case in which half of all distillery residues was digested, have been evaluated. The case studies show that in today's biogas plant it is not economical to replace the existing biogas upgrading unit with water absorption to chemical absorption. The upgrading cost with water absorption at today's smaller facility is 0.11 kr/kWh and in order to obtain the same total cost of chemical absorption a steam price of 0.15 kr/kWh is required. For large gas flows, chemical absorption is an advantage since the technology is more suitable for upscaling in comparison with water absorption that must be delivered in multiple lines. Nevertheless, a possibility to recover waste heat from chemical absorption is necessary if the technology shall be competitive. If waste heat from both water absorption and chemical absorption

  6. Modelling of a hybrid plant and development of a control system for the Vaesthamn plant based on artificial neural networks; Modellering av hybridanlaeggning samt utveckling av oevervakningssystem foer Vaesthamnsverket baserat paa Artificiella Neurala Naetverk

    Energy Technology Data Exchange (ETDEWEB)

    Assadi, Mohsen; Fast, Magnus [Lund Inst. of Technology (Sweden). Dept. of Energy Sciences

    2006-12-15

    The project aim is to model the hybrid plant at Vaesthamnsverket in Helsingborg using artificial neural networks (ANN). The definition of a hybrid plant is that it uses more than one fuel, in this case a natural gas fuelled gas turbine with heat recovery steam generator (HRSG) and a biomass fuelled steam boiler with steam turbine. The models in the present project are based on operational data from the plant in contrary to previous projects where synthetic (simulated) data has been used in a large extent. The gas turbine represents the subsystem that has received most attention in previous projects, which will also be the case for the present project although models of the HRSG, steam boiler and steam turbine are created since the whole plant is of interest. The completed ANN sub modules are connected in a network, which can be used for e.g. offline simulation and real-time condition monitoring of the plant. A product, including all sub modules, is created in shape of a user-friendly interface in an MS Excel environment. This user interface can be used for continuous monitoring, training personnel and in planning of the operation. The target group is the plant owners and the original equipment manufacturers (OEM). The plant owners interest lies in receiving a product that can assist them when operating the plant, for instance supply them with information about the grade of degradation. The OEMs main interest lies in investigating the possibilities of delivering ANNs, based on synthetic data, along with their new gas turbines. Vaesthamnsverket have contributed with operational data from the plant as well as support in plant related questions. Siemens have contributed with expert knowledge about their gas turbine, the SGT800. The received data has been examined and filtered before used for training ANN models. The models have been evaluated with independent data. The results are very promising with ANN models showing high prediction accuracy. All subsystems can be

  7. DESIGN AV FREMTIDENS KUMLOKK

    OpenAIRE

    Breien, William Topper

    2014-01-01

    Denne oppgavens mål har vært å utvikle et nytt design for kumlokk. Det nye designet skal være lettere enn utgangspunktet. Dette har blitt gjort ved hjelp av en iterativ designprosess, styrkeberegninger i Siemens NX 8, simuleringer av støp i Magmasofts MAGMA5, prøvestøping og testing ved støperiet til Ulefos Jernværk i Ulefoss. Denne rapporten inneholder teoretisk bakgrunn og beskrivelse av metoder tatt i bruk ved utvikling av nytt design, simulerin...

  8. Decommissioning of nuclear power plants in the US - a travel report; Avveckling av kaernkraftverk i USA - en reserapport

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, H.; Lindhe, J.C.; Malmqvist, L.; Lund, I.; Welleman, E

    1999-03-01

    This report summarises information and impressions from a journey in north-east USA. The purpose of the journey was to study the on-going decommissioning of nuclear power plants - mainly how it is regulated by the competent authorities, but also how it is performed in practice. The journey included visits at the US Nuclear Regulatory Commission, the company Duke Engineering and Services, and the two nuclear power plants Haddam Neck and Maine Yankee

  9. On the need for new continues measurement techniques at combustion plants; Anlaeggningars behov av ny kontinuerlig maetteknik

    Energy Technology Data Exchange (ETDEWEB)

    Eskilsson, David; Samuelsson, Jessica [Swedish National Testing and Research Inst., Boraas (Sweden)

    2006-11-15

    The purpose of this study is to make an inventory regarding the need for new continuous measurement techniques at combustion plants in Sweden. In total 15 interviews at 15 different combustion plants were made. The interviewed plants are of different sizes and use different combustion techniques, fuels, and cleaning equipments. They thereby well reflect the combustion plants present in Sweden today. Among many interesting interview results, we chose to highlight: Continuous measurement of the moisture content of the fuel, which can be used to decide the value of a fuel delivery, or for monitoring or to controlling the combustion (e.g. the speed of the grate); Continuous measurement of the heating value of the fuel, which can be used to decide the value of a fuel delivery, or for monitoring or to controlling the combustion. There is a need for temperature sensors which better withstand the environment in the furnace. Moreover, there is also a need for 3-dimensional measurements of the temperature in the furnace, especially for fluidized beds. This information can be used to control the combustion in different ways, e.g. preventing the bed from sintering. At some plants there was a need to measure the rate of corrosion and the growth of deposits. The measurements can be used to control the fuel mix at an early stage and to thereby avoid problems caused by corrosion and deposits. The measurement results can also be used to control the soot cleaning equipment, fuel mixture and adding of additive. At some of the interviewed plants there was a need to continuously measure the amount of unburned fuel in the ash. The continuous measurement results can be used for automatic control or monitoring of the combustion process. Several plants had problems with their dust instruments. Suitable topics for future work include investigating how the measurement techniques mentioned above may be developed/improved and implemented at the plants.

  10. Adjustment of machine equipment in heating plants to facilitate addition of straw fuel; Anpassning av vaermeverksutrustning till halminblandning

    Energy Technology Data Exchange (ETDEWEB)

    Stridsberg, Sven [BIOSYD (Sweden)

    1999-10-01

    The ground of the project is a development work, carried out by BIOSYD according combustion of straw in heating plants. First we have handled combustion experiments with addition of straw in some plants working with wood fuels, mainly with good results. In the next step we have worked with new techniques for handling and delivery of straw to the plants, also including experiments with chopping of the straw on the field, storing it in outdoor uncovered piles and consequently delivered in the shape of 'chips' to the heating plant. The whole cycle from cutting to combustion has been checked. The results indicate a possible price of the straw at the heating plant of approx 85 SEK/MWh, which can easily compete with wood fuels. The present project will describe which adjustments of the machine equipment are needed to allow a 25 % addition of straw in the fuel mix, how much these adjustments will cost and if they should be profitable in competition with wood fuels for 110 SEK/MWh. In total 37 heating plants from Skaane up to Uppland have been visited and the process from fuel reception to combustion analyzed. The costs of adjustments needed have been calculated from similar examples. The main impression from the studies is that the fuel reception has too small volumes to allow more numerous kinds of fuel and specially make it possible to give a good mix. This is often not critical for wood fuels but for straw we must guarantee a good mix to get a good combustion. Other critical points are crossings between conveyors, for example dips and feeding out devices, which often have to be adjusted. In the combustion there is a risk for sintering as well as coatings on tubes and walls. These functions must be avoided by air distribution, feed back of fuel gas and better carbon removing. In our analyses we would have judged on results from practical tests, but as this would have been too extensive, we must trust in former experiences, transferred to respective plants. Our

  11. Increased electrical efficiency in biofueled CHP plants by biomass drying; Oekat elutbyte i biobraensleeldade kraftvaermeanlaeggningar med hjaelp av foertorkning

    Energy Technology Data Exchange (ETDEWEB)

    Berntsson, Mikael; Thorson, Ola; Wennberg, Olle

    2010-09-15

    In this report, integrated biofuel drying has been studied for two cases. One is the existing CHP plant at ENA Energi AB in Enkoeping and the other is a theoretical case. The thought plant is assumed to have a steam generating performance that is probable for a future CHP plant optimised for power production. The CHP plant at ENA Energi with its integrated bed drying system has been used as a model in this study. The plant has a grate fired boiler with the capacity to co-produce 24 MW electricity and 55 MW heat. It is designed to use biofuel with moisture content between 40 and 55 %. However, the boiler is able to manage even dryer fuels with the moisture content of about 35 % without complications. Since the boiler operates on part load during most of the season, there are free capacity which can be used for delivering heat to the drying system. The increased power production is a result of mainly two factors: Increased demand of heat as the dryer uses district heating and thus improved possibility to produce steam; and, The season of operation can be extended, since the point where the minimum load of the boiler occurs can be pushed forward as a result of increased demand of heat. For future CHP plants, an optimised plant has been used as a model. The steam data is assumed to be 170 bar and 540 deg C with reheating. For this plant, both on-site and offsite drying have been studied. The case study comprises a whole season of operation and the fuel is assumed to be dried from 50 to 10 %. The size of the optimised plant is as to fit the dimension of a main production unit in a district heating net equal to the tenth largest in Sweden. Heat delivery is assumed to be 896 GWh/year and the maximum heat delivery of district heating is 250 MW. The sizing of the boiler is made to maximise the production of electricity, and thus dependent of the drying strategy used. Flue gas condensation is assumed to be used as much as possible. It decreases the basis for power production

  12. NDT methods for life-time assessment of high temperature plant; Ofoerstoerande provning foer livslaengdsbedoemning av hoegtemperaturanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, J. [Swedish Inst. for Metals Research, Stockholm (Sweden)

    1996-10-01

    A comprehensive literature study of NDT and analysis methods for residual life-time assessment of high temperature plant has been made. The study has been concentrated on components in boilers, steam piping and turbines in fossil fired power plant. Most types of components are exposed to creep which is also the life-time limiting mechanism in many cases. In addition to creep, other stresses and damages which appear in plant are described for each type of component. Thermal fatigue, corrosion and embrittlement as well as combined damage mechanisms are also life-time limiting in many cases. The literature shows a large number of NDT methods developed and under development in purpose to identify and measure the size and extent of damage in the components. The methods and their limitations are described in relation to the experience and understanding of character, distribution and development of damage in different situations. 83 refs, 12 figs, 1 tab

  13. Evaluation of the first SCR-plants in Sweden; Utvaerdering av de foersta SCR-anlaeggningarna i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Hanell, B. [Vattenfall AB, Stockholm (Sweden)] [and others

    1996-05-01

    This report presents operational experience of SCR systems at five power plants in Sweden; the diesel cogeneration plants in Linkoeping, Oskarshamn, Skultuna and Visby and the coal fired power plant in Vaesteraas. The experience represents the first years of operation of the SCR systems. The SCR-systems involved in this project achieve the following: * Uneven flue gas flow and concentration of ammonia and NO{sub x} through the SCR reactor results in lower efficiency. Hence it is important to achieve a thorough mixing of the ammonia in the flue gas in order to achieve high NO{sub x} reduction efficiencies, * Inferior control systems can cause unnecessary ammonia slip, * The diesel plants with an operating time of a couple of thousand hours have had major problems with deposits on the catalyst surface, * Guarantees regarding the lifetime of the catalyst are important. At commissioning the catalyst has to be over-dimensioned since the system has to reach the guaranteed emissions during the whole guarantee period, * There should be enough space in the reactor to install additional catalyst layers. This project verifies that additional layers need to be installed at later stages, * The mechanical construction of the SCR-reactor is important. The efficiency decreases when there is a leakage of flue gases past the reactor, * No considerable amounts of N{sub 2}O are generated by the catalyst. 21 refs, 27 figs, 47 tabs

  14. Survey results of corroding problems at biological treatment plants; Kartlaeggning av vittrings- och korrosionsskador paa biologiska behandlingsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Boubitsas, Dimitrios; Aakesson, Urban (CBI, Boraas (Sweden)); Hellstroem, Hanna; Henriksson, Gunilla (SP, Boraas (Sweden))

    2010-03-15

    Problems regarding that leachate from food waste have been corroding vehicles and concrete slabs has been reported by Biogas- and composting plants. This is an issue that has been reported to Swedish Waste Management more often within the same pace as the volume of food waste gathering is increasing all around Sweden. The problem has also been addressed at inspections according to SPCR 120 Biogoedsel and SPCR 152 Kompost, where several plants have requested guidance/support/investigation to help solve their specific issue. Swedish Cement and Concrete Research Inst., has earlier completed some investigations which have been ordered by private plant owners/municipalities and the result from these investigations have often proved that the exposure classification has not been adjusted for its purpose. There is no clear definition regarding construction of concrete that is meant for usage in a receiving hall for food waste. It is likely that concrete for Biogas- and Composting plants are built to meet the demands of agricultural environments. The project will examine the magnitude of the problem regarding corrosion- and weathering damage on concrete slabs and cisterns at biological treatment plants. The project will also culminate to actual solutions for plants that are hit and to give advice to those in the danger zone and those who plan for new constructions. Through a survey handed to Biogas- and composting plants around the country, the width of the problem has been examined and what solutions plants have found and executed to solve this issue. A literature review has been implemented to find specific demands regarding concrete that is meant for a certain environment. Another four treatment plants have been examined. The studies that have been made are chemical analysis of leachate from food waste, analysis of drill cores and analysis of reinforcement corrosion. The results from this project show that concrete doesn't have enough resistance in these

  15. Verdsetting av brukermedvirkning ved utforming av skoleanlegg

    Directory of Open Access Journals (Sweden)

    Else Margrethe Lefdal

    2015-03-01

    Full Text Available Ved planlegging av offentlige bygninger i Norge forutsettes det at brukerne medvirker i prosessen. Dette er forankret i lov- og avtaleverk og motiveres ved at brukerne innehar en kompetanse som er av betydning for byggenes funksjonalitet. I denne artikkelen vil jeg belyse brukermedvirkningsproblematikk i planleggingen av et skoleanlegg for videregående opplæring. Tilgjengelige plan- og byggesaksdokumenter i den aktuelle fylkeskommunens digitale og fysiske arkiver er blitt analysert. I referater fra brukermøtene fremmes det for eksempel ønsker fra brukerne om begrenset bruk av glass. Det ferdige skole-anlegget har imidlertid utstrakt bruk av innvendige glassvegger, men det er ikke dokumentert diskusjoner knyttet til bestemmelsen av dette. Et profesjons- og maktperspektiv er relevant for å forstå hva som blir verdsatt, og hvilke strukt-urer og mekanismer som har påvirket planleggings­prosessen. De sentrale aktørgruppene er skoleeier og representantene for lærer- og arkitekt-profesjonen. Omfattende bruk av innvendig glass i skoleanlegget tolker jeg som et kompromiss mellom skoleeiers ønske om åpenhet og kontroll, lærernes ønske om mindre støy og arkitektens ønske om å skape romfølelse og visuelle siktlinjer.AbstractWhen planning public buildings in Norway, it is expected that users are involved in the process. This is grounded in legislation and agreements, and motivated by the idea that users have an expertise which is significant for the planning of the building’s functionality. The aim of this article is to investigate user participation in planning the school facilities for a secondary school. I have analyzed planning and building documents available in government records, digital and physical. In the reports from meetings with user groups, it is for example stated that users want to limit the use of glass. However, the completed school building has extensive use of glass dividing walls, but any discussions leading to this

  16. Best possible cycle chemistry control in steam turbine plants; Baesta moejliga oevervakning av vattenkemin i anlaeggningar med aangturbin

    Energy Technology Data Exchange (ETDEWEB)

    Hellman, Mats [Hellman Vatten AB, Stockholm (Sweden)

    2004-11-01

    A project has been conducted of a large number of power and pulp plants in Sweden. Production managers and those responsible for water quality control were visited and interviewed. In addition, a research of cycle chemistry literature has been conducted to determine what has been done in other countries. The review of this literature shows that the Electric Power Research Institute in the USA and ESKOM in South Africa are in the forefront regarding QA/QC and have come a long way in water control management. A key requirement for successful plant cycle chemistry is corporate management support. The project makes it clear that cycle chemistry control was best at plants where production management was aware of the importance of high water quality. There is a real need for feed water technique and water quality education at all company levels. The objective should be that 'everyone should know the importance of right water quality'. Personnel without an education in chemistry often regard cycle chemistry as somewhat complicated. Better understanding and better working cycle chemistry control can be obtained by making the control easier and clearer for persons without training in chemistry. Extensive on-line instrumentation with well-designed systems for presenting the data, by-far, gives the best cycle chemistry control. It is important to have a holistic view when water treatment systems and on-line instrumentation are planned. It is not the amount of instruments or the number of chemistry personnel that is important. The important thing is to ensure that all functions needed fit together in the best way possible. Today, when cycle chemistry monitoring is heavily dependent on on-line instrumentation, the reliability of the instruments is crucial. Therefore, it is important to have well-established routines for maintenance, calibration and service. In order to decrease forced outages of plants due to poor cycle chemistry, the focus of chemistry control should

  17. Effects of slash extraction on plant diversity in forests. Final report; Effekter av grotuttag paa vaexters maangfald. Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Aastroem, Marcus; Nilsson, Christer [Umeaa Univ. (Sweden). Dept. of Ecology and Environmental Science

    2005-09-01

    This project includes three studies designed to investigate the effects of slash extraction on forest plant diversity. The first study explores the previously unknown effects of commercial slash harvest after clear-felling on bryophytes and vascular plants. Differences between conventionally harvested (i.e. slash left) and slash-harvested stands were investigated 5-10 years after clear-cutting through analysis of 28 paired stands. In each stand we studied vegetation patterns in 0.1 ha plots divided into five 0.02 ha subplots. Species composition of mosses and liverworts in 0.1 ha plots was significantly affected by slash harvest, whereas composition of vascular plant species showed no differences between conventional and slash harvested plots. Species richness of liverworts was significantly reduced by slash harvest in plots of both sizes (0.1 ha and 0.02 ha), whereas moss richness was reduced only in the smaller plot size. The loss of liverwort species was largest, with approximately one third of the species disappearing. The species richness of vascular plants was not significantly affected by slash harvest in either plot size. Slash harvest also reduced species richness of forest bryophytes and of bryophytes typically growing on organic substrates in open habitats. Species richness of non-forest bryophytes on inorganic substrates remained unchanged. The second study evaluates the effects of slash-cover on ground living bryophytes in seven different clear-cuts. By transplanting ten different species of bryophytes in manipulated plots located to north-facing forest edges and the centres of the clear-cuts) we evaluated the effects of branch cover and full exposure on bryophyte growth and vitality. In the more sheltered, north-facing plots there was no difference between treatments. In the centre of the clear-cuts, however, both growth and vitality of exposed bryophytes were significantly lowered in exposed compared to covered plots. The third study investigates the

  18. Recommendations for replica testing of high temperature components in power plant; Rekommendationer foer replikprovning av hoegtemperaturkomponenter i kraftanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan [Det Norske Veritas AB, Stockholm (Sweden)

    2000-08-01

    Replica testing is a non-destructive testing method where the microstructure of the surface of a component is replicated. This involves careful metallographical preparation which in some points also should be adapted to the aims of the investigation. There are published guidelines for replica testing of high temperature components in power plant, for instance by Nordtest, but these may be considered to be insufficient to assure the required quality and reproducibility of the replicas. There are no certification systems for the replica method in Sweden as well as abroad and the experience has shown that differences in the performance that existing praxis can involve may give significant influence on the results when the replicas are evaluated. In the present project recommendations have been compiled for replica testing with regard to creep damage on occurring heat resistant steel types in Swedish power plants. The recommendations consist of guidelines for metallographical replication in the field and cover: - Test positions at weldments and pipe bends; - Equipment; - Rough and fine grinding; - Macro-etching; - Electrolytic and mechanical polishing; - Etching; - Replication; - Documentation and storage; - Personnel. They describe differences in the testing of the different materials and the purpose is to assure replica testing of the highest quality and reproducibility. The recommendations have been compiled by use of guidelines and company standards as a starting point. Some points in the recommendations refer to trials for verification which have been carried out within the frame of the project. The trials have been focused on the appearance of creep damage and microstructure in different established methods for polishing and etching. Comments and closer descriptions for some points of the test procedures are given in an appendix to the recommendations.

  19. Guideline for inspection of plant concerning creep below the limit temperature; Stoed vid besiktning av anlaeggningar avseende krypning under graenstemperaturen

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan; Bjurstroem, Henrik; Weilin Zang; Andersson-Frejd, Ulf

    2007-12-15

    In an earlier report from Vaermeforsk, Inspecta and AaF mapped the extent of the problem of creep damage in several components of steam systems in power plants, which systems operate at temperatures below the lower limit for creep. Recommendations were issued regarding inspection of components where creep damage may occur. The authorities have issued a new regulation, AFS 2005:3 regarding inspection of pressure vessels, extending the requirement for inspection against creep fracture down to 350 deg C. This extensive inspection and testing is though considered as costly by the plants. A simplified inspection routine has been requested so that status regarding creep in exposed components may be determined at a more reasonable cost. In the present follow-up project, the goal was to provide a more comprehensive basis for the recommendations on methods for identifying exposed components. This has included: Collecting information from the replica tests that have been carried out during 2006 and 2007 as a complement to the documentation in the earlier project; Verifying the usability of analyses of elastic stresses; Additional simulations with FEM with the purpose of identifying critical geometries of components and positions. Information has been gathered from 11 replica inspections during the last two years. Creep damage has been observed in every case. In two of them, micro and macro cracks were observed. Eight of the remaining nine had significant occurrences of creep cavities. Damage has occurred also below 450 deg C, which was hitherto unknown. Excessive temperatures may have occurred in one of the two cases; defects and high system stresses are the probable causes of the other case. Positions where the most severe creep damage was observed were not the same as those with the highest stresses in the elastic stresses analysis. Therefore, components which are prone to damage according to experience, e.g. T-joints, should also be tested, even if the utilisation is

  20. AV dissociation, an inevitable response.

    Science.gov (United States)

    Wang, Kyuhyun; Benditt, David G

    2011-07-01

    The independent activation of the atria and ventricles, AV dissociation, is a common phenomenon that occurs during a wide variety of electrophysiologic circumstances. The clinical significance of AV dissociation is often misunderstood. This article examines the basis and clinical implications of AV dissociation. AV dissociation is often an obligatory, secondary phenomenon, and should not be construed as the primary disorder; it may be due to either the AV conduction system being completely blocked (3° AV block) or the P wave and the QRS complex being generated from separate sources (usually, the AV junction or ventricle) but occurring close together during the physiologic refractory period of each other. The latter may happen in junctional or ventricular arrhythmias including escape or accelerated rhythm, tachycardia, or premature beats. The crucial clinical point is not the AV dissociation itself, but that an underlying triggering primary disorder is present and should be identified. ©2011, Wiley Periodicals, Inc.

  1. Summer Student Report - AV Workflow

    CERN Document Server

    Abramson, Jessie

    2014-01-01

    The AV Workflow is web application which allows cern users to publish, update and delete videos from cds. During my summer internship I implemented the backend of the new version of the AV Worklow in python using the django framework.

  2. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  3. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  4. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  5. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  6. Air supersaturation, release of wooden fibres and upstream migration of Atlantic salmon at Rygene power plant in the River Nidelva, Aust Agder county; Vurdering av luftovermetning, trefiberutslipp og oppvandring av laks ved Rygene kraftverk i Nidelva, Aust-Agder

    Energy Technology Data Exchange (ETDEWEB)

    Thorstad, Eva B.; Kroglund, Frode; Oekland, Finn; Heggberget, Tor G.

    1997-12-31

    Incidents of dead fish have been reported in connection with a power plant at Rygene on the River Nidelva in the Aust-Agder county, Norway. Air supersaturation has been used in a bypass construction of the power plant tunnel system. In addition, wooden fibres from a fabric have been released into the water of the tunnel. Results from relevant studies concerning air saturation, wooden fibres and upstream migration are summarised in this report. 148 refs., 4 figs., 2 tabs.

  7. Many and small or large and few? A comparison of the environmental effects of different strategies for the development of hydropower plants.; Mange og smaa eller store og faa? En sammenligning av miljoevirkningene ved ulike strategier for utvikling av vannkraft.

    Energy Technology Data Exchange (ETDEWEB)

    Bakken, Tor Haakon; Sundt, Haakon; Ruud, Audun

    2012-11-01

    This study compared the cumulative environmental impact of 27 small hydro power plants to the environmental impact of an average of three large hydropower plants, which range from the small farms and the average of the major producing about as much energy. Based on the empirical basis used in this study are the environmental impacts of large hydropower fewer and less severe than the cumulative environmental impacts from the 27 small plants. The results are, however marginal in favor of big hydro power plants and suffers from uncertainties due to lack of precision in the raw data, limitations of the methodic of accumulating environmental effects of many small facilities and extensive use of discretion in the transition between the scientific description of the environmental impacts and impact classes (Statens Vegvesen, 2006). The input data in the study has primarily been published available environmental impact assessment (KU). The results must therefore be said to have limited power statement in order to draw general conclusions. The identified environmental effects are to some extent, different from the type and size, so that an individual valuation and political or administrative priorities will to a large extent determine the preferred strategy for the development of hydropower. From 2012 promoted the production stimulating action as a result of common certificate market with Sweden. Small hydro power plants has so far been a priority in Norway, but when Norway implements EU Water Framework Directive in all areas of precipitation, one should be aware of our findings, especially regarding the potential in expanding of existing hydropower plants. (auth)

  8. Consequences of emissions of NO{sub x} to air from a power heating plant. Evaluation of three alternatives, Fiborgtangen, Skogn; Konsekvenser av utslipp av NO{sub x} til luft fra kraftvarmeverk. Vurdering for tre alternativer, Fiborgtangen, Skogn

    Energy Technology Data Exchange (ETDEWEB)

    Hagen, Leif Otto; Aarrestad, Per Arild; Guerreiro, Christrina; Reitan, Ole; Skjelkvaale, Brit Lisa

    1999-07-01

    The Norwegian Institute for Air Research (NILU) , the Norwegian Institute for Water Research (NIVA) and the Norwegian Institute for Nature Research (NINA) have considered the consequences for the environment of NO{sub x} emissions from a power heating plant at Fiborgtangen, Skogn. Three alternatives have been considered, each of them with one (2003) and two (2005) units without cleaning of NO{sub x} emissions. Effects on air concentrations, acidification of water and impact on vegetation and fauna have been investigated. (Author)

  9. Introduction to AVS Audio

    Institute of Scientific and Technical Information of China (English)

    Hao-Jun Ai; Shui-Xian Chen; Rui-Min Hu

    2006-01-01

    This paper describes a general audio coding algorithm which has been recently standardized by AVS, China.The algorithm is based on a perceptual coding technique. The codec delivers near CD-quality audio at 128kb/s. This paper describes the coder structure in detail and discusses the reasons for specific design methods. A summary of the subjective test results are presented for the prototype codec. Comparison Mean Opinion Score (CMOS) test indicates that the quality of the AVS audio coder is comparable with MPEG Layer-3 audio coder. A real-time decoder was used for the characterization test,which is based on a 16-bit fixed-point DSP. The performance of the DSP solution was demonstrated, including computational complexity and storage characteristics.

  10. Accidental close-down of the Trollheim hydropower plant in July 2008. Effects on the fish populations in the river Surna; Utfall av Trollheim kraftverk i juli 2008. Effekter av fiskebestandene i Surna

    Energy Technology Data Exchange (ETDEWEB)

    Forseth, T.; Stickler, M.; Ugedal, O.; Sundt, H.; Bremset, G.; Linnansaari, T.; Hvidsten, N.A.; Harby, A.; Bongard, T.; Alfredsen, K.

    2009-01-15

    An accidental stop in the turbine in the Trollheim Hydropower Plant on 27th July 2008 caused a drop in downstream discharge in the River Surna from 21 to 3 m3/s during 100 min. River discharge was reestablished after three hours. The drop caused large dewatered areas (26 % of total wet area before the drop), but HEC-RAS simulations indicated that the ramping rates were relatively low (less than 20 cm per hour for the whole drop period in the modeled transects). Thus, a high proportion of the fish may have avoided stranding. Stranding mortality was estimated at approximately 14.000 0+ salmon and 3.600 older juveniles (70 % 1+), or the equivalent of approximately 3000 smolts. The loss constitutes less than 3% of the future smolt production downstream the power station (estimated by up-scaling from densities at electrofishing station, via mesohabitats to the whole river stretch) during 2009-2012. About one third of the smolts in the River Surna has been estimated to be produced in areas below the power plant. Between 3000 and 15 000 0+, and an unknown number of older brown trout likely also died from stranding, and the effect was probably larger for the juvenile population of brown trout than Atlantic salmon. All the above estimates are uncertain. Additional releases of water from the reservoir during, and one week after the drop, likely had no effects on the fish populations. The diversity of the zoobenthos communities in the river below the outlet of the power plant is low, likely due to large and frequent variation in discharge. The accidental stop in 2008 was probably particularly damaging, due to the large dewatered areas and low minimum discharge (far below the minimum allowed residual flow at 15 m3/s). This may temporarily reduce biomass and diversity of zoobenthos and thus prey availability for fish. Analysis of discharge data during the period from 2000 to 2008, show that despite measures implemented in the power plant (from 2006), there are several events

  11. Monitoring of caesium-137 in food plants and muscle from moose, red deer and wild reindeer in 2010.; Overvaaking av cesium-137 i beitevekster og kjoett av elg, hjort og villrein i 2010.

    Energy Technology Data Exchange (ETDEWEB)

    Veiberg, Vebjoern; Gaare, Eldar; Stokke, Sigbjoern; Solberg, Erling J.; Skuterud, Lavrans

    2011-07-01

    The monitoring of Cs-137 fall-out from the Chernobyl accident in 1986, started the same year. Several plants and wild reindeer in natural ecosystems in Nord-Rondane have been followed annually ever since. Four more wild reindeer ranges were included in 2001: Setesdal-Ryfylkeheiene, Hardangervidda, Nord-Ottadalen, Snoehetta and Nord-Rondane. From 2007 Forollhogna was also included. On fixed plots in Nord-Rondane and Snoehetta some of the reindeer forage plants, including both higher plants and fruticose lichens, have been sampled and analyzed annually since 1986. This was also done in 2010. In addition plants and lichens were sampled at five locations along an altitudinal gradient at Soendre Knutshoe, and at 7-8 locations along an east-west gradient from Kollaflata to Skarhoe in the Jora valley continuing along the Aursjoe to Torbudalen. All these locations were sampled annually between 1987-1990, but they have not been sampled since. In 2010 samples from red deer and moose was also collected from eight different regions located within the following counties: Oppland, Telemark, Vest-Agder, Rogaland, Sogn and Fjordane, Nord-Troendelag, Nordland and Troms. Red deer were sampled in four regions and moose in six. Both species were sampled in Oppland. In 2010 76, 49 and 61 samples were collected from wild reindeer, red deer and moose respectively. All measures of caesium levels were performed on dried samples. For the 596 samples of plants and lichen the results refer to caesium-levels in dried samples. For the meat samples, results refer to caesium-137 levels in raw meat. Due to large variation in measured levels of caesium within species and sampling area, we give median values instead of mean values.The highest caesium levels in wild reindeer were found in Snoehetta (1010 Bq/kg) and Nord-Rondane (2686 Bq/kg). The levels found in the other areas were considerably lower. The highest caesium levels in both red deer (Sel, 677 Bq/kg) and moose (Vaaga, 365 Bq/kg) were found

  12. Negotiation Mechanism of AVS Standardization

    Institute of Scientific and Technical Information of China (English)

    Su Junbin

    2007-01-01

    @@ 1. Introduction The mission of the Audio Video Coding Standard (AVS) Working Group of China is to develop AVS standards drafts and deliver them to the national standardization administration authorities. Since its establishment in 2002, the AVS Working Group has developed rapidly, growing from 33 members in 2003 to 153 in 2006. By the end of 2006, it had put forward for approval nine standards drafts (Table 1) with Part 2 of the AVS 1.0 draft approved as a national standard in February 2006.

  13. Gone with the wind: An analysis of the competition between suppliers of wind power plants in Sweden; Borta Med Vinden: En analys av konkurrensen melllan leverantoerer av vindkraftverk i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Roennborg, Petter [Goeteborg Univ. (Sweden). School of Economics and Commercial Law

    2003-05-01

    Introduction of wind power into the Swedish energy system started in the 1970s. Several R and D projects in technology development were initiated by the Swedish government. At the beginning the governmental projects were aimed at large-scale projects in the MW-range. However, the commercial breakthrough for wind power did not happen until the 1990s, mostly small-scale private initiatives supported by public subsidies. This led to the establishment of a number of new, foreign firms on the Swedish wind power market. The market is dominated by a few actors, who seem to have built special relations to other important players in the field. It is uncertain whether the competition between the actors in the field is functioning. The report presents the structure and economics of the wind power business in Sweden, and describes the owners, the networks and tendencies in the field. The study shows that the government has left a large part of the responsibility for reshaping the Swedish energy system to market forces, leaving the demand for wind power plants at a very low level. The concentration is high on the market, which can be characterized as an oligopoly, with limited competition. In spite of this fact, the price levels seem to be lower in Sweden than in other countries, mainly due to the (in an international comparison) very low Swedish electricity price. Further explanations to low level of wind power installation are: The stop-go policy in the support for renewable energy, and the difficulties in obtaining all necessary permits. The low demand and low prices has led to economic losses for several actors on the wind power market, and to the absence of new establishments on the market.

  14. Life cycle adaption of biofuel ashes. Evaluation of new techniques for pelletizing of biofuel ashes, especially regarding operational properties and environmental effects in the forest after ash recycling. Stage 1; Kretsloppsanpassning av bioaskor. Utvaerdering av ny teknik foer pelletering av bioaska med avseende paa dels driftsegenskaper, dels miljoeeffekter i skogen av askaaterfoering

    Energy Technology Data Exchange (ETDEWEB)

    Loevgren, Linnea [Stora Enso Environment, Falun (Sweden); Lundmark, Jan-Erik; Jansson, Charlotta [AssiDomaen AB, Stockholm (Sweden)

    2000-11-01

    The aim of the project 'Adaptation of Wood Ashes to Recycling' is to evaluate a new technique - roll pelleting - for making wood ash suitable for reuse as a fertiliser for woodland. The project is being carried out at the forest product companies AssiDomaen and Stora Enso. The main financier is the Swedish National Energy Administration. Other financiers are AssiDomaen, Stora Enso, The Thermal Engineering Research Institute and The Forestry Research Institute of Sweden. The project has involved the construction of a full-scale roll pelleter in a mobile container and its trial operation at two Swedish pulp and paper mills. The leaching properties of the ash products were studied with a laboratory method. In addition, the effects of ash fertilisation with these products are being studied in a four-year field trial. Effects on soil pH, nutrient supply, soil water chemistry and ground vegetation are being evaluated by The Forestry Research Institute of Sweden and will be reported separately in the year 2003. In a laboratory prestudy, the leaching properties of pellets from twelve different ash products made in a laboratory prototype machine were evaluated. The ash products were made from residues from the AssiDomaen Froevi mill and the Stora Enso Fors mill. Fly ash from Froevi was used alone and mixed with green liquor sludge and lime sludge respectively. Fly ash from Fors was also used alone and mixed with coating colour. The laboratory method used for the evaluation of leaching properties is the method developed by IVL The Swedish Environmental Research Institute Ltd. The results show that the progress of the leaching of roll pelleted ash is significantly slower than for the corresponding crushed product and a reference lime product. The speed of leaching, measured as acid neutralisation capacity, ANC, was significantly lower for the roll pelleted ash compared to self-hardened and crushed ash products. Because of the high content of calcium, lime has on the whole, a greater acid neutralisation capacity. Wood ash differs from lime in that it contains a substantial amount of nutrient elements essential for the forest. The acid neutralisation capacity of the roll pelleted ash was still the same after 100 days of laboratory leaching. The acid neutralisation capacity of self-hardened and crushed ashes usually ceases already after 30 days. It is likely that a well-hardened roll pelleted ash product can, without any great risk of serious damage to ground vegetation, be recycled to the forest during the clearcut stage as a compensation fertiliser following biofuel harvesting. Neither increased nitrification nor leaching of nitrate from soil water is likely to occur. Potassium is considered to be an element that is easily leached from ash. In our laboratory leaching study, on the other hand, as much as 61 % of the original potassium content was still present in the roll pelleted ash after 100 days. The roll pelleting machine has been running a little more than six months at the two mills. In total 1500 tonnes of pellets have been produced. The main part is pellets solely from ash, however, mixtures of ash and lime sludge and ash and green liquor sludge, respectively, have also been pelleted. Our experiences of the roll pelleting machine are very good. The ash products seem well suited to recycling back to the forest. The machine has a production capacity of five tonnes per hour, indicating a production capacity of 10,000 tonnes per year. The running costs, including costs for personnel, spare parts and internal transports, amounted to 87 SEK per tonne of dry ash (i.e. 61 SEK per tonne of ash with 30 % water content) during the long term test. These are low costs compared to other agglomeration techniques. The roll pelleting technique has worked very well on a large scale without any further technical development. As this machine was the first of its kind some adjustments and minor changes were made in the machine and container during the course of the project. Further adjustments have been suggested in our report. Beside this project, 2110 tonnes of roll pelleted ash have been spread in a 70 hectare forest area. The pellets were evenly distributed, at three tonnes per hectare, with a tractor equipped with a disc fertiliser spreader.

  15. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  16. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  17. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  18. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  19. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  20. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  1. Store Stokkavatn. Beskrivelse av forurensningssituasjonen

    OpenAIRE

    Holtan, H.

    1985-01-01

    Rapporten, som er et ledd i arbeidet med en vannbruksplan for Store Stokkavatn ved Stavanger, sammenstiller og diskuterer data som er samlet inn fra innsjøen og dens tilløp av Byveterinæretaten i Stavanger. Store Stokkavatnet er reservevannkilde for Stavanger og dessuten er innsjøen sentral i rekreasjonsmessig sammenheng. På bakgrunn av de foreliggende data, er innsjøens forurensningstilstand på grensen av det akseptable hva algeproduksjon (eutrofiering) og bakteriologiske forhold angår. Fler...

  2. Experiences from the Swedish programme - heavy water and natural uranium in the Aagesta cogeneration plant; Erfarenheter av den svenska linjen tungt vatten och naturligt uran i Aagesta kraftvaermeverk

    Energy Technology Data Exchange (ETDEWEB)

    Oestman, Alvar

    2002-11-01

    A short review of the Swedish programme for nuclear power in the 50's and the 60's is given, and in particular a description of the operating experiences of the Aagesta nuclear cogeneration plant, producing district heating for the south Stockholm area (12 MW{sub el} and 68 MW{sub heat}). The original Swedish nuclear programme was built on heavy water and natural uranium and had the objective to construct small nuclear plants in the vicinity of some 10 large cities in south and middle Sweden. Aagesta was the only full-scale plant to be built according to this programme, as Sweden adopted the light-water reactor policy and eventually constructed 12 large reactors at four sites. The report is based on the experiences of the author from his work at the Aagesta plant in the sixties. In an appendix, the experiences from Vattenfall (the Swedish electric utility which took over the operating responsibility for the Aagesta plant), of the plant operation is reviewed.

  3. Condition monitoring and thermoeconomic optimization of operation for a hybrid plant using artificial neural networks; Tillstaandsoevervakning och termoekonomisk driftoptimering av en hybridanlaeggning med artificiella neurala naetverk

    Energy Technology Data Exchange (ETDEWEB)

    Fast, Magnus; Assadi, Mohsen

    2007-12-15

    The project aim is to model the hybrid plant at Vaesthamnsverket in Helsingborg using artificial neural networks (ANN) and integrating the ANN models, for online condition monitoring and thermoeconomic optimization, at Vaesthamnsverket. The definition of a hybrid plant is that it uses more than one fuel, in this case a natural gas fuelled gas turbine with heat recovery steam generator (HRSG) and a biomass fuelled steam boiler with steam turbine. The project is a continuation of previous projects where ANN training was done with operational data from the plant. The ANN models have, if required, been updated to better suit the purpose of this project. The thermoeconomic optimization takes into account current electricity prices, taxes, fuel prices etc. and calculates the current production cost along with the 'predicted' production cost. The tool also has a built in feature of predicting when a compressor wash is economically beneficial. The user interface is developed together with co-workers at Vaesthamnsverket to ensure its usefulness. The user interface includes functions for warnings and alarms when possible deviations in operation occur and also includes a feature for plotting parameter trends in optional time intervals, both measured values and predicted. The target group is the plant owners and the original equipment manufacturers (OEM). The power plant owners want to acquire a product for condition monitoring and thermoeconomic optimization of e.g. maintenance. The OEMs main interest lies in investigating the possibilities of delivering ANN models along with their new gas turbines. The project has been carried out at Lund University, Department of Energy Sciences, with support from Vaesthamnsverket and Siemens. Vaesthamnsverket have contributed with operational data from the plant as well as support in plant related questions. They have also been involved in the implementation of the ANN models in their computer system and the development of the

  4. Better and more efficient collaboration for increased use of field fuel in heating plants; Baettre och effektivare samverkan foer oekad anvaendning av aakerbraenslen i vaermeverken

    Energy Technology Data Exchange (ETDEWEB)

    Arkeloev, Olof (Agrovaest, Skara (Sweden)); Hellstroem, Chris; Hollsten, Ronnie (KanEnergi Sweden AB, Skara (Sweden)); Lindh, Carina (LRF Konsult, Skara (Sweden))

    2010-05-15

    Despite that the potential for field fuels in SW Sweden is great and that the combustion characteristics of fuels are known, the interest for field fuels has been low from farmers and heating plants. The purpose of the project is to identify why the introduction of field fuel into heating plants is going so slow and to suggest possible solutions. Field fuel is missing the general structure and tradition that is found in forest fuels in terms of harvesting, processing, logistics and business models. The overall long-term objective is a better and more effective cooperation between heating plants, farmers and logistic companies for the increased use of field fuels in heating plants. The potential for field fuel in the area is great but won't be sufficient to cover the need. The raw materials that exist today and are deemed will be relevant in the future are willow, straw and grain kernel. We have divided the heating plants into two groups; Small plants with a furnace less than 35 MW, and large plants with an effect over 35 MW. Common to both small and large heating plants is that there must be a willingness to receive and combust field fuels for the share of field fuels to increase. For the small heating plants to be able to receive and combust field fuels the knowledge of the combustion properties of these fuels must increase. Larger heating plants have better opportunities to use field fuels in their boilers when it comes to the technology and the know how. They have a more controlled handling and receiving of fuels. It is not uncommon that storing and blending of fuels will take place at their own facility. They also have more experience of handling a larger number of suppliers at the same time. The heating plants would like to see standardization in terms of fuel characteristics, and they prefer to obtain approximately the same burning performance regardless of delivery date. Today, the small heating plants do not have the routines to manage multiple small

  5. Ceramic materials in hydroelectric power plants - testing and working out method descriptions. Prestudy; Keramiska material i vattenkraftanlaeggningar - test och utarbetande av metodbeskrivning. Foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Forssander, Maerit (TerraCorrosion AB (SE)); Persson, Charlotte (EnergoRetea, Stockholm (SE)); Carlsson, Roger (Vattenfall Power Consultant, Stockholm (SE)); Edwardson, Wille (Jaemtkontroll, Hammerdal (SE)); Johansson, Martin (Skellefteaa Kraft (SE)); Westerlund, Erik (Fortum Power and Heat OY (FI))

    2008-01-15

    Using ceramic materials for anti-corrosion painting in Swedish hydro power plants has been done with different results. In some cases it has performed well but in other it has failed. In only some cases the tests has been followed up rigorously to learn more about the process. The result from the interviews with the user and manufacturers is that there are cases where the use of ceramics in the hydro power plants will be economically favourable. The materials are there but they have to be tested in every single application before general recommendations can be done. A literature survey has been performed. Experiences from tests with ceramics in hydro power plants in Sweden have been summarised. Manufacturers on the Swedish market have been interviewed. The results from the literature survey showed that no published result was to be found of using ceramics in hydro electric power plants in the world. It is mentioned somewhere that Three Gorges in China have been using ceramics but no results was found. The conclusion is that even though the use of ceramics in hydro power plants can be economically favourable more tests has to be done. Those tests can be done together with the manufacturers in Sweden

  6. An evaluation of a farm scale biogas plant with a micro turbine for combined heat and power production; Utvaerdering av gaardsbiogasanlaeggning med mikroturbin foer kraftvaermeproduktion

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Nils; Edstroem, Mats; Hansson, Mikael (Swedish Inst. of Agricultural and Environmental Engineering, Uppsala (Sweden)); Algerbo, Per-Anders (HIR Malmoehus, Bjaerred (Sweden))

    2010-03-15

    The purpose of this study was to: To evaluate a farm scale biogas plant digesting energy and nutrient rich substrates at a high organic loading rate and biogas production using the biogas for combined heat and power production with a micro turbine. Put together technical, biological and economical documentation which can help farmers to investigate presumption to invest in a farm scale biogas plant for heat and power production. The farm scale biogas plant has an active digester volume of 450 m3 and the process temperature is ca 37 deg C. A micro turbine with 105 kW electrical and 160 kW thermal power is used for heat and power production. The produced electricity is sold to the grid and the heat is used on the farm for drying grain and heating two houses. The plant is digesting poultry manure and 2 substrates from the agriculture industry. All together the plant is digesting 3140 metric tons of substrates/yr and the substrates costs 160 k SEK/yr. Total investment for the plant is 4.7 M SEK. Produced head reduces the oil consumption at the farm with 15 m3 (value 100 k SEK/yr). There is a surplus of heat production of 600 MWh/yr. The production cost for the electricity is close to 0,66 SEK/kWh based on a value of the digestate of 100 SEK/ton together with an investment subsidy of 30 %. The production cost for the electricity is strongly depending on the value of the digestate. Hagavik is a crop production farm based on organic farming. If the valuation of the digestate is reduced to 50 SEK/ton, the production cost for the electricity increases to approx. 0.84 SEK/kWh (1 SEK is about 0.14 USD)

  7. Ice Forces on Offshore Wind Power Plants. Descriptions of mechanisms and recommendations for dimensioning; Islaster paa vindkraftverk till havs. Beskrivning av mekanismer och rekommendationer foer dimensionering

    Energy Technology Data Exchange (ETDEWEB)

    Bergdahl, Lars [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept of Water Environment Transport

    2002-02-01

    Mechanisms for ice-loads on off-shore wind power plants are described, The ice-loads are due to thermal expansion, water level variations, drifting ice and ice-reefing. Ice accretion is briefly treated. Ice instance, ice thickness, ice retention time, water level variations and stream velocities in Swedish waters are compiled. The main text deals with recommendations for dimensioning wind power plants at sea. In the appendices, a thorough review of the physical and mechanical properties of ice is presented.

  8. Expansion of Hitra wind-power plant - consequences related to wildlife except birds; Etterundersoekingar og konsekvens-utgreiingar for Hitra vindpark (Hitra 2). Naturmiljoe med unntak av fugleliv

    Energy Technology Data Exchange (ETDEWEB)

    Veiberg, V.; Pedersen, H.C.

    2010-02-15

    Hitra wind-power plant today consists of 24 wind turbines located at Eldsfjellet. The power plant was officially opened in October 2004 after approximately one year of construction work. As part of the establishment of the park, 20 km of roads with solid rock foundation was built. In addition, 25 km of earth cable was dug down, and a 10 km power line to Fillan was constructed. A second building step including between 15 and 25 new turbines and belonging infrastructure, is now being planned. In addition, about 10 km of new power line need to be built between the power plant and a new sub-sea power cable to Tjeldbergodden. One of the alternatives for the enlargement also includes construction of a new service road from the south. This report evaluates to what extent the present wind-power plant has had detectable consequences for the terrestrial fauna (except avifauna) at Eldsfjellet or in its surroundings. We also look into whether the establishment has had an impact on the hunting activity. Likely consequences of the next building step are evaluated for the same matters as the post-construction investigation. There are no indications that the construction of Hitra wind-power plant has caused lasting effects on the terrestrial fauna within the area of influence. For red deer, temporary avoidance of influence areas was registered during the construction period. This was not found to cause reduction neither in the harvest numbers, nor in the hunting related income for the various hunting areas. The construction of roads in relation to the power plant has been beneficial for the red deer hunt in the areas east, north and west of Eldsfjellet. The two suggested alternatives for enlargement of Hitra wind-power plant will to a varying degree affect attractive red deer habitats. These areas are also popular hunting grounds. The expected negative impacts from a power plant enlargement are mainly related to habitat loss due to technical installations and construction of roads

  9. Planning of biogas plants. A question of co-operation and negotiation; Planering av biogasanlaeggningar. En fraaga om samverkan och foerhandling

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Jamil

    2003-04-01

    During the last years there has been an increased interest in Sweden to build biogas reactors. The planning of a biogas plant brings about the need for co-operation between a variety of actors. Furthermore, there are a number of different issues that need to be dealt with. To build a biogas plant is thus a rather complicated thing to do. The aim of this report is to increase the knowledge about the processes that precede a decision to build a biogas plant, in order to try to facilitate the planning of future projects. The report is based on case studies of the planning of two biogas plants in Sweden and the empirical material consists of interviews with key persons as well as written documents. In the study, three parallel processes are identified and analysed, which are all crucial to carry through a project. These are the project planning process, the political process and the application process. The most important result of the study is that there is not only one way to carry through a project and that the choice of strategy depends on the character of the project and the different questions that need to be handled. Examples of other results are: the importance of an early and continuous dialogue with the political leadership, the necessity to build an organisation for the co-operation between key actors and that the project leaders should be flexible and open to changes in the project throughout the planning process.

  10. Ozone and climate - Effects of the excess of critical loads on birches and mountain plants; Ozon og klima - effekter av taalegrenseoverskridelser paa bjoerk og fjellplanter

    Energy Technology Data Exchange (ETDEWEB)

    Mortensen, L.M.

    1996-01-01

    The conference paper relates to the environmental effects of high concentrated ozone on the biomass production in Norway. The effects on birches and mountain plants from ozone together with the interaction between ozone and carbon dioxide and their influence on vegetation are discussed

  11. The SSI project on decommissioning of nuclear plants - a preliminary study; SSI:s projekt avseende avveckling av kaerntekniska anlaeggningar - en foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, Henrik; Ehdwall, H.; Godaas, T.; Hofvander, P.; Lindhe, J.C.; Lumpus, J.; Lund, I.; Malmqvist, L.; Welleman, E

    1999-01-01

    SSI will amend and complete regulations and stipulations for nuclear plants in order to take into account issues which arise in connection with decommissioning. The objective of a pilot study, performed during 1998, was to identify the questions at issue, what the authority should control and how SSI should proceed with the work. The recommendations and the result of the pilot study are presented in this report 29 refs.

  12. Optimering av bergtransporter i underjordsgruva

    OpenAIRE

    Abrahamsson, Magnus

    2015-01-01

    Detta examensarbete utfördes på LKAB, en mineralkoncern som tillverkar och levererar järnmalmsprodukter. Arbetet utfördes för företagets underjordsgruva i Malmberget och behandlar tillredningens bergtransporter. Tillredningen är den process som förbereder nya delar av gruvan för järnmalmsbrytning. Målsättningen med arbetet har varit att kartlägga hur transporterna av tillredningsberg styrs samt att kvantifiera en besparingspotential för dessa transporter. Om möjligt skulle även förbättringsfö...

  13. Energy savings in dust collector plants of bag house filter type. Phase 1 - Literature study; Energieffektivisering av anlaeggningar foer stoftrening med slangfilter. Etapp 1-Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Lars; Wikman, Karin; Berg, Magnus [AaF-Energi and Miljoe AB, Stockholm (Sweden)

    2004-01-01

    The largest energy demands in connection with the operation of bag house filters are the electric energy consumption for the fans, securing the flow of flue gas through the filter, and the electric energy consumption when producing the pressurized air (compressors or high pressure fans). Considering the significantly increased fan work when having a non-optimised cleaning of the filters, it seems justified to investigate the possibilities to minimise the unnecessary pressure drop. There is also a saving potential in the filter cleaning process, which otherwise may cost an unacceptable amount of pressurized air or other energy. The main purpose of this work is to develop methods to optimize the operation of bag house filters, which is started up with this report containing a follow-up of what has been done in Denmark and a confirmation of the technology status. In the next step, a case study where two-three plants are examined more in detail is suggested followed by a potential study to estimate the total energy saving potential in Sweden. Dust precipitation with bag house filters is basically a rather simple technique, which has existed in flue gas cleaning for about 50 years. From the literature study it can be established that there has been no revolutionary development in the field, but there are some work being done mainly to introduce new filter material but also to optimise the use of bag house filters with new computer based control systems. The largest potential of energy saving prevails if the filter from the beginning is overloaded, which usually is the case. The reason for overload may be a too large volume flow in relation to the filter area, that the dust has penetrated and blocked the filter, a defective filter cleaning process or that wrong filter material has been chosen. In Denmark a study has been made with the purpose to investigate the possibilities to optimise the energy consumption for bag house filters. For the three plants studied, an

  14. Institusjonelle felt og forståelser av evaluering – en analyse av evalueringen av NAV-reformen

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Hansen, Morten Balle

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av...... interessene som var involvert i evalueringen. I EVANAV ble dette blant annet ivaretatt i formuleringen av fire mål som tilgodeser ulike behov. Basert på evalueringsteori og teori om institusjonelle felt bidrar analysen til en bedre forståelse av hva evaluering er, og hvordan ulike utfordringer knyttet til...

  15. PAH i forurenset sediment: Utredning av egnethet av PAHkomponenter/ grupperinger for vurdering av tiltaksbehov

    OpenAIRE

    Ruus, Anders; Arp, Hans Petter Heinrich; Oen, Amy M.P.; Grung, Merete; Breedveld, Gijs D.

    2015-01-01

    I Norge er det utarbeidet klassegrenser for til sammen 16 PAH-forbindelser i sediment og vann. Grenseverdiene baserer seg på kunnskap om toksisitet av de ulike stoffene og hva som er akseptabel eksponering for miljøet. I tillegg til grenseverdiene for enkeltkomponentene av PAH opererer norske miljømyndigheter med klassegrenser for PAH-grupperingen SUM PAH-16 i sediment. Disse klassegrensene bygger på overkonsentrasjoner i forhold til bakgrunnsnivå, og ikke økotoksikologiske dat...

  16. Bruk av kartleggingsresultater i forbedringsarbeid

    DEFF Research Database (Denmark)

    Nordahl, Thomas; Hansen, Line Skov

    . Barnehagen har gjerne tilgang på informasjon fra kartlegginger, men det er ikke alltid denne informasjonen blir systematisk analysert og aktivt brukt i forbedringsarbeid. Forfatterne viser hvordan slike analyser kan gjennomføres på forskjellige nivåer i den enkelte barnehage, og vektlegger viktigheten av...

  17. The effect of vehicle exhausts on crops and other utility plants close to roads; Trafikavgasers effekter paa groedor och andra nyttovaexter i naerheten av vaegar

    Energy Technology Data Exchange (ETDEWEB)

    Pleijel, H.; Ahlfors, A.; Skaerby, L.; Pihl Karlsson, G.; Sjoedin, Aa.

    1993-11-01

    This report summarizes the present knowledge concerning the impact of automobile exhausts on plants and the research carried out at IVL in this field during the period 1988-1991. The investigations carried out at motorway E6 south of Gothenburg show: * that the concentrations of ethylene are high enough to cause pronounced effects on the bio indicator petunia, * that the ozone concentrations in the vicinity of the motorway are lower than the regional background concentrations, which was reflected in significantly less visible ozone injury on the ozone bio indicator, subterranean clover, close to the motorway after an ozone episode, * that the less ozone sensitive red clover, in contrast to subterranean clover, showed stimulated growth with increasing distance from the motorway, * that there was a tendency towards higher yields for cereals in the vicinity of the motorway, but the extent of and cause for this growth stimulation is not known at present. The effects of metals from catalytic converters is as yet uncertain, as is the understanding of effects of nitrogen oxides. 45 refs, 16 figs, 7 tabs

  18. Effects of small hydropower plants on low-and moss flora. A feasibility study; Virkninger av smaa vannkraftverk paa lav- og mosefloraen: en forundersoekelse

    Energy Technology Data Exchange (ETDEWEB)

    Ihlen, Per G.; Bjelland, Torbjoerg; Vaskinn, Kjetil; Johnsen, Geir Helge

    2012-07-01

    We have established a list of lichen- and moss flora of a waterway to be developed for hydropower production (Vangjolo) and in a control water system (Roesgrovi), both in Voss in Hordaland. The waterways have similar bedrock, exposure, vegetation and elevation. To monitor any change in the flora, it was laid out 20 fixed routes from each river systems where low-and moss flora were recorded. To relate this to the monitoring of potential impacts, l flow, humidity, air temperature, water temperature and dew point temperature were logged. It was recorded 66 species total for Roesgrovi and Vangjolo, and 32 mosses, 29 lichens and 5 vascular plants. The results show that the rivers are so similar to the low-and moss flora that they can form the basis for further investigations. This is also shown by the DCA-analyses. The waterways comprises a combination of species with the same requirements as to moisture, and contains species of high and low Ellenberg indicator values for moisture. There is no statistically significant difference between Roesgrovi and Vangjolo in the fixed routes average values. The hydrological and local climatic measurements also show that the river systems are comparable for further study of possible changes after development. (eb)

  19. Production Planning with Respect to Uncertainties. Simulator Based Production Planning of Average Sized Combined Heat and Power Production Plants; Produktionsplanering under osaekerhet. Simulatorbaserad produktionsplanering av medelstora kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Haeggstaahl, Daniel [Maelardalen Univ., Vaesteraas (Sweden); Dotzauer, Erik [AB Fortum, Stockholm (Sweden)

    2004-12-01

    Production planning in Combined Heat and Power (CHP) systems is considered. The focus is on development and use of mathematical models and methods. Different aspects on production planning are discussed, including weather and load predictions. Questions relevant on the different planning horizons are illuminated. The main purpose with short-term (one week) planning is to decide when to start and stop the production units, and to decide how to use the heat storage. The main conclusion from the outline of pros and cons of commercial planning software are that several are using Mixed Integer Programming (MIP). In that sense they are similar. Building a production planning model means that the planning problem is formulated as a mathematical optimization problem. The accuracy of the input data determines the practical detail level of the model. Two alternatives to the methods used in today's commercial programs are proposed: stochastic optimization and simulator-based optimization. The basic concepts of mathematical optimization are outlined. A simulator-based model for short-term planning is developed. The purpose is to minimize the production costs, depending on the heat demand in the district heating system, prices of electricity and fuels, emission taxes and fees, etc. The problem is simplified by not including any time-linking conditions. The process model is developed in IPSEpro, a heat and mass-balance software from SimTech Simulation Technology. TOMLAB, an optimization toolbox in MATLAB, is used as optimizer. Three different solvers are applied: glcFast, glcCluster and SNOPT. The link between TOMLAB and IPSEpro is accomplished using the Microsoft COM technology. MATLAB is the automation client and contains the control of IPSEpro and TOMLAB. The simulator-based model is applied to the CHP plant in Eskilstuna. Two days are chosen and analyzed. The optimized production is compared to the measured. A sensitivity analysis on how variations in outdoor

  20. Analyse av klimatilpasningstiltak : en casestudie av overvannsnettet på Bogafjell i Sandnes kommune

    OpenAIRE

    Bekkum, Ina

    2012-01-01

    For å simulere klimaendringenes effekt på avløpssystemet og klimatilpasningstiltakenes avbøtende virkning kan man benyttes seg av urbanhydrologiske avløpsmodeller. I denne oppgaven er det gjennomført et casestudie av overvannsnettet på Bogafjell i Sandnes kommune. Det er gjort simuleringer av enkeltregn i form av symmetriske nedbørshyetogram, med og uten klimatillegg – i Rosie/ArcGIS med MOUSE beregningsmotor – for å teste tiltaksprinsipper som frakopling av overvann, fordrøyning av ...

  1. Transmembrane potentials of canine AV junctional tissues.

    Science.gov (United States)

    Tse, W W

    1986-06-01

    The atrioventricular (AV) junction comprises the AV node, His bundle (HB), and specialized tissues proximal to the node called paranodal fibers (PNF). In the present study, an in vitro, dissection-exposed canine right atrial (RA), transitional fiber (TF), AV junctional preparation was used. The TF and PNF formed a pathway running along the base of the septal cusp of the tricuspid valve (SCTV). In the first experiment, impulses elicited at the RA were monitored to propagate sequentially through the TF, PNF, AV node, and then the HB. This functional evidence supports the concept that a conduction pathway connecting the RA and the AV node exists along the base of the SCTV. This internodal pathway is referred to as the septal cusp pathway. In another experiment, transmembrane potentials and Vmax were determined on each of the AV junctional tissues. Results showed that PNF had the lowest Vmax (2.5 V/sec), followed by AV node (7.0 V/sec) and HB (33 V/sec). This finding showed that PNF, and not the AV node, has the lowest Vmax, suggesting that the PNF has the lowest conductivity among the AV junctional tissues, and this study advances our understanding on the mechanism of AV conduction delay in dog hearts.

  2. Evaluering av ABW-filter

    OpenAIRE

    Ohren, J.A.

    1986-01-01

    Det er foretatt en evaluering av ABW-filteret basert på forskningsresultater og driftserfaringer fra USA. ABW-filteret er godt egnet med sand eller sand-antrasitt i konvensjonelle fullrenseanlegg med flokkulering, sedimentering og filtrering. Etter disse prosessene er filteret også egnet med aktivt kull. ABW-filteret er også interessant for etterbehandling i kommunale og industrielle avløpsrenseanlegg.

  3. Environmental monitoring program for the Ormen Lange Onshore Processing Plant and the Reserve Power Plant at Nyhamna, Gossa. Monitoring of vegetation and soil: re-analyses and establishment of new monitoring plots in 2010.; Miljoeovervaakingsprogram for Ormen Lange landanlegg og Reservegasskraftverk paa Nyhamna, Gossa. Overvaaking av vegetasjon og jord: gjenanalyser og nyetablering av overvaakingsfelter i 2010

    Energy Technology Data Exchange (ETDEWEB)

    Aarrestad, P.A.; Bakkestuen, V.; Stabbetorp, O.E.; Myklebost, Heidi

    2011-07-01

    The Ormen Lange Onshore Processing Plant in Aukra municipality (Moere og Romsdal county) receives unprocessed gas and condensate from the Ormen Lange field in the Norwegian Sea. During processing of sales gas and condensate, the plant emits CO, Co2, Nox, CH4, NMVOC (including BTEX), SO2 and small amounts of heavy metals, as specified in the discharge permit issued by the Climate and Pollution Directorate. The plant started production in 2007, with A/S Norske Shell as operator. In general, emissions of nitrogen and sulphur-containing gasses may affect terrestrial ecosystems through acidification and fertilization of soil and vegetation. The emissions from the onshore plant are calculated to be below the current critical loads for the terrestrial nature types. However, the nitrogen background level in the area of influence is close to the critical loads for oligotrophic habitats. To be able to document any effects of emissions to air on terrestrial ecosystems, a monitoring program for vegetation and soil was established in 2008 in the area of influence from the Ormen Lange Onshore Plant. The monitoring is planned at regular intervals according to the same methods employed in 2008, with the first reanalysis in 2010. The benefits of the monitoring parameters will be continuously evaluated. Statnett has established a Reserve Power Plant with discharge permits of similar substances in the same area as the Ormen Lange Onshore Processing plant, and participates in an extended monitor program from 2010. In 2008 two monitoring sites were established, one with rather high deposition of nitrogen north of the plant within Gule-Stavmyran nature reserve in Fraena municipality (site Gulmyran) and one south of the plant on the island Gossa (site Aukra). Deposition values have been estimated by the Norwegian Institute for Air Research (NILU). Within each site integrated monitoring of the species composition of the vegetation, plant growth, and chemical content of plants and soil is

  4. Multimedia for læring av tallsystemer : utvikling av programvare for læring av og om tallsystemer

    OpenAIRE

    Idland, Terje

    2006-01-01

    Oppgaven har en teoretisk forankring innenfor Piagets konstruktivisme, Vygotskys sosialkonstruktivisme, Dienes teori for læring av posisjonssystemet og Mayer & Morenos teori for læring med multimedia. Primært har jeg brukt eksisterende teori som grunnlag for utvikling av pedagogisk programvare for læring av tallsystemer. Denne programvaren er todelt. En del er en interaktiv applett som er et utforskingsmiljø for posisjonssystemet. Den andre delen er en interaktiv multimediep...

  5. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  6. Effekten av karbohydrat- og proteininntak på restitusjon av utholdenhetskapasiteten etter et utmattende arbeid

    OpenAIRE

    Rustad, Per Inge

    2011-01-01

    Innledning: Dietten i etterkant av trening og konkurranser er av stor betydning for restitusjonsprosessen. Få studier har imidlertid undersøkt restitusjonseffekten av karbohydratog proteininntak etter et utmattende arbeid på utholdenhetskapasiteten dagen etter. I vår studie ble det gjennomført totalt tre diettintervensjoner for å undersøke følgende problemstillinger; 1) undersøke utholdenhetskapasiteten dagen etter et utmattende utholdenhetsarbeid etter inntak av en høy karbohy...

  7. AVS-M: From Standards to Applications

    Institute of Scientific and Technical Information of China (English)

    Ye-Kui Wang

    2006-01-01

    AVS stands for the Audio Video coding Standard Workgroup of China, who develops audio/video coding standards as well as system and digital right management standards. AVS-M is the AVS video coding standard targeting for mobile multimedia applications. Besides the coding specification, AVS also developed the file format and Real-time Transport Protocol (RTP) payload format specifications to enable the application of AVS-M video in various services. This paper reviews the high-level coding tools and features of the AVS-M coding standard as well as the file format and payload format standards.In particular, sixteen AVS-M high-level coding tools and features, which cover most of the high-level topics during AVS-M standardization, are discussed in some detail. After that, the error resilience tools are briefly reviewed before the file format and RTP payload format discussions. The coding efficiency and error resiliency performances of AVS-M are provided finally.H.264/AVC has been extensively used as a comparison in many of the discussions and the simulation results.

  8. The AV-8B Decision

    Science.gov (United States)

    1982-06-01

    isa csestudy of the debate overthdeionfte United States Gover mn to prc--u the McDonnell Douglas AV-8B Advanced Hrrier V/STOL jet aircraft for the U.S...Sciences 3 ABSTRACT This thesis is a case study of the debate over the decision of the United States Government to procure the McDonnell Douglas IT-8...a egrate4 dur nq the 1ive To r perIoo by the introduction of the moderNtely prcod F1-18 aircraft. The F/1 8 proqrts will, 0euce to*n uber and tpes of

  9. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  10. Syncope and Idiopathic (Paroxysmal) AV Block.

    Science.gov (United States)

    Brignole, Michele; Deharo, Jean-Claude; Guieu, Regis

    2015-08-01

    Syncope due to idiopathic AV block is characterized by: 1) ECG documentation (usually by means of prolonged ECG monitoring) of paroxysmal complete AV block with one or multiple consecutive pauses, without P-P cycle lengthening or PR interval prolongation, not triggered by atrial or ventricular premature beats nor by rate variations; 2) long history of recurrent syncope without prodromes; 3) absence of cardiac and ECG abnormalities; 4) absence of progression to persistent forms of AV block; 5) efficacy of cardiac pacing therapy. The patients affected by idiopathic AV block have low baseline adenosine plasma level values and show an increased susceptibility to exogenous adenosine. The APL value of the patients with idiopathic AV block is much lower than patients affected by vasovagal syncope who have high adenosine values. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. Review of AVS Audio Coding Standard

    Institute of Scientific and Technical Information of China (English)

    ZHANG Tao; ZHANG Caixia; ZHAO Xin

    2016-01-01

    Audio Video Coding Standard (AVS) is a second⁃generation source coding standard and the first standard for audio and video coding in China with independent intellectual property rights. Its performance has reached the international standard. Its coding efficiency is 2 to 3 times greater than that of MPEG⁃2. This technical solution is more simple, and it can greatly save channel resource. After more than ten years ’develop⁃ment, AVS has achieved great success. The latest version of the AVS audio coding standard is ongoing and mainly aims at the increasing demand for low bitrate and high quality audio services. The paper reviews the history and recent develop⁃ment of AVS audio coding standard in terms of basic fea⁃tures, key techniques and performance. Finally, the future de⁃velopment of AVS audio coding standard is discussed.

  12. Tolkning av det verbala och det visuella

    Directory of Open Access Journals (Sweden)

    Barbro Sjöberg

    2011-12-01

    Full Text Available I en tidigare publicerad artikel i Techne serien (Sjöberg, 2005 gjordes en genre-beskrivning av fenomenet skissbok. Genrebeskrivningen baserade sig på en analys av sex formgivarstuderandes skissböcker. I den nu aktuella artikeln redogörs för hur genren tillämpats i en slöjdpedagogisk kontext inom två kurser i Konsthand-arbete under åren 2002 respektive 2004 inom de didaktikbaserade ämnesteknolo-giska studierna i slöjdpedagogik vid Åbo Akademi, Vasa. En av målsättningarna för kurserna var att testa skissboken i en slöjdpedagogisk kontext. Under kursens gång hade de studerande som uppgift att utforska och dokumentera ett givet tema i sina skissböcker. Efter avslutad kurs skannades skissböckerna in för att utgöra empiriskt material för tolkning och analys av hur de studerande utformat dokumen-tationen i sina skissböcker på basen av de instruktioner de fått under kursens gång. I föreliggande studie redogörs för bearbetning, tolkning och analys av det empiris-ka materialet med hjälp av NVivo 9, en version av NVivo som underlättar bearbet-ning och den vetenskapliga tolkningen av visuellt material. Resultaten visar att uppmuntran till horisontell mediering i samband med dokumentation i skissbok kan leda till en mångsidig och personlig utforskning av givet tema.Sökord: metod, slöjd, NVivo, skissbok, lärarutbildningURN:NBN:no-29968

  13. Påvising av aminoglykosidresistens ved hjelp av massespektrometri. Utvikling av metode for deteksjon, stabilitet av aminoglykosid og molekylær karakterisering av teststammer

    OpenAIRE

    Kvarekvål, Torunn

    2014-01-01

    Aminoglykosid er potente antibiotika som vert brukt til behandling av alvorlege infeksjonar med aerobe bakteriar. Dei er baktericide og verkar ved å binda til ribosoma i bakteriane og på denne måten forstyrra den normale peptidsyntesen. Aminoglykosida er verdifulle medikament, men som for mange andre antibiotika er resistens mot desse midla eit aukande problem. Den viktigaste resistensmekanismen er aminoglykosidmodifiserande enzym (AME). Desse enzyma inaktiverer ...

  14. Uptake of AV-1451 in meningiomas.

    Science.gov (United States)

    Bruinsma, Tyler J; Johnson, Derek R; Fang, Ping; Senjem, Matthew; Josephs, Keith A; Whitwell, Jennifer L; Boeve, Bradley F; Pandey, Mukesh K; Kantarci, Kejal; Jones, David T; Vemuri, Prashanthi; Murray, Melissa; Graff-Radford, Jonathan; Schwarz, Christopher G; Knopman, David S; Petersen, Ronald C; Jack, Clifford R; Lowe, Val J

    2017-09-08

    AV-1451 is an imaging agent labeled with the positron-emitting radiolabel Fluorine-18. 18F-AV-1451 binds paired helical filament tau (PHF-tau), a pathology related to Alzheimer's disease. In our study of AV-1451 uptake in the brains of cognitively normal subjects, we noted a case of a meningioma with visually significant uptake of AV-1451. We initiated the present retrospective study to further examine cases of meningioma that underwent AV-1451 imaging. We searched the patient records of 650 patients who had undergone AV-1451 at our institution for the keyword "meningioma" to identify potential cases. PET/CT and MRI results were visually reviewed and semi-quantitative analysis of PET was performed. A paired student's t test was run between background and tumor standard uptake values. Fisher's exact test was used to examine the association between AV-1451 uptake and presence of calcifications on CT. We identified 12 cases of meningioma, 58% (7/12) of which demonstrated uptake greater than background using both visual analysis and tumor-to-normal cortex ratios (T/N + 1.90 ± 0.83). The paired student's t test revealed no statistically significant difference between background and tumor standard uptake values (p = 0.09); however, cases with a T/N ratio greater than one showed statistically higher uptake in tumor tissue (p = 0.01). A significant association was noted between AV-1451 uptake and presence of calcifications (p = 0.01). AV-1451 PET imaging should be reviewed concurrently with anatomic imaging to prevent misleading interpretations of PHF-tau distribution due to meningiomas.

  15. Portering av programvara – metodik och fallstudie

    OpenAIRE

    Ståhl, Nils

    2012-01-01

    Carasoft AB är ett företag som specialiserat sig på utveckling av dokumenthanteringssystem. Man erbjuder bland annat ett Windowsbaserat dokumenthanteringssystem vid namn Caradoc. Systemet består av flertalet DLL:er skrivna i Delphi och har inte ändrats eller kompilerats sedan 2004. Det här examensarbetet har i syfte att utreda om det finns möjlighet att inom rimlig tid portera Caradoc till Windows 7, med hjälp av den nya Delphi-versionen XE2. Efter en förstudie i ämnet portering, programspråk...

  16. Basic Considerations on AVS DRM Architecture

    Institute of Scientific and Technical Information of China (English)

    Tie-Jun Huang; Yong-Liang Liu

    2006-01-01

    Digital Rights Management (DRM) is an important infrastructure for the digital media age. It is a part of the AVS (Audio and Video coding Standard) of China. AVS Trusted Decoder (ATD) that plays back digital media program according to rights conditions is the core of AVS DRM architecture. Adaptation layers are responsible for translating or negotiating between ATD and peripheral systems. The Packaging Adaptation Layer (PAL), Licensing Adaptation Layer (LAL) and Rendering Adaptation Layer (RAL) will help ATD to gain the interoperability in various DRM environments.

  17. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients.

    Science.gov (United States)

    Schmelter, Christopher; Raab, Udo; Lazarus, Friedrich; Ruppert, Volker; Vorwerk, Dierk

    2015-08-01

    The study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients. 63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5%), followed by complications of angioplasty with vessel rupture or dissection (31.8%). A high rate of procedural success was achieved (98.5%). The most frequent location of the deployed stent-graft was the draining vein (66.7%). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5% at 6 month, 31.3% at 12 month and 19.2% at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1%), followed by stenosis at the AV access (29.5%) and the deployed stent-graft (23.5%). Re-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  18. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  19. Integrasjon av vindkraft i energisystemet : effekten av variabilitet på markedsverdien

    OpenAIRE

    Brekken, Tormod Ween

    2014-01-01

    Klimapolitikken bidrar til å fase ut termisk kraftproduksjon basert på fossile kilder. Dette kan føre til at en mindre andel av kraftproduksjonen kan respondere på prissignaler. Det er planlagt å øke andelen vindkraft i flere kraftmarkeder. Vindkraft er avhengig av været, og er karakterisert av varierende produksjon. Dette påvirker inntekten til hva produsenter av vindkraft vil tjene i kraftmarkedet. Studier har funnet at markedsverdien til vindkraft reduseres ved økte andeler vindkraft i ma...

  20. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  1. En norsk pilotstudie av helsesøstres oppfatninger av pasienters health literacy: helsefremmende allmenndannelse

    OpenAIRE

    Hanne Søberg Finbråten; Kjell Sverre Pettersen

    2012-01-01

    Bakgrunn Uttrykket “ansvar for egen helse” innebærer også evnen til kritisk evaluering av helseinformasjon. Slike kunnskaper og ferdigheter reflekterer health literacy (HL) – på norsk; helsefremmende allmenndannelse, som handler om å forstå, kunne skaffe seg tilgang på, kritisk vurdere og adekvat anvende helseinformasjon for ervervelse av god helse. Hensikt Formålet var å kartlegge helsesøstres oppfatninger av brukeres tre hierarkiske nivåer av HL (Nutbeam 2000): functional HL (FHL), inte...

  2. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  3. Analysis reports on the ecotoxicological evaluation of discharges of spent water at the cogeneration/central heating plants Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes and Aelmhult; Analysrapporter avseende ekotoxikologisk bedoemning av utslaepp av utgaaende vatten vid Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes och Aelmhult

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jonas; Axby, Fredrik; Persson, Maarten; Rossander, Annelie; Schultz, Emma; Svaerd, Sara [Carl Bro AB, Kristianstad (Sweden)

    2007-04-15

    The discharges to water at six biofuelled Swedish cogeneration/district heating plants are evaluated in light of the EU Water Framework Directive concerning ecotoxicological impacts. Ecotoxicological data for the 33 prioritized substances are also reviewed.

  4. Kartlegging av PCB i sedimenter fra Indre Sørfjord

    OpenAIRE

    Skei, J.; Klungsøyr, J

    1990-01-01

    Som følge av forhøyede nivåer av PCB i fiskelever innerst i Sørfjorden er det gjennomført en sedimentundersøkelse for om mulig å finne kilden til PCB. Det ble ikke registrert høye nivåer av PCB i sedimentene. Høyeste konsentrasjoner ble målt i munningen av Eitrheimsvågen. Analyser av trafooljer brukt i Tyssedalsområdet viste spor av PCB.

  5. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  6. Utvärdering av event marketing

    OpenAIRE

    Fransson, Erik; Törnqvist, Johan

    2001-01-01

    Event marketing är en marknadsföringsform som har växt ordentligt under senare delen av 90-talet och det börjar bli ett naturligt inslag i företagens marknadskommunikation. Trots denna tillväxt har event marketing under en längre tid sammankopplats med brist på utvärderingsmetoder. En avsaknad av utvärderingsmetoder leder till svårigheter att avgöra vilka effekter en event marketing-satsning resulterar i, hur genomförandet kan förbättras samt huruvida event marketing är en lämplig form av mar...

  7. Eksakte metodar for analyse av tovegstabellar

    OpenAIRE

    Aaberge, Rolf

    1980-01-01

    Dei fleste matematisk-statistiske metodane som er utvikla til analyse av tabellar, byggjer på føresetnader om at talet på observasjonar i tabellcellene er "stort. Haldorsen (1977a) og (1977b) omtalar metodar som kviler på dette kravet. I denne rapporten skal vi presentere eksakte metodar for analyse av to-vegstabel lar, dvs. metodar som er gyldige sjølv om vi har småe observasjonstal i tabellcellene. I mange undersøkingar vil observasjonane ofte gi uttrykk for kva slags ...

  8. Grafisk presentasjon av GPenSim-simulering

    OpenAIRE

    2009-01-01

    GPenSim er et verktøy for modellering og simulering av diskret hendelsesystemer (DES). GPenSim er integrert i Matlab-plattformen, og har dermed tilgang til innebygde Matlabfunksjoner som plot etc. I GPenSim blir Petri net-grafen definert i Petri netdefinisjonsfiler. Resultatet av en simulering blir vist i tekst. Oppgaven gikk ut på å utvikle et verktøy som skulle presentere både Petri net-grafen og simuleringsresultatet grafisk. En grafisk presentasjon viser tydeligere sammenhe...

  9. AVS Intellectual Property Rights (IPR) Policy

    Institute of Scientific and Technical Information of China (English)

    Cliff Reader

    2006-01-01

    The AVS Workgroup has developed an IPR Policy to facilitate the adoption of standards in the marketplace.The policy is based on consideration of IPR issues in parallel with the technical work for drafting the standard. The paper describes the relationship between IPR and the standard, and how the goals for the standard must be complemented by goals for the IPR. The existing IPR policies of the ITU and ISO are outlined, and then the AVS IPR policy is described,organized by its three main components: commitment to license on declared basic terms, disclosure of intellectual property,and protection of IPR.

  10. Bruk av landstrøm for reduksjon av NOX og CO2 i norske havner

    OpenAIRE

    Frengstad, Åsmund Møll

    2014-01-01

    Bruk av Smart Grid og landstrøm for reduksjon av NOX- og CO2- utslipp i norske havner. I dag slippes det ut mye avgasser fra marine næringer i havner. Disse gassene bidrar både til internasjonale miljøutslipp i form av CO2, men også til lokal luftforurensing. Dette kan føre til redusert livskvalitet for befolkningen og besøkende til havnebyene. For å belyse problemet er Hurtigruten ASA benyttet som eksempel med de havnene den besøker på sin rute opp langs norskekysten. Rapporten gir en...

  11. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  12. Ishockeykjelke - Innfesting av spilleren: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  13. Instrumentering av Bergsøysundbrua og Gjemnesundbrua

    OpenAIRE

    Dahlen, Adrian; Lystad, Tor Martin

    2013-01-01

    Gjemnessundbrua og Bergsøysundbrua på Europavei E39 i Møre og Romsdal, skal instrumenteres for identifikasjon av strukturelle og dynamiske egenskaper. Denne rapporten omhandler dokumentasjon og beskrivelse av det utførte arbeidet ved monteringen av måleutstyret. Det er også gjort analyser av de ulike konstruksjonsdelene akselerometersensorer og anemometre er montert på. Til slutt er de initielle responssignalene fra systemet behandlet, der egenfrekvenser og ...

  14. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  15. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  16. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  17. Acid volatile sulfide (AVS)- a comment

    NARCIS (Netherlands)

    Meysman, F.J.R.; Middelburg, J.J.

    2005-01-01

    The review by Rickard and Morse (this volume) adequately summarizes our current understanding with respect to acid-volatile sulfides (AVS). At the same time, this review addresses some of the misunderstandings with regard to measurements and dynamics of this important sedimentary sulfur pool. In

  18. Risikostyring av jetfuelprisen med futureskontrakter : en studie av hedgingstrategier for flyselskaper

    OpenAIRE

    Marker, Sebastian

    2013-01-01

    Denne oppgaven undersøker risikostyring av jetfuelprisen gjennom hedgingstrategier med WTI- og fyringsoljefutures som sikringsinstrument. Analysen tar sikte på å estimere minimum varians hedgingrater for ulike hedgingstrategier. Formålet er å finne hedgingstrategier som gir høyest hedgingeffektivitet, og dermed gir størst reduksjon i jetfuelprisrisiko. Første del av analysen vil estimere hedgingrater med utgangspunkt i flere analysemetoder under en klassisk lineær regresjonsmodell (CLRM). Hed...

  19. Aktivitetsbasert pedagogikk; en studie av bachelorstudenters utvikling av handlingskompetanse gjennom aktivitetsbasert pedagogikk

    Directory of Open Access Journals (Sweden)

    Kari Margrete Hjelle

    2012-06-01

    Full Text Available Målet med artikkelen er å synliggjøre hvordan bachelorstudenter i ergoterapi kan utvikle profesjonell handlingskompetanse gjennom aktivitetsbasert pedagogikk. På bakgrunn av dette gjennomførte vi kvalitative fokusgruppeintervju med 12 ergoterapeutstudenter som hadde deltatt i undervisningsopplegget “Aktivitetsgrupper-lede og delta”. Datamaterialet ble analysert etter retningslinjer for fenomenologisk basert meningskondensering. Studentene diskuterte sine erfaringer og det kom tydelig fram at undervisningsopplegget ga dem muligheter til å bruke sitt engasjement og sin kreativitet i valg av aktiviteter for sin simulerte aktivitetsgruppe. Videre fikk de muligheter til å oppdage sider ved anvendelse av aktiviteter for ulike pasienter, som de ikke kunne forstå uten integrering av teori i praktisk ferdighetstrening. Ved planlegging, gjennomføring og refleksjon over å lede og delta i aktivitetsgrupper, oppøvet de evnen til handlingsrefleksjon. Aktivitetsbasert pedagogikk kan bidra til utvikling av profesjonell handlingskompetanse og det er behov for både teoretiske og praktiske læringsformer. Funnene ble diskutert i lys av pedagogisk handlingsteori.

  20. Low-Complexity Tools in AVS Part 7

    Institute of Scientific and Technical Information of China (English)

    Feng Yi; Qi-Chao Sun; Jie Dong; Lu Yu

    2006-01-01

    Audio Video coding Standard (AVS) is established by the AVS Working Group of China. The main goal of AVS part 7 is to provide high compression performance with relatively low complexity for mobility applications. There are 3 main low-complexity tools: deblocking filter, context-based adaptive 2D-VLC and direct intra prediction. These tools are presented and analyzed respectively. Finally, we compare the performance and the decoding speed of AVS part 7 and H.264 baseline profile. The analysis and results indicate that AVS part 7 achieves similar performance with lower cost.

  1. Overview of AVS-video: tools, performance and complexity

    Science.gov (United States)

    Yu, Lu; Yi, Feng; Dong, Jie; Zhang, Cixun

    2005-07-01

    Audio Video coding Standard (AVS) is established by the Working Group of China in the same name. AVS-video is an application driven coding standard. AVS Part 2 targets to high-definition digital video broadcasting and high-density storage media and AVS Part 7 targets to low complexity, low picture resolution mobility applications. Integer transform, intra and inter-picture prediction, in-loop deblocking filter and context-based two dimensional variable length coding are the major compression tools in AVS-video, which are well-tuned for target applications. It achieves similar performance to H.264/AVC with lower cost.

  2. Varmepumper i hushald. Analyse av endringar i effektforbruket hos hushald med panelomnar og vedfyring ved installasjon av ulike typar varmepumper

    OpenAIRE

    Øvrebotten, Kristian

    2015-01-01

    Sidan oljekrisa på 1970-talet som førte til ein gradvis overgang frå bruk av oljekjelar og parafinkaminar til panelomnar og varmepumper, har andelen elektrisitet stadig auka mens andelen av olje har vore redusert. Andelen av elektrisitet hos hushalda utgjer i dag om lag 79 % av den samla energibruken hos hushalda i Noreg. Dette høge forbruket av elektrisitet hos hushalda bidreg til å skape problem med høge effekttoppar i kraftnettet som igjen skapar problem for kraftdistributørar og er med...

  3. Environmental analysis of the system for the households' wastewater and organic waste. Synthesis of handling systems studied in the research program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall. Syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E. [Chalmers Inst. of Technology, Goeteborg (Sweden). Sanitary Engineering; Joensson, Haakan; Sonesson, Ulf [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Agricultural Engineering; Gruvberger, C.; Dalemo, M. [Swedish Inst. of Agricultural Engineering, Uppsala (Sweden); Stenstroem, T.A. [Swedish Inst. for Infections Disease Control, Stockholm (Sweden)

    2001-11-01

    Knowledge derived within the RandD programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20,000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised in

  4. Environmental system analysis of the waste water and organic wastes from households - synthesis of handling systems studied in the program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall - syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E.; Joensson, Haakan; Gruvberger, C.; Dalemo, M.; Sonesson, Ulf; Stenstroem, T.A. [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden)

    2001-03-01

    Knowledge derived within the R and D programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20 000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised

  5. Optimizing reed canary grass cropping to increase profitability. Field studies of plant varieties, intercropping with legumes and barley, fertilization and soil compaction; Optimering av odlingsaatgaerder i roerflen foer oekad loensamhet. Faeltstudier av sorter, samodling med baljvaexter och korn, goedsling samt markpackning

    Energy Technology Data Exchange (ETDEWEB)

    Palmborg, Cecilia; Lindvall, Eva (Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Agricultural Research for Northern Sweden)

    2010-05-15

    Reed Canary Grass is a promising crop for biofuel production. For reed canary grass the first year is an establishment year when the small biomass is not harvested. The second year the biomass is usually cut in late autumn but the harvest (removal of the biomass from the field) is delayed until spring. This technique has resulted in lower costs and increases in fuel quality through lower ash contents, including lower contents of chlorine, sodium and potassium. However costs for production are still high, especially establishment costs, fertilization costs and harvesting costs. The aim of this project was to test ways to cut costs per MWh by increased yields, and decreased establishment costs. The methods used have been variety trials to develop more productive plant material, intercropping with nitrogen fixing legumes to reduce the nitrogen demand of the crop, fertilization with waste material (sewage sludge, reed canary grass ash or poultry manure) and harvest at frozen ground as a strategy to reduce soil compaction and harvest damages on the crop. Reed canary grass grown as a fuel has so far been grown as a mono culture. However, when it is been grown for forage, or as a biogas crop, intercropping with legumes has been successful in some studies. In addition to NPK-fertilizers sewage sludge, ash from combustion of reed canary grass and poultry manure was used. An economic calculation showed that the establishment costs (the first two growing seasons) can be lowered by intercropping with red clover. However it is also involves more risks, related to weeds, and cannot be recommended on fallow soil with a large seed bank of weeds. A ten year old reed canary grass ley was used for the experiment. Two 25 m wide strips were harvested with a mower on November 19 2008 when the top soil was frozen. The harvested material was chopped and removed from the field the following day. The following spring, May 19 2009, the remaining reed canary grass on the field was cut with a

  6. A Novel MBAFF Scheme of AVS

    Institute of Scientific and Technical Information of China (English)

    Jian-Wen Chen; Guo-Ping Li; Yun He

    2006-01-01

    Adaptive frame/field coding techniques have been adopted in many international video standards for interlaced sequence coding. When the frame/field adaptation is applied on the picture level, the coding efficiency is improved greatly,compared with the pure frame coding or the pure field coding. The picture-level adaptive frame/field coding (PAFF) selects frame coding or field coding once for one picture. If this frame/field adaptation is extended to Macro Block (MB) level, the coding efficiency will be further increased. In this paper, a novel MB-level adaptive frame/field (MBAFF) coding scheme is proposed. In the proposed MBAFF scheme, the top field of the current picture is used as a reference. The experiments are implemented on the platforms of Audio Video coding Standard (AVS) base profile and H.264/AVC, respectively. On the AVS platform, 0.35dB gain can be achieved averagely, compared with AVS1.0 anchor. On the H.264/AVC platform, 0.16dB gain can be achieved averagely, compared with MBAFF scheme of H.264/AVC. Additionally, an extensive subjective quality enhancement can be achieved by the proposed scheme.

  7. Practical consequences of the Water Framework Directive implementation for combustion plants. New water cleaning technologies and methods for improvement of effluent discharges; Praktiska konsekvenser foer foerbraenningsanlaeggningar vid infoerandet av Vattendirektivet. Nya reningstekniker och foerbaettringsaatgaerder vid utslaepp till vatten

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Hansson, Christina [Carl Bro Energikonsult AB, Malmoe (Sweden)

    2004-11-01

    As a consequence of the growing impact on water resources the Water Framework Directive was legislated in 2000. The directive should ensure that a 'good water status' and entail a coordinated legislation striving for a long-term protection of all water resources. Stakeholders should be able to participate in the preparations of river basin management plans and programs of measures. District based water authorities will administrate the implementation and are mandated to decide upon regional environmental quality standards and promulgate fees for water use and discharges. The Directive contains a list of 33 prioritized substances that should be reduced or phased out. Discharges from combustion plants contain twelve, polyaromatic hydrocarbons (PAH) and heavy metals. PAH and heavy metals impacts growth and vital functions as respiration and photosynthesis of water living organisms and induces cancer in humans. NOEC-values (NO Effect Concentration) state manageable substance concentrations for an organism. Flue gas condensate contains concentrations of some of the substances which impact exceeds the critical state level. Extended sewage treatment could thus be needed. Sludge, wash and soot water contains elevated levels of heavy metals. This water is normally treated by municipal sewage treatment. Further treatment at plant site could be relevant. Presence of PAH and heavy metals in leach water depends on the precipitation. Additional flowing-independent water treatment could be relevant. It is very uncertain how plant owners will be affected. Licenses could be reviewed and standards could be raised for sensitive recipients; new limits for prioritized substances and standards for other types of discharges and water fees could be added. Respites could be given if costs exceed the benefits. Location, ecotoxicological risk assessments and precautionary measures could become more relevant in an EIA. Pricing of water could take place by using a system of emissions

  8. Risk assessment and zone classification of solid fuel plants in accordance with AFS 2003:3. ATEX; Riskbedoemning och zonklassning av fastbraensleanlaeggningar i enlighet med AFS 2003:3. ATEX

    Energy Technology Data Exchange (ETDEWEB)

    Haglund, Annika; Oeberg, AnnCharlott; Lindhe, Magnus [Inspecta AB, Stockholm (Sweden)

    2007-04-15

    Inspecta AB has composed a handbook in risk assessment and zone classification of solid fuel plants in accordance with the demands in AFS 2003:3 (regulations issued by Swedish Work Environment Authority). Several more or less severe accidents with dust explosions as the underlying cause occurs each year in Sweden. Many of these accidents occurs totally unexpected and perhaps even without understandings. 'It is only dust' AFS 2003:3 was made imperative 2006-07-01 and several plant owners are still uncertain of what procedures to make in order to fulfil the demands. The target group for the handbook is primarily plant owners but also people active in thermo-technical research and development. The prospect is to be an easy understandable handbook and for operators in the energy branch, on their own, independently of background knowledge, to be able to apply the method on a cost efficient way, and in that way fulfil the demands according to the so called explosion protection document. The number of unforeseen accidents with regard to explosive dust atmosphere will be decreased as a natural result of the implementation of the explosion protection documents. The handbook has a theory part with five complementary appendices. More than the other appendices, appendix B consist of a practical example which will take the reader step by step through how a risk assessment and zone classification of a solid fuel plant is made. Appendix B can be used separately, but the theory part should be read in order to understand the background for the dusts characteristics and other important factors.

  9. Aerobic effluent treatment with lower electric power consumption. Survey of results from questionnaire sent out to Swedish pulp and paper mills with biological effluent treatment plants; Aerob rening med laegre elfoerbrukning. Sammanstaellning av enkaetsvar fraan svenska skogsindustrier med biologisk rening

    Energy Technology Data Exchange (ETDEWEB)

    Sivard, Aasa; Simon, Olle

    2010-12-15

    A survey of the energy situation at 23 Swedish pulp and paper mills with aerobic effluent treatment plants has been performed. The electricity consumption for aeration equipment is about 80 % of the total electricity consumption. Proposed measures to increase energy efficiency are regular measurements of energy consumption, better control of the oxygen level in some mills and evaluation of measures to use the heat in process effluent before and after biological treatment

  10. Utveckling av ett webbforum med innehållshanteringssystemet Drupal

    OpenAIRE

    Lindqvist, Christoffer

    2010-01-01

    Detta examensarbete består av två huvuddelar. Den första delen är en teoretisk analys av innehållshanteringssystem i allmänhet och en forskning i hur det populära innehållshanteringsverktyget Drupal är uppbyggt. Den andra delen av arbetet är en praktisk genomgång av hur funktionalitet för ett webbforum kan byggas upp med hjälp av Drupals ramverk. Den teoretiska analysen undersöker vad ett innehållshanteringsverktyg är, vad det används till och vilka huvuddrag det i allmänhet består av. Sed...

  11. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  12. Kvinnors upplevelser av komplicerad förlossning

    OpenAIRE

    Samuelsson, Magdalena; Wahlberg, Christina

    2006-01-01

    Att vänta och föda barn beskrivs som en av de viktiga övergångsperioderna i livet och innebär ofta en personlig utveckling för den födande kvinnan. Då graviditeten och förlossningen av någon anledning kompliceras, kan denna process störas, och kvinnan kan istället få både fysiska och psykiska men i efterförloppet. Syftet med denna studie var att belysa kvinnors upplevelser av en komplicerad förlossning. Metoden var en granskning i form av en innehållsanalys av sju artiklar som utgjordes av fy...

  13. AVS 3D Video Coding Technology and System

    Institute of Scientific and Technical Information of China (English)

    Siwei Ma; Shiqi Wang; Wen Gao

    2012-01-01

    Following the success of the audio video standard (AVS) for 2D video coding, in 2008, the China AVS workgroup started developing 3D video (3DV) coding techniques. In this paper, we discuss the background, technical features, and applications of AVS 3DV coding technology. We introduce two core techniques used in AVS 3DV coding: inter-view prediction and enhanced stereo packing coding. We elaborate on these techniques, which are used in the AVS real-time 3DV encoder. An application of the AVS 3DV coding system is presented to show the great practical value of this system. Simulation results show that the advanced techniques used in AVS 3DV coding provide remarkable coding gain compared with techniques used in a simulcast scheme.

  14. Analyse av klimatilpassningstiltak : en casestudie av avløpsnettet i Veumdalen, Fredrikstad kommune

    OpenAIRE

    Myking, Jakob Severin Eide

    2012-01-01

    Økt forståelse av fortidens klimaendringer og klimasystemet i sin helhet, har gitt forskerne mulighet til å anta fremtidens klimaendringer. Denne økte forståelsen har gitt sikre tegn på at klimaendringene er knyttet til en stor grad av usikkerhet. Det eneste som er sikkert, er at klimaendringer kommer til å skje, og at det er umulig å si med sikkerhet når eller med hvilken kraft de vil inntreffe. Det som derimot kan sies med sikkerhet, er at befolkningen kommer til å øke. Dette vil føre til ø...

  15. Optimering av FISH- teknik för detektion av Laktobaciller

    OpenAIRE

    Hamidi, Helaleh

    2008-01-01

    Sammanfattning Syftet med den här studien var att utveckla och optimera FISH (Fluorescense In Situ Hybridisation) tekniken som en snabb och ganska billig metod för detektion av laktobaciller. Det vill säga att kunna på objektsglas använda FISH tekniken för att identifiera laktobaciller på artnivå med fluorescensmärkta prober mot 16S och 23S RNA. FISH är en allmän och användbar metod för att detektera och lokalisera mikroorganismer eller en specifik grupp av mikroorganismer i provet (1). Metod...

  16. Kunnskapsutvikling i et profesjonsperspektiv - En kvantitativ studie av sosialarbeideres bruk av kunnskapsressurser i arbeidslivet

    OpenAIRE

    2014-01-01

    Problemområde Profesjoner betraktes gjerne som grupper som rår over store deler av samfunnets ressurser. Som velferdsstatens portvakter anses de gjerne som grupper med definisjonsmakt og forvaltere av kunnskap (Molander og Smeby, 2013). Det moderne kunnskapssamfunnet byr imidlertid på nye utfordringer for profesjonsfeltet. Det stilles i økende grad krav til at profesjonsutøvere skal være faglig oppdaterte, utøve en kunnskapsbasert praksis og til en hver tid inneha nødvendig kompetanse. Sosial...

  17. Functional mathematical model of dual pathway AV nodal conduction.

    Science.gov (United States)

    Climent, A M; Guillem, M S; Zhang, Y; Millet, J; Mazgalev, T N

    2011-04-01

    Dual atrioventricular (AV) nodal pathway physiology is described as two different wave fronts that propagate from the atria to the His bundle: one with a longer effective refractory period [fast pathway (FP)] and a second with a shorter effective refractory period [slow pathway (SP)]. By using His electrogram alternance, we have developed a mathematical model of AV conduction that incorporates dual AV nodal pathway physiology. Experiments were performed on five rabbit atrial-AV nodal preparations to develop and test the presented model. His electrogram alternances from the inferior margin of the His bundle were used to identify fast and slow wave front propagations. The ability to predict AV conduction time and the interaction between FP and SP wave fronts have been analyzed during regular and irregular atrial rhythms (e.g., atrial fibrillation). In addition, the role of dual AV nodal pathway wave fronts in the generation of Wenckebach periodicities has been illustrated. Finally, AV node ablative modifications have been evaluated. The model accurately reproduced interactions between FP and SP during regular and irregular atrial pacing protocols. In all experiments, specificity and sensitivity higher than 85% were obtained in the prediction of the pathway responsible for conduction. It has been shown that, during atrial fibrillation, the SP ablation significantly increased the mean HH interval (204 ± 39 vs. 274 ± 50 ms, P AV node mechanisms and should be considered as a step forward in the studies of AV nodal conduction.

  18. AV nodal dual pathway electrophysiology and Wenckebach periodicity.

    Science.gov (United States)

    Zhang, Youhua; Mazgalev, Todor N

    2011-11-01

    The precise mechanism(s) governing the phenomenon of AV nodal Wenckebach periodicity is not fully elucidated. Currently 2 hypotheses, the decremental conduction and the Rosenbluethian step-delay, are most frequently used. We have provided new evidence that, in addition, dual pathway (DPW) electrophysiology is directly involved in the manifestation of AV nodal Wenckebach phenomenon. AV nodal cellular action potentials (APs) were recorded from 6 rabbit AV node preparations during standard A1A2 and incremental pacing protocols. His electrogram alternans, a validated index of DPW electrophysiology, was used to monitor fast (FP) and slow (SP) pathway conduction. The data were collected in intact AV nodes, as well as after SP ablation. In all studied hearts the Wenckebach cycle started with FP propagation, followed by transition to SP until its ultimate block. During this process complex cellular APs were observed, with decremental foot formations reflecting the fading FP and second depolarizations produced by the SP. In addition, the AV node cells exhibited a progressive loss in maximal diastolic membrane potential (MDP) due to incomplete repolarization. The pause created with the blocked Wenckebach beat was associated with restoration of MDP and reinitiation of the conduction cycle via the FP wavefront. DPW electrophysiology is dynamically involved in the development of AV nodal Wenckebach periodicity. In the intact AV node, the cycle starts with FP that is progressively weakened and then replaced by SP propagation, until block occurs. AV nodal SP modification did not eliminate Wenckebach periodicity but strongly affected its paradigm. © 2011 Wiley Periodicals, Inc.

  19. Legemiddelbivirkninger – forekomst og vurdering av årsakssammenhenger.

    Directory of Open Access Journals (Sweden)

    Tone Westergren

    2009-09-01

    Full Text Available En gjennomgang av spontanrapportene fra den norske bivirkningsdatabasen viser en betydelig geografisk variasjon når det gjelder innrapportering av bivirkninger. I Norge blir disse meldingene evaluert ved RELIS (Regionale legemiddelinformasjonssentre av tverrfaglige team bestående av leger og farmasøyter. Bivirkningsarbeidet ved RELIS gjøres på oppdrag fra Statens legemiddelverk, som har det overordnede ansvar for legemiddelovervåkningen i Norge. Vurderingene baseres på kjent risikoprofil for mistenkte legemidler, indikasjon, dosering, tidsmessig sammenheng mellom reaksjon og medikamentinntak, effekt av seponering og eventuelle andre risikofaktorer. 3345 legemiddel/bivirkningskombinasjoner ble vurdert på bakgrunn av 1408 rapporter i 2006. De fleste mistenkte bivirkningene ble klassifisert som mulige, ettersom andre faktorer også kunne ha spilt en rolle. Få bivirkninger ble klassifisert som sikre. Informasjon om bivirkninger i litteratur og databaser er i flere tilfeller preget av manglende homogenitet, tilfeldige sammentreff i tid, manglende data og lite vurdering av sammenhengen mellom reaksjonen og medisinbruken. Kliniske studier har begrenset mulighet til å påvise annet enn de vanligste bivirkningene. Det kan ta år etter markedsføring å fastslå sammenhengen med mer sjeldne bivirkninger. Frekvenstabeller for bivirkninger er anslag basert på et begrenset antall pasienter, spesielt for nye legemidler. Evaluering av bivirkningsrapporter fra helsepersonell kan avdekke mangel på lett tilgjengelig informasjon og bidra til ny kunnskap om et legemiddels bivirkningsprofil

  20. Russisk oljetransport gjennom Barentshavet : En tilfellestudie av den norske responsen

    OpenAIRE

    Aasen, Kari

    2010-01-01

    Oppgaven er en tilfellestudie av den norske responsen på økningen av russisk oljetransport gjennom Barentshavet. Oljetransporten fra Nordvest-Russland tok seg plutselig dramatisk opp i 2002, noe som kom svært overraskende på norske myndigheter. Hensikten med oppgaven har derfor vært å kartlegge den norske responsen, for å finne ut hva som har preget den. På bakgrunn av kjennetegnene ved responsen har jeg deretter forsøkt å sannsynliggjøre hvilke oppfatninger av Russland som vært dominerende. ...

  1. Possibilities of increased power output from existing generator plants. Feasible changes of existing generators. New technology, ASD (Adjustable Speed Drives); Muligheter for oekt effekt fra eksisterende generatoranlegg. Mulige endringer av bestaaende generatorer. Ny teknologi, ASD (Adustable Speed Drives)

    Energy Technology Data Exchange (ETDEWEB)

    Elstroem, A.

    1996-12-31

    The present paper relates to the increase of power output from existing generator plants in Norway by new operation profiles. The paper focuses on the consequences of increasing the power turnover and production with a particular attention to the generator itself. In addition, some of the possibilities on the use of an ASD (Adjustable Speed Drives) installation are elucidated, which is a concept on regulating the number of revolutions within small limits by synchronous rotation. According to the author, the power output of generator increases between 10 to 30%

  2. Factors affecting the conversion of Zn, Cu, Pb, and Cd in soils - the system of plants in forest; Faktorer som paavirker omsetning av Zn, Cu, Pb og Cd i jord - plantesystemet i skog

    Energy Technology Data Exchange (ETDEWEB)

    Berthelsen, B.O.

    1996-01-01

    The conference paper relates the factors affecting the conversion of long-range transported heavy metals in soils with the focus on the system of forest plants. The paper discusses themes like the mobility of metals in forest soils under the influence of artificial acidification, contribution from metal accumulation in ectomycorrhiza to metal levels in organic surface soils, importance of cutting areas for accumulation and transport of metals in surface soils, concentration of metals in forest vegetation in relation to temporal and geographic differences in the atmospheric precipitation of metals. 6 refs., 5 figs.

  3. Chemometric formulation of bacterial consortium-AVS for improved decolorization of resonance-stabilized and heteropolyaromatic dyes.

    Science.gov (United States)

    Kumar, Madhava Anil; Kumar, Vaidyanathan Vinoth; Premkumar, Manickam Periyaraman; Baskaralingam, Palanichamy; Thiruvengadaravi, Kadathur Varathachary; Dhanasekaran, Anuradha; Sivanesan, Subramanian

    2012-11-01

    A bacterial consortium-AVS, consisting of Pseudomonas desmolyticum NCIM 2112, Kocuria rosea MTCC 1532 and Micrococcus glutamicus NCIM 2168 was formulated chemometrically, using the mixture design matrix based on the design of experiments methodology. The formulated consortium-AVS decolorized acid blue 15 and methylene blue with a higher average decolorization rate, which is more rapid than that of the pure cultures. The UV-vis spectrophotometric, Fourier transform infra red spectrophotometric and high performance liquid chromatographic analysis confirm that the decolorization was due to biodegradation by oxido-reductive enzymes, produced by the consortium-AVS. The toxicological assessment of plant growth parameters and the chlorophyll pigment concentrations of Phaseolus mungo and Triticum aestivum seedlings revealed the reduced toxic nature of the biodegraded products.

  4. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  5. Avian post-construction studies and EIA for planned extension of the Hitra wind-power plant; EIA = environmental impact assessment; Ornitologisk etterundersoekelse og konsekvensutredning i tilknytning til planer for utvidelse av Hitra vindkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Bevanger, K.; Dahl, E.L.; Gjershaug, J.O.; Halley, D.J.; Hanssen, F.O.; Nygaard, T.; Pearson, M.; Pedersen, H.C.; Reitan, O.

    2010-03-15

    The results indicate that the annual number of dead birds recorded varies, and that an annual average probably is slightly less than two dead white-tailed eagles and four willow ptarmigans as long as 24 turbines are operating in the wind-power plant. The number of dead birds recorded is minimum figures. The total collision rate has not been estimated, however, the terrain where the power plant is located is difficult to search, and thus the habitat bias will be significant. Taking into account removal rate (scavenging bias) and search efficiency of the dog (search bias) it is assumed that the real number of casualties is somewhat higher. Dead birds are particularly found near turbines located at the edge of the power plant. There is insufficient evidence to conclude whether the recorded mortality for the white- tailed eagle is or is not acceptable with regard to short- or long-term population development. As regards the willow ptarmigan population, the data, while not conclusive, in combination with population censuses suggests that the power-plant extension will not be unacceptable for population development. Both for the white-tailed eagle and the willow ptarmigan an increased mortality must be expected when the power plant turbine number is increased.It is important to clarify whether there are established breeding pairs within the planning area, particularly in connection to the planned road access from the south. By building this road a general disturbance increase will take place. Whether the routing of the road will conflict with nest sites of red-listed species like the eagle owl and grey-headed wood- pecker is unknown as the routing not was known when the fieldwork took place during spring/summer 2009. There is, however, more reason to believe that the road might threaten an eagle owl territory than the contrary. The existing data are insufficient to conclude whether the encroachments connected to the road building from the south into the power-plant area

  6. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  7. The conditions for use of reed canary grass briquettes and chopped reed canary grass in small heating plants; Foerutsaettningar foer anvaendning av roerflensbriketter och hackad roerflen i mindre vaermecentraler

    Energy Technology Data Exchange (ETDEWEB)

    Paulrud, Susanne; Davidsson, Kent; Holmgren, Magnus A. (Swedish National Testing and Research Inst., Boraas (Sweden)); Hedman, Henry; Oehman, Rikard; Leffler, Joel (ETC, Piteaa (Sweden))

    2010-09-15

    The aim of this study was to test fuel blends of briquettes and chopped reed canary grass in three existing heating plants (50 kW - 500 kW) and elucidate the requirements for good performance and low emissions. In addition, the study investigated production of reed canary grass briquettes using a Polish screw press developed for straw. Some tests with a bale shredder were also undertaken. The screw press technique is of interest for reed canary grass because it is a simple technique, easy to handle, developed for small scale production, and for straw. The test with reed canary grass in this study showed that the technique worked well but that further adjustments and a longer test period are needed in order to achieve higher bulk density and mechanical strength. The test with chopped reed canary grass shows that a system with a forage harvester is slightly more effective than baling and cutting in a bale shredder. The study concluded that few existing heating plants of size 50 kW-1 MW that currently use wood fuels will be able to use reed canary grass without adjustment, conversion or replacement of the combustion equipment. Reed canary grass has 15-20 times higher ash content than wood briquettes and 2-3 times higher ash content than forest residue; the combustion equipment must be able to handle these properties. The boiler must be equipped with a continuously operating ashing system and it must be possible to move the ash bed mechanically. There is a risk of high content of unburned matter if the residence time in the boiler is too short, due to the structure and low bulk density of the reed canary grass ash. Using a blend of wood briquettes and reed canary briquettes results in lower ash content, but also affects the ash chemistry and tends to lower the initial ash fusion temperature compared to using 100 % reed canary grass. Blending chopped reed canary grass and wood chips in an existing small scale heating plant also requires measures to achieve an even fuel

  8. Simulation and cost analysis of systems for handling of fuel straw - applied to a heating plant in Skaane; Simulering och kostnadsanalys av hanteringssystem foer braenslehalm - tillaempning foer en vaermeanlaeggning i Skaane

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Daniel

    2010-05-15

    The following conclusions were drawn from this study: - The total costs for delivery of fuel straw to heating plants ranged from about 130 SEK/MWh to 180 SEK/MWh (1 SEK approx 0.14 USD), depending on the payment to farmers for the straw, the storage method used, the profit margins of the contractors, etc. - The area investigated, which covered parts of the municipalities of Svaloev, Esloev and Kaevlinge, has very good conditions for harvest of straw compared with other parts of Sweden. The yield of winter wheat (and straw) is high, the road network is well developed, the fields are concentrated and large, the straw crops ripen early, and security of supply between years is high. - For a harvest and handling system with an average capacity of about 8 000 tonnes of straw per year, the simulations showed that a machine system with six balers, two loaders in the field, four transporters (tractor), one loader at the stores and lorry transport to the heating plant was cost-effective with regard to system performance (for example, expressed as the average amount of straw baled per year with a moisture content below 18%, the average quantity of straw per year put into storage prior to 1 October, the average lying time for the straw between threshing and baling, etc.). - Harvesting straw from various crops (in this case winter rape, rye and winter wheat) instead of only winter wheat had no major impact on costs, but increased the chance to harvest 'greyer' straw with lower contents of alkali metals, chlorine, etc. Only including fields of at least 5 ha had a minor impact on costs. Noticeable cost savings occurred when the field size limit was set to 10 ha or more. Increasing the moisture content limit at baling to 20% made it possible to harvest more straw, especially in years with difficult weather conditions. - The storage method used had a decisive impact on costs. Outdoor storage decreased the total costs to 133 SEK/MWh (7% storage losses), compared with 154

  9. Noise and noise disturbances from wind power plants - Tests with interactive control of sound parameters for more comfortable and less perceptible sounds; Buller och bullerstoerningar fraan vindkraftverk - Foersoek med interaktiv styrning av ljudparametrar foer behagligare och mindre maerkbara ljud

    Energy Technology Data Exchange (ETDEWEB)

    Persson-Waye, K.; Oehrstroem, E.; Bjoerkman, M.; Agge, A. [Goeteborg Univ. (Sweden). Dept. of Environmental Medicine

    2001-12-01

    In experimental pilot studies, a methodology has been worked out for interactively varying sound parameters in wind power plants. In the tests, 24 persons varied the center frequency of different band-widths, the frequency of a sinus-tone and the amplitude-modulation of a sinus-tone in order to create as comfortable a sound as possible. The variations build on the noise from the two wind turbines Bonus and Wind World. The variations were performed with a constant dba level. The results showed that the majority preferred a low-frequency tone (94 Hz and 115 Hz for Wind World and Bonus, respectively). The mean of the most comfortable amplitude-modulation varied between 18 and 22 Hz, depending on the ground frequency. The mean of the center-frequency for the different band-widths varied from 785 to 1104 Hz. In order to study the influence of the wind velocity on the acoustic character of the noise, a long-time measurement program has been performed. A remotely controlled system has been developed, where wind velocity, wind direction, temperature and humidity are registered simultaneously with the noise. Long-time registrations have been performed for four different wing turbines.

  10. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  11. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  12. Bochdalek Hernia As A Cause Of Intermittent AV Block

    OpenAIRE

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-01-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  13. Introduction to AVS2 Scene Video Coding Techniques

    Institute of Scientific and Technical Information of China (English)

    Jiaying Yan; Siwei Dong; Yonghong Tian; Tiejun Huang

    2016-01-01

    The second generation Audio Video Coding Standard (AVS2) is the most recent video coding standard. By introducing several new coding techniques, AVS2 can provide more efficient compression for scene videos such as surveillance videos, conference videos, etc. Due to the limited scenes, scene videos have great redundancy especially in background region. The new scene video coding techniques applied in AVS2 mainly focus on reducing redundancy in order to achieve higher compression. This paper introduces several important AVS2 scene video coding techniques. Experimental results show that with scene video coding tools, AVS2 can save nearly 40%BD⁃rate (Bjøntegaard⁃Delta bit⁃rate) on scene videos.

  14. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  15. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  16. Mutagenesis in ORF AV2 affects viral replication in Mungbean yellow mosaic India virus

    Indian Academy of Sciences (India)

    A Rouhibakhsh; Q M I Haq; V G Malathi

    2011-06-01

    Mungbean yellow mosaic India virus (MYMIV) is a whitefly-transmitted begomovirus with a bipartite genome. We investigate the functions of the MYMIV-AV2 protein, the open reading frame present upstream of the coat protein gene in DNA A component. The ability of MYMIV-AV2 mutants to replicate, spread and cause symptoms in legume hosts, blackgram, cowpea and French bean was analysed. Plants agroinoculated with mutants K73R, C86S and the double mutant C84S, C86S showed increase in severity of symptoms compared with the wild type. However, mutants W2S and H14Q,G15E caused marked attenuation of symptoms. While the double mutants C84S,C86S caused a 50-fold increase in double-stranded supercoiled and single-stranded DNA accumulation, the mutations W2S and H14Q,G15E showed a decrease in double-stranded supercoiled and single-stranded viral DNA accumulation. Because AV2 mutants affect the ratio between open circular and supercoiled DNA forms, we hypothesize that these mutations may modulate the functions of the replication initiation protein.

  17. Bioseguridad en granjas avícolas

    Directory of Open Access Journals (Sweden)

    Sandra L. Ricaurte Galindo

    2005-02-01

    Full Text Available La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extraños a la granja, limpieza y desinfección de los galpones, control de visitas, evitar el stress en las aves encasetadas, evitar la contaminación del pienso, control de vacunaciones y medicaciones y control de deyecciones, cadáveres, etc.The biosecurity is the group of practical of handling designed to prevent the entrance and agents' pathologies transmission that can affect the sanity in the poultry farms. The biosecurity is since a fundamental part of any poultry company it provides an increase of the productivity of the chickens and hens and an increase in the economic yield. In general lines, the localization of the farm should be contemplated, characteristic constructive of the ship, control of strange chickens and hens to the farm, cleaning and disinfection of the ship, control of visits, to avoid the stress in the birds housed, to avoid the contamination of the I think, control of vaccinations and medications and dejections control, cadavers, etc.

  18. Phase 4 paroxysmal AV block in a patient with scleroderma.

    Science.gov (United States)

    Butschek, Ross; Powell, Brian D; Littmann, Laszlo

    2013-01-01

    A 72-year-old man with limited cutaneous systemic scleroderma was hospitalized for two episodes of witnessed syncope. The baseline 12-lead electrocardiogram was normal but on telemetry there were numerous episodes of paroxysmal AV block with asystolic periods of up to 7.5 s duration. Analysis of the rhythm strips revealed phase 4 intra-His bundle block characterized by critical P-P intervals that triggered the AV block, and a narrow range of junctional escape to subsequent P wave intervals that were required to release the AV block. A dual chamber pacemaker was implanted. Copyright © 2013 Elsevier Inc. All rights reserved.

  19. Ishockeykjelke - Understell: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  20. "Oktober i lederstolen" og "Harlekins Alle hjerters dag" : to noveller av Neil Gaiman : oversatt og kommentert

    OpenAIRE

    Eilertsen, Helle Elisabet Jæger

    2011-01-01

    Oppgaven består av oversettelser av to noveller skrevet av Neil Gaiman, og en kommentardel. Novellene er innenfor sjangeren fantastisk litteratur. Kommentardelen tar for seg relevante problemstillinger, blant annet oversettelse av navn, særegne uttrykk og dobbeltbetydning. Den tar også for seg hjemliggjøring/fremmedgjøring og valg av stil. Dette er knyttet til oversettelsesteoretikere som Schleiermacher, Nida, Koller og Berman.

  1. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  2. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  3. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  4. EST Table: AV399431 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399431 NV120218 10/09/28 91 %/131 aa ref|NP_047488.1| CG30 [Bombyx mori NPV] gb|A...AC63757.1| CG30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  5. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  6. EST Table: AV404175 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404175 pg--0560 10/09/28 100 %/209 aa ref|NP_040587.1| capsid component [Enteroba...EFF06860.1| phage major capsid protein E [Escherichia coli B185] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404434 pg-- ...

  7. EST Table: AV399451 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399451 NV120246 10/09/28 94 %/223 aa ref|NP_047521.1| AcMNPV orf124 [Bombyx mori ...NPV] gb|AAC63790.1| AcMNPV orf124 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399564 NV12 ...

  8. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  9. AV-95 Sun Devil: High-Speed Military Rotorcraft

    Science.gov (United States)

    1996-01-01

    The AV-95 Sun Devil must combine helicopter capabilities, such as vertical takeoff and landings (VTOL) and rotor-powered flight, along with long-duration cruise and high-speed dash capabilities unobtainable by conventional helicopters. To be able to perform both tasks, and perform them well, the AV-95 Sun Devil design incorporates several unconventional devices; the AV-95 uses two convertible turbofan engines, able to provide both shaft power for the main rotor and tall fan as well as jet thrust either separately or simultaneously. Other devices used for the AV-95 include a variable diameter main rotor and a blown flap. In helicopter mode, the AV-95 Sun Devil performs like a winged helicopter. The addition of wings to an attack helicopter results in two significant advantages. First, the addition of wings makes a helicopter more maneuverable than a wingless, but otherwise similar helicopter. Second, since the wings produce lift, rotor stall and compressibility effects can be significantly delayed at high tip velocities. In fixed-wing mode, the main rotor is completely off-loaded but slightly powered, and the rotor diameter has been minimized. The AV-95 Sun Devil has many advantages over other VTOL aircraft. The conversion process is simple and fast; conversion does not make the AV-95 vulnerable to enemy attack during conversion such as a tilt-wing or a tilt-rotor. Stop-rotor aircraft and a stowed rotor aircraft require heavy breaking of the rotor for conversion; this adds time for conversion and weight to the aircraft. Because the AV-95 never stops the rotor in flight, much weight is spared, and conversion is much simpler and faster.

  10. EST Table: AV404360 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404360 pg--0892 11/12/09 n.h 10/09/28 61 %/132 aa sp|P03764.2|STF_LAMBD RecName: ...Full=Side tail fiber protein 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404360 pg-- ...

  11. EST Table: AV399747 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399747 NV120691 10/09/28 89 %/128 aa ref|YP_950793.1| gp41 [Maruca vitrata MNPV] ...gb|ABL76015.1| gp41 [Maruca vitrata MNPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399524 NV12 ...

  12. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  13. Gradering av kvaliteten på dokumentasjonen

    Directory of Open Access Journals (Sweden)

    Gunn E. Vist

    2013-11-01

    Full Text Available Hva menes med at noe er ”godt dokumentert”? I hvilken grad kan vi stole på forskningsresultater? Den mest brukte metoden for å vurdere kvalitet på dokumentasjon og styrke på anbefalinger er GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE brukes i systematiske oversikter og i retningslinjer der man vurderer effekten av og gir anbefalinger om ulike behandlingsalternativer. I GRADE gjøres et klart skille mellom kvaliteten på dokumentasjonen og styrken på anbefalingene. For å vurdere kvaliteten på dokumentasjonen tar GRADE utgangspunkt i en godt utført systematisk oversikt som omfatter den aktuelle problemstillingen. Både randomiserte forsøk og observasjonsstuder kan inngå. GRADE benytter fem kriterier som vurderes for eventuell nedgradering av kvaliteten på dokumentasjonen: studiekvalitet, konsistens mellom studiene, direkthet, presisjon og rapporteringsskjevheter. I tillegg kan observasjonsstudier vurderes for oppgradering ved følgende tre kriterier: sterke assosiasjoner, dose-responseffekter og forvekslingsfaktorer. Alle vurderingene noteres og presenteres sammen med resultatene i oppsummeringstabeller.Vist GE, Sæterdal I, Vandvik PO, Flottorp SA. Grading the quality of the evidence. Nor J Epidemiol 2013; 23 (2: 151-156.ENGLISH SUMMARY What is meant by the claim that something is “well documented”? How much confidence can we have in the results? The most commonly used method to grade the quality of the evidence is GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE is used in systematic reviews, where the effects of different treatments or options are being compared, and in guidelines with recommendations about the competing options. GRADE makes a clear distinction between the quality of the evidence and the strength of recommendation. When grading the quality of the evidence with GRADE, the starting point is a well conducted systematic review of research on the

  14. Problemstillingar rundt framføring av transkribert musikk - Ei analyse av Bach/Busoni: Chaconne i d-moll

    OpenAIRE

    Flem, Kato Nogva

    2014-01-01

    Ei samanlikning og analyse av Busoni sin transkripsjon av Bach sin Chaconne frå partita nr. 2 for solofiolin. Partita for Violin No. 2 was written by Johann Sebastian Bach during 1717-1723 and consists of five movements; Allemande, Courante, Sarabande, Gigue and Chaconne. The chaconne is longer than the rest of the piece combined, and is frequently played separately. Yehudi Menuhin calls the Chaconne "the greatest structure for solo violin that exists." (Menuhin, 1997, p. 236) Violinist...

  15. Enhanced A-V nodal conduction (Lown-Ganong-Levine syndrome) by congenitally hypoplastic A-V node.

    Science.gov (United States)

    Ometto, R; Thiene, G; Corrado, D; Vincenzi, M; Rossi, L

    1992-11-01

    The basic anatomical substrate of enhanced A-V nodal conduction, manifesting or not as Lown-Ganong-Levine syndrome, is still a controversial issue. We describe the case of a 34-year-old man who presented episodes of ventricular fibrillation. Electrophysiological studies showed that the AH interval was 55 ms, and increased by only 20 ms at paced cycle lengths of 300 ms; atrial pacing induced atrial fibrillation, with a shortest RR interval of 240 ms. Despite verapamil therapy, this patient died suddenly at home. Histological study disclosed a severe A-V node hypoplasia that was evidently congenital in nature; the rest of the conduction system was normal, and no accessory A-V pathways were present. We suggest that enhanced A-V nodal conduction in this patient was due to the developmental defect in the A-V node; this abnormality caused a loss of specific impulse-delaying function, and thus allowed rapid, unfiltered atrial impulses to reach the lower A-V junction and ventricles.

  16. Experiences of membrane technique in flue gas condensate treatment applications; Utvaerdering av erfarenheter av membranteknik foer rening av roekgaskondensat

    Energy Technology Data Exchange (ETDEWEB)

    Goldschmidt, Barbara; Ekdahl, Emma; Hellman, Mats

    2009-07-01

    Investing in a flue gas condensate treatment plant often turns out to be very profitable. The profitability comes from savings in energy and water consumption when treated waste water is recirculated, and also from savings in the NO{sub x} fee as condensate treatment allows for higher ammonia injection rates in the SNCR (NO{sub x} reduction) system. The membrane based technologies for flue gas treatment, which were investigated in this report, have proven to be successful and are operating well. However, they require that the project management is committed and acquaint themselves with the technology to avoid problems during commissioning and operation. In this project, experience with membrane based flue gas condensate treatment at ten different plants was investigated and evaluated. The ten plants are either biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. Membrane based flue gas condensate treatment is used by circa ten Swedish plants (Ultra Filtration membranes and/or Reverse Osmosis membranes, and at some plants also membranes for ammonia and carbon dioxide removal). All plants are biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. In Sweden, no plant firing municipal waste has yet been equipped with membrane based flue gas condensate treatment. These plants usually use precipitation and filtration technologies instead. Also the purpose of the condensation step is primarily to operate as a wet flue gas cleaning step. The heat recovery is of subordinate importance. Typical for these plants is also that they use condensation in several steps. The condensates from the different steps are often treated separately, as they may be of very different qualities. The RO unit is the main equipment in a membrane based water treatment plant. Pre-treatment and post-treatment of the RO water is adjusted to the incoming condensate quality, and to the requirements on the effluent. The

  17. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  18. 快速 AVS 帧内预测算法%FAST AVS INTRA PREDICTION ALGORITHM

    Institute of Scientific and Technical Information of China (English)

    王双龙

    2015-01-01

    As to the complexity process of choosing best probable encoding mode in AVS intra prediction,we proposed a fast intra predic-tion encoding algorithm.With the analysis of AVS intra prediction encoding theory and its implementation in reference software GDM2.1,we derived the threshold of zero coefficient block determination.The fast algorithm determines whether or not the current block is a zero coeffi-cient block according to its threshold discriminant condition.For zero coefficient block,it encodes cbp element directly and terminates intra prediction encoding in advance,which avoids the consequent complex process.As for the non-zero coefficient blocks,the fast selection algo-rithm associating the time domain SAD and the frequency domain SATD is used,which excludes 40% to 80% impossible prediction modes, and the rate distortion function is applied to the remained prediction modes to select the best prediction mode.It was verified through experi-ment that when PSNR (peak signal-to-noise ratio)decreased within 0.25db and bits rate increased within 2%,the time of AVS encoding de-creased over 40%,and the encoding efficiency was largely improved as well.%针对 AVS(Audio Video code Standard)帧内预测中选择最优编码模式流程复杂的问题,提出一种快速帧内预测编码的算法。通过分析 AVS 帧内预测编码的原理及其在参考软件 GDM2.1中的代码实现,推导出判定零系数块的阈值。该快速算法根据零系数块的判定阈值条件判定当前块,对于零系数块,直接编码 cbp 元素,提前中止帧内预测编码,避免了后续的复杂流程;对于非零系数块,采用时域 SAD(Sum of Absolute Difference)与频域 SATD(Sum of Absolute Transformed Difference)相联合的快速选择算法,排除了40%~80%的不可能预测模式,对余下的模式采用率失真代价函数的方法选取最佳预测模式。经实验验证,在 PSNR(Peak Sig-nal to Noise Ratio)降低0

  19. Kortisonskepsis : En studie om holdninger til kortisonkrem blant foreldre av barn med atopisk eksem

    OpenAIRE

    Gustavsen, Hanne Engstrøm

    2010-01-01

    Bakgrunn: Kortisonkremer er en viktig del av behandlingen mot atopisk eksem. Mange foreldre er skeptiske til bruken av kortisonkremer, fordi de har lest eller hørt om bivirkninger. Pasienters og pårørendes holdninger til bruk av kortisonkrem kan påvirke gjennomføringen av behandlingen. Formål: Vi ønsket å undersøke holdninger til bruk av kortisonkrem blant foreldre og pårørende av barn med atopisk eksem. Vi ville også undersøke om det er en sammenheng mellom kunnskapsnivå om kortisonkreme...

  20. Utviklingen av Noark-standarden 1984 – 2008

    Directory of Open Access Journals (Sweden)

    Trond Sirevåg

    2014-11-01

    Full Text Available Artikkelen behandler utviklingen av Noark – standarden for elektronisk arkivdanning i norsk offentlig forvaltning – fra versjon 1 (1984 til versjon 5 (2008. Den beskriver omstendighetene som medførte at standarden ble til i 1984, og søker å forklare hvorfor og hvordan det lyktes å utbre standarden slik at Noark-systemer ble enerådende i offentlig forvaltning i løpet av 1990-årene. Riksarkivarens strategier i Noark-utviklingen behandles, – de som fra først av fikk Riksarkivaren til å engasjere seg i standardiseringsarbeidet, de som deretter fikk Riksarkivaren til å overta forvalteransvaret for Noark, og de som senere er endret eller justert som resultat av erfaringer med Noark-baserte systemer og av nyåpnede teknologiske muligheter. Særlig vekt legges på å belyse Riksarkivarens motiver for å overta ansvaret for Noark-standarden fra 1990. Noark plasseres også i det internasjonale bildet, og sammenholdes med andre standarder som ISO 15489 og EU-standarden MoReq. Da Noark-utviklingen startet i 1984, pågikk tilsvarende utviklingsprosjekter både i Danmark og i Sverige. Artikkelen søker forklaringer på at en journal- og sakarkivstandard bare ble en realitet i Norge.

  1. Cloning and characterization of trichome-specific promoter of cpr71av1 gene involved in artemisinin biosynthesis in Artemisia annua L.

    Science.gov (United States)

    Wang, Yueyue; Yang, Ke; Jing, Fuyuan; Li, Meiya; Deng, Ting; Huang, Runze; Wang, Boshi; Wang, Guofeng; Sun, Xiaofen; Tang, Ke-Xuan

    2011-01-01

    Artemisinin, a sesquiterpene lactone endoperoxide derived from Artemisia annua L. (Asteraceae), is the most effective antimalarial drug. We used two methods: genome walking and thermal asymmetric interlaced polymerase chain reaction, to isolate the unknown 5'-flanking sequence of the cyp71av1 gene. The subsequent sequence analysis using bioinformatics software revealed that there are several cis-acting elements inside the cyp71av1 promoter. The 5'-rapid amplification of the cDNA ends method was used to determine the transcription start site of the cyp71av1 gene. We then mapped it at the 18 base upstream of the ATG initiation codon. For simple functional characterization, we built fusion vectors between the 5'-deletion promoter and the gas reporter gene. The expression levels of the transferred vectors into A. annua L. were analyzed by the transient expression way. The beta-glucuronidase assay results indicated that deletion of the region to -1551 bp did not lead to much damage in the GUS activity, whereas further deletion, to -1155 bp, resulted in a 5.5-fold reduction of GUS activity. In stabilized transgenic A. annua L. seedlings we observed that GUS expression was restricted to trichomes, which means that the promoter of the cyp71av1 gene is trichome-specific. Compared with the constitutive CaMV 35S promoter, which can express genes throughout the plant, influence on the trichome system through the trichome-specific expression promoter merely imperils plant growth. In addition, the promoter of the cyp71av1 gene contains several binding sites for transcription factors, which implies that the cyp71av1 promoter responds to more than one form of stimulation.

  2. Kartläggning av byggprocessen hos Peab med hjälp av SCOR

    OpenAIRE

    Johansson, Robin

    2012-01-01

    Detta är ett examensarbete utfört på Institutionen för teknik och naturvetenskap (ITN) i Norrköping som är en del av Linköpings Universitet i samarbete med Peab som intressent. Historiskt sett har byggbranschens intresse för logistik varit svalt vilket har lett till att logistiken inom denna bransch har halkat efter i förhållande till övriga branscher. Syftet med detta examensarbete är att utifrån ett logistiskt synsätt tillhandahålla anpassningsförslag till SCOR-processerna ”Make” och ”Retur...

  3. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  4. Solmoduler på balkongfronter : Renovering av flerbostadshus i miljonprogrammet

    OpenAIRE

    Persson, Maria

    2015-01-01

    Under det senaste seklet har en intensiv energianvändning orsakat stora utsläpp av koldioxid och andra växthusgaser i atmosfären med negativa miljöeffekter som följd. Den alltjämt ökade efterfrågan på elektricitet runtom i världen måste mötas av förnybara energikällor i kombination med energieffektiviseringar för att inte riskera ytterligare miljöförstöring. I Sverige är bostads- och servicesektorn en intensiv energianvändare och några av de byggnader som förbrukar mest energi finns i miljonp...

  5. En kartläggning av stereoskopisk 3D

    OpenAIRE

    Holmström, Benny

    2011-01-01

    Det här lärdomsprovet är en genomgång av ett av den moderna tidens största modeord: stereoskopisk 3D och syskontermen autostereoskopisk 3D. Kort sagt de tekniker som går ut på att leverera en bild till vardera av människans två ögon och därmed simulera djup i tvådimensionella bilder. Det här kan göras på en mängd olika sätt, och i detta examensarbete går jag igenom de vanligaste teknikerna och förklarar dem kortfattat, en och en. Utöver tekniken analyserar jag även dagens marknad, teknikernas...

  6. Brachial artery aneurysms following brachio-cephalic AV fistula ligation.

    Science.gov (United States)

    Khalid, Usman; Parkinson, Frances; Mohiuddin, Kamran; Davies, Paula; Woolgar, Justin

    2014-01-01

    Peripheral artery aneurysms proximal to a long-standing arteriovenous (AV) fistula can be a serious complication. It is important to be aware of this and manage it appropriately. Vascular access nurses input all data regarding patients undergoing dialysis access procedures into a securely held database prospectively. This was retrospectively reviewed to identify cases of brachial artery aneurysms over the last 3 years. In Morriston Hospital, around 200 forearm and arm AV fistulas are performed annually for vascular access in renal dialysis patients. Of these, approximately 15 (7.5%) are ligated. Three patients who had developed brachial artery aneurysms following AV fistula ligation were identified. All 3 patients had developed brachial artery aneurysms following ligation of a long-standing brachio-cephalic AV fistula. Two patients presented with pain and a pulsatile mass in the arm, and one presented with pins and needles and discoloration of fingertips. Two were managed with resection of the aneurysm and reconstruction with a reversed long saphenous vein interposition graft, the third simply required ligation of a feeding arterial branch. True aneurysm formation proximal to an AV fistula that has been ligated is a rare complication. There are several reasons for why these aneurysms develop in such patients, the most plausible one being the increase in blood flow and resistance following ligation of the AV fistula. Of note, all the patients in this study were on immunosuppressive therapy following successful renal transplantation. Vigilance by the vascular access team and nephrologists is paramount to identify those patients who may warrant further evaluation and investigation by the vascular surgeon.

  7. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  8. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_3_ORF2 E26799A422BE33BE PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) NA ? IPR015500 unintegrated ...

  9. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  10. Modellering og dimensjonering av kaianlegg etter Eurokode 2

    OpenAIRE

    Lilleaker, Tore; Tvervåg, Henrik

    2010-01-01

    Dette er sluttrapporten for masteroppgaven på en kaikonstruksjon utført ved NTNU, institutt for konstruksjonsteknikk. Det er i oppgaven gjennomført en prosjektering og dimensjonering av en betongkai etter NS-EN 1992-1-1. Det er også gjennomført et litteraturstudie med en tilhørende teoridel om bestandighet for betongkonstruksjoner i et marint miljø, samt at det er gjennomført en sannsynlighetsbasert bestandighetsanalyse av denne konstruksjonen. Avslutningsvis er det drøftet litt rundt teori, ...

  11. EST Table: AV403981 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available terminase large subunit (DNA packaging protein A) from bacteriophage origin [Escherichia coli UMN026] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403981 pg-- ... ...AV403981 pg--0297 11/12/09 n.h 10/09/28 100 %/265 aa ref|YP_002411376.1| terminase large subunit (DNA packag...ing protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1|

  12. Modellering av nedslagsfeltet- Veumdalen i Fredrikstad med programmet SWMM

    OpenAIRE

    2015-01-01

    Fredrikstad kommune har hatt store prosjekter pågang i de siste årene i forbindelse med opprustning av ledningsnettet. Oppfylte kjellere har vært en viktig tema for kommunen, og de har en intensjon om å redusere faren for oversvømmelser i utsatte steder. En av de utsatte stedene i Fredrikstad er Veumdalen som har problemer med oversvømmelser nesten hvert år. Som en forebyggende tiltak har kommunen i samarbeid med COWI bygget en tunnel fra Veumveien/Veumbekken til Seutelva. Det ...

  13. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  14. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  15. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  16. EST Table: AV399757 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399757 NV120719 11/12/09 n.h 10/09/28 83 %/234 aa ref|NP_047435.1| AcMNPV orf30 [...Bombyx mori NPV] gb|AAC63704.1| AcMNPV orf30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399757 NV12 ...

  17. Prosjektering og analyse av Nordøyvegen bru 3

    OpenAIRE

    Lauknes, Andreas; Arild, Audun

    2016-01-01

    Rapporten tar for seg prosjektering av en etteroppspent betongbru, der beregninger og dimensjoneringen er i henhold til det Europeiske regelverket, nasjonale tillegg og Håndbøker fra Statens vegvesen. Brua som skal dimensjoneres og bli gjort kapasitetskontroll for er Nordøyvegen bru 3, som skal bygges som en del av et større fastlandsprosjekt for nordøyene i Haram kommune. Brua skal bygges som en bjelke-/platebru, og konstruksjonsmetoden er fritt frambygg med totalt syv byggefaser. Den består...

  18. Fysisk aktivitet inom rehabiliteringen av anorexi : - En systematisk litteraturstudie

    OpenAIRE

    Högnäs, Maria

    2011-01-01

    Studiens syfte var att undersöka hur fysisk aktivitet påverkar unga flickor (12-24 år) med anorexi, i samband med rehabilitering. Skribenten vill dessutom ytterligare få specificerat vilken typ av fysisk aktivitet som kan vara lämplig för denna målgrupp. Frågeställningarna besvaras genom en systematisk litteraturstudie. Genom databassökning och frisökning hittades 14 relevanta artiklar som genomgick en kvalitetsgranskning, enligt en modifierad metod för kvalitetsgranskning av Forsberg & Wengs...

  19. Norsk passivhusstandard og Passivhauskonzept: en sammenlignende analyse av krav og kriterier

    DEFF Research Database (Denmark)

    Anton, Karin; Vestergaard, Inge

    kriterier som omfattes av passivhuskonseptet med tilhørende sertifisering og kriterier i Norsk Standard 3701. Gjennom analysen ønsker vi å systematisere og sammenlikne de forskjellige kriteriene i standarden: optimalisering, kuldebroer, lufttetthet og trykktesting, utnyttelse av passiv solenergi, bruk av...

  20. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...

  1. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  2. Long-time effects of run-off water from ash recycling to a planted forest. Final report for a partial study in the project 'Forestry measures - effects on carbon-, nutrients and heavy metal flows' financed by the Swedish Energy Agency; Laangtidsverkan paa avrinnande vatten av askaaterfoering till plantskog. Slutrapport foer en delstudie inom det av Energimyndigheten finansierade projektet 'Skogliga aatgaerder - effekter paa kol-, naering och tungmetalIfloeden'

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Torbjoern; Eriksson, Hillevi

    2001-06-01

    The chemical composition of runoff from a wood ash fertilized catchment in central Sweden has been studied during eight years after the treatment. The effects of the ash treatment was compared with a 12 year long reference period and a reference catchment close to the ash treated area was earlier (winter 1980/81) whole-tree-harvested to 90 %. At the same time the reference area was stemwood harvested on 60 % of the area. Both areas were planted with spruce and pine. Granulated ash was spread on the whole-tree-harvested area, by helicopter, on two occasions (1 ton per hectare in May 1989 and 2 tonnes per hectare in October 1991). During the first ash application a marked peak in K concentration was observed. The second ash application caused a high peak in K concentration. Short-lived peaks was also observed for pH, electric conductivity, ANC, Mg, Na and Cl. Significant increases of pH, electric conductivity, Ca, K and Cl was observed in runoff water from the ash treated area during the 8-year-period after the last ash spreading. However, during the same period concentrations of NH{sub 4}-N, NO{sub 3}-N and total N have shown a relative decrease in runoff water from the ash treated area, compared to the reference area.

  3. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  4. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  5. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  6. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  7. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  8. EST Table: AV405806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405806 wdV30260 10/09/28 65 %/199 aa ref|NP_001119709.1| transformer 2 isoform E ...[Bombyx mori] gb|AAX47003.1| transformer-2 protein E [Bombyx mori] 10/08/28 low homology 10/08/27 low homolo

  9. EST Table: AV400604 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400604 br--1517 10/09/28 48 %/208 aa ref|XP_001863389.1| wolfram syndrome 1 [Cule...x quinquefasciatus] gb|EDS38516.1| wolfram syndrome 1 [Culex quinquefasciatus] 10/08/28 50 %/173 aa FBpp0291

  10. EST Table: AV398407 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398407 NV021774 10/09/28 100 %/186 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...507-PA 10/09/10 48 %/236 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  11. EST Table: AV398495 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398495 NV021874 10/09/28 91 %/209 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 54 %/213 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  12. EST Table: AV401468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401468 e96h0771 10/09/28 87 %/171 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 55 %/166 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 e96h ...

  13. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  14. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  15. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  16. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  17. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  18. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  19. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  20. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  1. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  2. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  3. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  4. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  5. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  6. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  7. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  8. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  9. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  10. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  11. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  12. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  13. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  14. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  15. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  16. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  17. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  18. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  19. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  20. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  1. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  2. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  3. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  4. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  5. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  6. EST Table: AV399507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399507 NV120319 10/09/28 70 %/144 aa ref|YP_803401.1| baculovirus repeated ORF-b [Anticars...ia gemmatalis nucleopolyhedrovirus] gb|ABI13791.1| baculovirus repeated ORF-b [Anticarsia gemmatali

  7. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  8. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  9. EST Table: AV403894 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ref|XP_001605691.1| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/08/28 52...%/206 aa gi|189241712|ref|XP_968082.2| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] AV403894 pg-- ...

  10. Centralized Library Services for Audiovisual Media. AV in Action 4.

    Science.gov (United States)

    Nederlands Bibliotheek en Lektuur Centrum, The Hague (Netherlands).

    Designed to provide assistance to countries in developing centralized services to their libraries for nonbook materials, this pamphlet contains examples from five countries that have succeeded in establishing such services. Those examples include: (1) "The Central Library Service for AV-Materials in Denmark" (Suzanne Hemmeth…

  11. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  12. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  13. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something about...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  14. EST Table: AV398194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398194 NV021231 10/09/28 38 %/170 aa ref|NP_724426.2| vulcan, isoform D [Drosophi...la melanogaster] gb|AAM68355.2| vulcan, isoform D [Drosophila melanogaster] 10/08/28 38 %/170 aa FBpp0289730

  15. EST Table: AV406060 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406060 wdV30561X 10/09/28 99 %/122 aa gb|ACN86367.1| troponin T transcript varian...006588#locus:tnt- 3#status:Partially_confirmed#UniProt:B9WRS6#protein_id:AC M46022.1 10/09/10 81 %/122 aa AG

  16. EST Table: AV405690 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405690 wdV30118 10/09/28 93 %/225 aa ref|NP_001040124.1| exuperantia [Bombyx mori] gb|ABD36117.1| exuperan...9360-PA 10/09/10 53 %/220 aa gi|91085815|ref|XP_974770.1| PREDICTED: similar to exuperantia [Tribolium castaneum] FS919769 wdV3 ...

  17. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  18. EST Table: AV401871 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401871 heS00267 11/12/09 GO hit GO:0046872(metal ion binding) 10/09/28 65 %/194 aa gb|ACR61720.1| triglyce...ride lipase [Manduca sexta] 10/08/28 48 %/206 aa FBpp0147001|DgriGH13095-PA 10/08/2

  19. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  20. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  1. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  2. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  3. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  4. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  5. EST Table: AV405516 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405516 wdV10864 10/09/28 33 %/180 aa ref|XP_969213.1| PREDICTED: similar to artemis...0768|ref|XP_969213.1| PREDICTED: similar to artemis protein [Tribolium castaneum] FS920671 wdV1 ...

  6. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  7. Forskerskoler som modeller for forskerutdanning: Progresjon og utvikling av ekspertise

    Directory of Open Access Journals (Sweden)

    Sten Ludvigsen

    2013-12-01

    Full Text Available I de senere årene har forskerskoler blitt fremhevet som en mulig løsning på ulike utfordringer innenfor forskerutdanningen. På bakgrunn av erfaringer med to forskerskoler innenfor utdanningsvitenskap, vil vi i denne artikkelen belyse to problemstillinger: Hvordan kan man organisere læringsforløpet til ph.d.-kandidatene slik at det støtter deres progresjon? Og hva må forskerutdanningen inneholde for at ph.d.-kandidatene skal utvikle tilstrekkelig ekspertise innenfor et avgrenset kunnskapsområde?For å skape progresjon, bør utdanningsprogrammet bidra til å gi struktur og angi faglig retning. Videre må utdanningselementene være relevante for avhandlingsarbeidet. I tillegg kan progresjon fremmes gjennom seminarer, der utviklingen av tekster og artikler følges opp. Argumentet om at forskerskoler bør bygge på gode forskningsmiljøer har stått sentralt i utredningen av ulike modeller for forskerutdanning i Norge. Ett aspekt som har fått økende oppmerksomhet er betydningen av å oppnå en tilstrekkelig grad av spesialisering. Uten utvikling av en slik ekspertise, vil ph.d.-kandidatene ikke kunne publisere internasjonalt og delta i forskningsfellesskap.Ved Det utdanningsvitenskapelige fakultet har man de siste 10 årene utviklet flere typer forskerskoler. I denne artikkelen tar vi utgangspunkt i den UiO-finansierte, tematisk avgrensede forskerskolen «Læring, kommunikasjon og IKT» (2004–2008 og den NFR-finansierte nasjonale forskerskolen i utdanningsvitenskap, NATED (2008–2016, hvor ph.d.-kandidatene deltar i faglige aktiviteter organisert i fire spor.Metodene som brukes for å besvare problemstillingene omfatter intervjuer, spørreskjema og refleksjoner vedrørende de to ulike forskerskolene.Resultatene viser at man kan oppnå nødvendig spesialisering, høy kvalitet, høy tilfredshet og høy relevans ved bruk av forskerskoler som virkemiddel i forskerutdanningen. Begge forskerskolene har tilrettelagt for internasjonal

  8. Minimizing ventricular pacing by a novel atrioventricular (AV) delay hysteresis algorithm in patients with intact or compromised intrinsic AV conduction and different atrial and ventricular lead locations.

    Science.gov (United States)

    Pakarinen, Sami; Toivonen, Lauri

    2013-09-01

    To investigate if an advanced AV search hysteresis (AVSH) algorithm, Ventricular Intrinsic Preference (VIP(™)), reduces the incidence of ventricular pacing (VP) in sinus node dysfunction (SND) with both intact and compromised AV conduction and with intermittent AV block regardless of the lead positions in the right atria and the ventricle. Patients were classified as having intact AV (AVi) conduction if the PR interval was ≤ 210 ms on ECG and 1:1 AV conduction during atrial pacing up to 120 bpm with PR interval ≤ 350 ms. Otherwise the AV conduction was classified as compromised (AVc). Both AVi and AVc patients were randomized to VIP ON or OFF. VIP performed an intrinsic AV conduction search every 30 s for three consecutive atrial cycles with the extension of the sensed and paced AV (SAV/PAV) delays from basic values of 150/200 ms to 300/350 ms. Extended AV intervals were allowed for three cycles when VP occurred before returning to basic AV delays. The primary end-point was %VP at 12 months. Among 389 patients, 30.1% had intact and 69.9% had compromised AV conduction. The mean %VP at 12 months was 9.6% by VIP compared to 51.8% with standard AV settings in patients with AVi (P < 0.0001) and 28.0% versus 78.9% (P < 0.0001) with AVc. With VIP, excessive %VP among most used lead positions was not seen. Conversely, when VIP was off %VP was low only in patients who had leads in the RA septal-RV septal position (23.0%). VIP feature reduces VP both in patients with SND and with intermittent heart block regardless of the lead positions in the right atria and the ventricle.

  9. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  10. Fra strømfordeling til pengestrøm? : Statnett fra forvaltningsbedrift til statsforetak : en konsekvensanalyse av omorganiseringen av Statnett seks år etter

    OpenAIRE

    Knudsen, Halvor Gillund

    1998-01-01

    Fra strømfordeling til pengestrøm? Statnett fra forvaltningsbedrift til statsforetak en konsekvensanalyse av omorganiseringen av Statnett seks år etter. Tema for oppgaven er konsekvenser av endrete tilknytningsformer i staten. Temaet er kommet frem gjennom tilknytning til et samarbeidsprosjekt mellom Universitetet i Oslo ved Vitenskapsbutikken og Arbeids- og administrasjonsdepartementet. Årsaken til at man ønsker å se på slike forhold er den stadige kritikken mot en etter sigende alt for...

  11. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  12. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  13. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  14. Forbuden frukt smaker best en studie av nordmenns spise- og drikkemønster av sjokolade, søtsaker, salt snacks, sukkerholdige leskedrikker og lignende

    OpenAIRE

    Bugge, Annechen Bahr

    2010-01-01

    Denne studien er en del av forskningsprosjektene Young Food og HealthMeal. Begge prosjektene er finansiert av Norges forskningsråd. Temaet i rapporten er nordmenns spise- og drikkemønster av en type mat og drikke som helsemyndighetene ønsker at befolkningen skal redusere forbruket sitt av – slik som sjokolade, søtsaker, søte bakervarer, salt snacks og sukkerholdige drikker. Selv om forbruksutviklingen de seneste par årene har vist positive tendenser, har altså nordmenn fremdeles et langt høye...

  15. En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap

    OpenAIRE

    2014-01-01

    Abstrakt Utvecklingsarbetet ”En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap”, är en fortsättning på examensarbetet ”Abort - En systematisk översikt av kvinnornas upplevelser och av vårdpersonalens betydelse” som publicerades och presenterades våren 2013. Syftet med utvecklingsarbetet är att producera en handlingsmodell för hälsovårdspersonalen. Handlingsmodellen kommer att ge råd och tips på hur man som hälsovårdspe...

  16. Cloning and characterization of a novel apolipoprotein gene, apolipoprotein AV, in tree shrews.

    Science.gov (United States)

    Li, Guoping; Luo, Huairong; Sun, Guotao; Wu, Guisheng; Wu, Gang; Wang, Yan; Man, Yong; Wang, Shu; Li, Jian; Chen, Baosheng

    2013-09-01

    Apolipoprotein AV (apoAV) modulates plasma triglyceride levels, which is an independent risk factor for cardiovascular disease. ApoAV is also involved in atherosclerosis lesion formation. In order to systematically evaluate the apolipoprotein-related gene profile in tree shrew, a model for its insusceptibility to atherosclerosis, we performed apoAV cloning and characterization. The full-length cDNA of apoAV was identified using SMART-RACE. ApoAV cDNA sequence revealed two transcripts, 1,948 and 1,397 base pairs, due to alternative polyadenylation. These two transcripts share the same open reading frame (ORF), which encodes a 369-amino acid protein with high identity to human apoAV (75 %), including a 23-amino acid N-terminal signal peptide. ApoAV is expressed exclusively in the liver. Mature apoAV was expressed in E. coli BL21(DE3) and purified by Ni-chelated resin. Lipoprotein lipase activity was significantly stimulated by this recombinant protein. The full-length ORF of apoAV was cloned into pDsRed-monomer-N1 vector with a red fluorescent protein tag and was primarily localized in cytoplasm of hepG2 cells. The successful cloning, expression and localization of apoAV in tree shrew has laid down the foundation for further investigation on its structure and functions.

  17. Viktigheten av fysisk aktivitet og trening blant eldre

    Directory of Open Access Journals (Sweden)

    Hilde Lohne-Seiler

    2012-11-01

    Full Text Available Regelmessig fysisk aktivitet er viktig for eldres helse. Sammenhengen mellom en fysisk aktiv livsstil og helsegevinster som forebygging av sykdom, opprettholdelse av uavhengighet og økt livskvalitet er godt dokumentert (ACSM's Position Stand 1998; Spirduso & Cronin, 2001; Taylor et al., 2004. Hensikten med denne oversiktsartikkelen er derfor å redegjøre for viktigheten av regelmessig fysisk aktivitet og trening i aldringsprosessen, samt utdype sammenhengen mellom en fysisk aktiv livsstil og fysisk funksjon blant eldre. Basert på en nasjonal multisenterstudie (Anderssen et al., 2009, tilfredsstilte 20% voksne og eldre (20-85 år de nasjonale anbefalinger om 30 minutter med daglig fysisk aktivitet. Kun 12% i den eldste aldersgruppen (80-85 år tilfredsstilte anbefalingene. Totalt fysisk aktivitetsnivå, målt ved hjelp av akselerometer, ble redusert med økende alder, hvor de eldste (80-85 år hadde 50% lavere aktivitetsnivå sammenlignet med de yngste (65-69 år (Lohne-Seiler et al., 2012. Fra 25-års alder reduseres utholdenhet og muskelstyrke med 10% per 10 år dersom individet er inaktiv (Heath et al., 1981; Wilmore, 1991. Systematisk utholdenhets- og styrketrening ser derimot ut til å redusere tapet med inntil halvparten, det vil si en reduksjon tilsvarende 5% per 10 år hos fysisk aktive individer (Heath et al., 1981. Eldre individer ser ut til å ha de samme treningsinduserte effekter som yngre, det vil si at man får effekt av økt aktivitet uansett alder, og da også lik prosentvis fremgang (Hagberg et al., 1989. Studier har vist at det er mulig å øke maksimalt oksygenopptak og maksimal muskelstyrke med inntil 10-20% i løpet av en 12 ukers intervensjon (Hagberg et al., 1989; Reeves et al., 2003; Lohne-Seiler et al, in press. Da muskelstyrke ser ut til å ha en sterk sammenheng med individets funksjonsevne/mobilitet, er det viktig å kunne tilrettelegge for systematisk styrketrening for eldre for på den måten å oppnå

  18. Kartlegging av læreres kunnskap er ikke enkelt

    Directory of Open Access Journals (Sweden)

    Reidar Mosvold

    2015-05-01

    Full Text Available Læreres kunnskap har betydning for elevenes læring, og som et ledd i prosessen for styrking av kvaliteten i norsk skole har politikere i senere tid ytret ønske om å kartlegge læreres kunnskap. Kartlegging av læreres kunnskap er imidlertid ikke enkelt, og i denne artikkelen undersøker vi hvordan de samme lærernes undervisningskunnskap i matematikk kan se ut til å være forskjellig når den måles ved hjelp av oppgaver med ulikt format. Deltakerne i studien var 30 praktiserende lærere, og instrumentet besto av 28 flervalgsoppgaver med tilhørende åpne oppgaver. Sammenhengen mellom lærernes kunnskap slik den måles ved hjelp av flervalgsoppgavene og de åpne oppgavene er ikke alltid klar. Det er derfor nødvendig å tilnærme seg måling av læreres undervisnings-kunnskap i matematikk med stor varsomhet. Nærmere undersøkelser er nødvendig for å finne ut hva slags type kunnskap som kan måles med ulike typer oppgaver og hva slags måleinstrumenter som kan brukes til hvilke formål.Nøkkelord: Undervisningskunnskap i matematikk, kartlegging, måleinstrument-er, flervalgsoppgaver AbstractTeachers’ knowledge influence students’ learning, and as part of their attempts to increase the quality of Norwegian schools, politicians have announced their intentions to measure the knowledge of teachers. Measuring teacher knowledge is not straightforward, however, and this article investigates how a group of mathematics teachers’ knowledge might appear different when measured by items of different formats. The participants in this study were 30 in-service teachers, and the instrument consisted of 28 multiple-choice items with associated open-response items. The connection between the teachers’ know-ledge as measured by multiple-choice items and open-response items is not always straightforward. As an implication, it is necessary to approach measure-ment of teachers’ mathematical knowledge for teaching with great care. Further studies are

  19. Avsluttende studentevaluering i Bachelorutdanningen : avgangsstudenters vurdering av undervisning og utdanning ved Politihøgskolen, Kull 05–08

    OpenAIRE

    Hove, Kjersti

    2010-01-01

    Denne rapporten inneholder en oppsummering og enkle analyser av studenters evaluering av utdanningen ved slutten av studiet. Evalueringen bygger delvis på spørsmål hentet fra StudData, og en tilsvarende rapport fra HiO ( Hatlevik, Ida Katrine Riksaasen: Avgangsstudenten – Studentenes vurdering av undervisning, praksis, studieforhold, tilegnet kompetanse, studieatferd og fremtidig utdanning. HiO-notat nr 2 -2009) hvor analyser av flere studentgruppers evalueringer er sammenstilt. Rapporten fra...

  20. Sifting of waste; Siktning av avfall

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Andreas [SP Technical Research Inst. of Sweden, Boraas (Sweden); Johnsson, Anders [Boraas Energi och Miljoe, Boraas (Sweden); Yoshiguchi, Hitomi [Stena Metall, Goeteborg (Sweden); Steenari, Britt-Marie [Chalmers Tekniska Hoegskola, Goeteborg (Sweden); Bostroem, Sara [Renova AB, Goeteborg (Sweden); Fredaeng, Julia [Dalkia, Stockholm (Sweden); Bisaillon, Mattias [Profu AB, Moelndal (Sweden); Andersson, Hans [Metso Power, Tammerfors (Finland)

    2008-08-15

    Waste as a fuel is characterized by high levels of inert components (ash) that may cause problems in a combustion process that result in high costs for operation and maintenance (e.g. large ash flows, high need for additives). A potential method for reduction of these costs is to separate inert components through sifting prior the combustion process. Previously it has been found that a major share of the unwanted components is found in the fine grains. However, the practical relevance of sifting has not been verified against boiler performance. Therefore, the prospects for sifting as a pre-treatment method was investigated at Boraas Energi och miljoe with the aim to characterize the composition in the fine-grained residues and to determine the effects from sifting on the boiler performance. The project includes also a short report on possible markets for the fine-grained residues. The effect target is to increase the boiler availability and to reduce the cost for operation and maintenance. The target groups for the work are owners of Energy-from-Waste plants as well as constructors of plants and sieves. The work shows that sifting can be beneficial from an economical point of view if a suitable market for the fine-grained residues is found. Several theoretical markets exist but the governing parameter is the actual costs for the post-treatment.

  1. Wirevagn : Utvecklingen av en utrullare för hisslinor

    OpenAIRE

    Rehnsfeldt, Patrik

    2014-01-01

    Kandidatexamensarbetet som utgick från en förfrågan från företaget Irongrip AB hade som mål att utveckla ett produktförslag på en utlindare av stålvajer för hissmontörer. Irongrip AB som tillverkar och säljer verktyg för hantering av stålvajer hade uppmärksammat att en efterfrågan på en sådan produkt fanns på marknaden då befintliga lösningar var bristfälliga och inte hade alla de funktioner som är önskvärda hos en sådan produkt.Arbetet inleddes med en förstudie där studiebesök vid lindragnin...

  2. EST Table: AV400562 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400562 br--1452X 10/09/28 59 %/160 aa ref|XP_001843664.1| neuroendocrine protein ...7b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 41 ...47 %/159 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  3. EST Table: AV400244 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400244 br--1010 10/09/28 53 %/100 aa ref|XP_001654557.1| neuroendocrine protein 7...b2 [Aedes aegypti] gb|EAT46754.1| neuroendocrine protein 7b2 [Aedes aegypti] 10/08/28 n.h 10/08/27 n.h 10/09/10 low homology 10/09/10 n.h 10/09/10 n.h BP115163 br-- ...

  4. EST Table: AV398380 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398380 NV021745 10/09/28 70 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV02 ...

  5. EST Table: AV399091 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399091 NV060650 10/09/28 71 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV06 ...

  6. EST Table: AV399252 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399252 NV060970 10/09/28 62 %/104 aa ref|NP_001119705.1| transformer 2 isoform A ...[Bombyx mori] gb|AAT42220.2| transformer-2 protein A [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 low homology 10/09/10 low homology NM_001126237 NV06 ...

  7. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  8. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  9. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  10. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  11. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  12. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  13. EST Table: AV398139 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398139 NV021172 10/09/28 46 %/243 aa ref|XP_001661901.1| DNA mismatch repair protein muts... [Aedes aegypti] gb|EAT36110.1| DNA mismatch repair protein muts [Aedes aegypti] 10/08/28 43 %/238 a...el|GB10970-PA 10/09/10 42 %/247 aa gi|91082687|ref|XP_971522.1| PREDICTED: similar to DNA mismatch repair protein muts [Tribolium castaneum] BY922838 NV02 ...

  14. Effekter av endringer i finansieringsansvaret for TNF-hemmere

    OpenAIRE

    Hagen, Terje P.; Bjarkum, Irina; Hobbel, Silje; Orderdalen, Karianne

    2009-01-01

    Tumor necreosis factor alfa (TNF-a) - hemmere, og andre biologiske inflammatoriske modifiserende legemidler blir brukt innen reumatologi, gastroenterologi og dermatologi. I denne rapporten analyseres effekter av endringer i finansieringssystemet for seks legemidler som faller innenfor disse legemiddelgruppene og som langt på vei er substitutter: Humira, Enbrel og Remicade som er TNF-hemmere, Raptiva og Orencia som er registrert under kategorien selektive immunsuppressiver og MabThera som er r...

  15. EST Table: AV401797 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401797 heS00172 10/09/28 94 %/235 aa ref|NP_001036831.1| saposin-related [Bombyx ...9/10 low homology 10/09/10 low homology 10/09/10 41 %/191 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 heS0 ...

  16. EST Table: AV401078 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401078 e96h0200 10/09/28 42 %/112 aa ref|XP_001648294.1| Juvenile hormone-inducib...le protein, putative [Aedes aegypti] gb|EAT44634.1| Juvenile hormone-inducible protein, putative [Aedes aegy... 10/09/10 36 %/106 aa gi|91080979|ref|XP_974925.1| PREDICTED: similar to Juvenile hormone-inducible protein, putative [Tribolium castaneum] FS808716 e96h ...

  17. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    skull". Trots stora framsteg inom medicinen finns det skäl att stanna upp och fråga: Vad håller vi på med egentligen? Redaktörerna och författarna till denna bok lyfter fram behovet av att reflektera över medicinsk praktik och att kritiskt granska de teorier som ligger till grund för vad vi gör. I boken...

  18. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  19. Toward robust AV conferencing on next-generation networks

    Science.gov (United States)

    Liu, Haining; Cheng, Liang; El Zarki, Magda

    2005-01-01

    In order to enable a truly pervasive computing environment, next generation networks (including B3G and 4G) will merge the broadband wireless and wireline networking infrastructure. However, due to the tremendous complexity in administration and the unreliability of the wireless channel, provision of hard-guarantees for services on such networks will not happen in the foreseeable future. This consequently makes it particularly challenging to offer viable AV conferencing services due to their stringent synchronization, delay and data fidelity requirements. We propose in this paper a robust application-level solution for wireless mobile AV conferencing on B3G/4G networks. Expecting no special treatment from the network, we apply a novel adaptive delay and synchronization control mechanism to maintain the synchronization and reduce the latency as much as possible. We also employ a robust video coding technique that has better error-resilience capability. We investigate the performance of the proposed solution through simulations using a three-state hidden Markov chain as the generic end-to-end transport channel model. The results show that our scheme yields tight synchronization performance, relatively low end-to-end latency and satisfactory presentation quality. The scheme successfully provides a fairly robust AV conferencing service.

  20. Synliggörande av tyst kunskap i gymnasial yrkesutbildning

    Directory of Open Access Journals (Sweden)

    Mats Lundgren

    2012-04-01

    Full Text Available Yrkesutbildning skiljer sig från andra former av gymnasieutbildning genom att den innehåller praktisk kunskap som kan vara svårfångad, ofta benämnd som tyst kunskap. Tyst kunskap utgör en förutsättning för att yrkeselever ska kunna tillägna sig ett yrkes kultur, praxis och kunskapstradition. Med utgångspunkt i yrkeslärares berättelser beskrivs i artikeln med stöd av tre definierade kompetensområden, 1 yrkesfältet, 2 handlag i yrket samt 3 interaktion och social kompetens, hur yrkeslärare arbetar för att möjliggöra att ett yrkes tysta kunskaper kan läras i en skolmiljö. Resultatet visar betydelsen av att yrkeslärares tysta kunskaper blottläggs för eleverna genom att de i sin undervisning, berättar, visar och ställer frågor. Det är i dessa möten som den tysta kunskapens betydelse i yrkesutövning kan bli synlig för eleverna.

  1. Bruk av ordlæringsstrategier blant norske tyskelever

    Directory of Open Access Journals (Sweden)

    Anna Gausland

    2011-05-01

    Full Text Available Interessen for forskning på læringsstrategier er økende i Norge. Det finnes likevel ennå ingen publiserte empiriske studier som fokuserer på læringsstrategier i andre fremmedspråk. Hensikten med den foreliggende artikkelen er å gi et første innblikk i 54 norske tyskelevers bruk av ordlæringsstrategier. Studien er gjennomført som en skriftlig spørreundersøkelse hvor elevene beskrev hvordan de hadde arbeidet for å lære en liste med tysk-norske ordpar. Samlet sett ser vi at elevene behersker ordlæringsstrategier av ulik art, men at noen få strategier er hyppig forekomne hos de fleste elevene. Det viser seg at elevene i hovedsak bruker ordlæringsstrategier som inneholder element av repetisjon, altså strategier som krever lite kognitiv bearbeiding. Dernest blir metakognitive strategier som organiserer og planlegger læringen mest brukt. Artikkelens siste del sammenligner funn fra undersøkelsen med internasjonale studier og skisserer videre forskningsbehov innen feltet.

  2. Operational performance of Swedish grid connected solar power plants. Automatic data collection; Driftuppfoeljning av svenska naetanslutna solcellsanlaeggningar. Automatisering av datainsamling

    Energy Technology Data Exchange (ETDEWEB)

    Hedstroem, Jonas; Svensson, Stefan

    2006-09-15

    A performance database containing all grid-connected PV-systems in Sweden has been in operation since March 2002. The systems in the database are described in detail and energy production is continuously added in the form of monthly values. The energy production and the system descriptions are published on www.elforsk.se/solenergi. In august 2006 31 active systems were present in the database. As result of the Swedish subsidy program this number is expected to increase to over 100 systems in the next years. The new owners of PV-systems are obliged to report the produced electricity to the authorities at least once a year. In this work we have studied different means to simplify the collection of data. Four different methods are defined. 1. The conversion of readings from energy meters made at arbitrary distance in time into monthly values. 2. Methods to handle data obtained with the monitoring systems provided by different inverter manufactures. 3. Methods to acquire data from PV-systems with energy meters reporting to the green certificate system. 4. Commercial GSM/GPRS monitoring systems. The first method is the minimum level required by the authorities. The second and third methods are the use of equipments that are expected to be used by some PV-systems for other reasons. Method 4 gives a possibility to create a fully automatic collection method. The described GPRS-systems are expected to have an initial cost of roughly 4000 SEK and a yearly fee of 200 SEK (1 SEK {approx} 0.14 USD)

  3. Särhållning av gruvavfall med avseende på syrabildande potential : en studie av svenska sulfidmalmsgruvor

    OpenAIRE

    Sellin, Jessica

    2016-01-01

    Gruvavfall utgör över 80 % av den totala mängden avfall i Sverige. Avfallet från gruvindustrin kan påverka våra ekosystem negativt om tungmetaller och försurande ämnen lämnar materialet. I Sverige utgör avfall från sulfidmalmer störst risk för miljön eftersom det innehåller mineral som genom kontakt med luft vittrar och producerar surt och metallhaltigt lakvatten. Efterbehandling av dessa material är viktigt för att förhindra läckage till omgivningen. Eftersom efterbehandli...

  4. Mellom bibel og menneskerettigheter : en studie av Vårt Land og Dagens vinkling av Palestina/Israel-konflikten

    OpenAIRE

    2005-01-01

    Sammendrag Tittel: Israel og Palestina mellom bibel og menneskerettigheter. - Vinkling av Palestina/Israelkonflikten i avisene Vårt Land og Dagens lederartikler Spørsmålsstilling: Hvilke holdninger til Palestina/Israel-konflikten reflekterer lederartikler i de to kristne dagsavisene Dagen og Vårt Land? Er det mulig å spore en endring i vinklingen over tid? Hvordan kan disse lederartiklene gi oss innblikk i en debatt om Palestina/Israel-konflikten blant kristne i Norge? Metode...

  5. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  6. Har forhold under svangerskapet betydning for utviklingen av otitis media?

    Directory of Open Access Journals (Sweden)

    Kari J. Kværner

    2009-10-01

    Full Text Available  SAMMENDRAGMed utgangspunkt i data fra et populasjonsbasert utvalg av 7 992 norske tvillinger ble sammenhengenmellom gjentatte ørebetennelser og forhold under svangerskapet studert. Som parametre på intrauterinevekstforhold ble informasjon om fødselsvekt og gestasjonsalder fra Medisinsk Fødselsregister benyttet.Informasjon om rapporterte øreinfeksjoner ble basert på spørreskjemaer som ble besvart av tvillingene ialderen 18–25 år. Først studerte vi individuelle effekter av fødselsvekt og gestasjonsalder på forekomsten avotitis media (OM. Rapportert fødselsvekt hos individer med OM var signifikant lavere enn hos kontrollene,med en gjennomsnittsforskjell på 86 gram. Hos de som rapporterte OM var gjennomsnittlig gestasjonsalder3 dager kortere enn i kontrollmaterialet. Deretter beregnet vi effekten av fødselsvekt ved bruk av co-twinkontroll metoden. Blant monozygote (MZ tvillingpar gjenspeiler fødselsvektforskjeller innenfor tvillingparetintra-uterine miljøforskjeller. Blant dizygote (DZ par kan vektforskjellen være både genetiske ogmiljøbetinget. Ved sammenligning av fødselsvektforskjeller innenfor tvillingparene er tvillingen som ikkehar gjentatte øreinfeksjoner en matchet kontroll blant OM diskordante par. Resultatene antyder at lavfødselsvekt er en risikofaktor for otitis media. Gjennomsnittlig vektforskjell blant par diskordante for OMvar 48 gram, og den av tvillingen som ikke rapporterte OM hadde signifikant høyere fødselsvekt.Kværner KJ, Tambs K, Harris J, Magnus P. Do pregnancy-related factors influence the development ofotitis media? Nor J Epidemiol 1997; 7 (1: 55-58.  ENGLISH SUMMARYThe association between intrauterine growth, as measured by weight and gestational age, and the occurrenceof recurrent ear infections was studied using data from a population based sample of 7992 Norwegian twins.Perinatal measures were collected from the Medical Birth Registry, and reports of recurrent ear infectionswere based on

  7. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  8. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  9. Rail transportation of biofuels; Jaernvaegstransport av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Frosch, Martin; Thoren, Peter

    2010-05-15

    The project has had the task of describing how the rail transportation of biofuels can be increased. This has been made by analyzing the current conditions of five transmission terminals and five different CHP plants, henceforth called reference cases, and the prevailing conditions at their reception terminals. For each of the five reference cases several transport solutions have been created that take in consideration how these conditions affect the efficiency of the transport solutions for 23 different relations. The study will also show to what extent reduction of environmental impacts can be achieved with the rail transportation of biofuels as alternative to road transport. Three of the reference cases are in operation, one under construction and one in the development phase. To develop transportation solutions and identify potential catchment areas for biofuels a slightly higher resolution than what normally is analyzed in existing literature is required. Therefore, these analysis have been made for each of the relevant catchment areas with the help of forest assessment data, kNN-data, from the Swedish agricultural university (SLU), statistics of peat production from the Swedish geological survey (SGU) and the Forestry boards (Skogsstyrelsen) statistical yearbook of 2008. The calculations underlying the transport solutions are relating to the sustainability of each catchment area, constraints and opportunities at both the reception and transmission terminals, and the practical solutions for wagons, containers and number of possible weekly circulations. The target audience is the heating and CHP plants in Sweden, wishing to use rail transport of biofuels, regardless of available infrastructure since remote receiving terminals also can be used if needed. The results of the economical analysis for all possible relations are based on calculations with 20 wagons in each circulation. Due to topographic limitations and limited traction capacity all relations

  10. Implementering av nye GOLD-stadier hos pasienter med KOLS i allmennpraksis

    OpenAIRE

    Storaker, Marit Aarvaag; Nerwey, Ibrahim; Kierulf-Strømme, Kirsten; Tengesdal, Randi Hauge; Wyller, Nora Guttormsgaard; Skårn, Elling Skeide; Cagrici, Ufuk

    2014-01-01

    Bakgrunn: GOLD (Global Initiative for Chronic Obstructive Lung Disease) lanserte i 2011 nye kriterier for gradering av alvorlighetsgrad av KOLS, der man i tillegg til FEV1 ved spirometri også tar hensyn til antall eksaserbasjoner og pasientens symptombyrde. Mange pasienter havner i en lavere risikogruppe etter den nye inndelingen, og er følgelig overbehandlet med f.eks. inhalasjonssteroider. Andre kan identifiseres tidligere som høyrisikopasienter for hyppige eksaserbasjoner og raskt tap av l...

  11. STUDY ON EFFICIENT COMPUTATION AND PERFORMANCE OF AV-BASED REDUCED-RANK FILTERING

    Institute of Scientific and Technical Information of China (English)

    Xu Bin; Yang Chenyang; Mao Shiyi

    2005-01-01

    In this paper, the complexity and performance of the Auxiliary Vector (AV) based reduced-rank filtering are addressed. The AV filters presented in the previous papers have the general form of the sum of the signature vector of the desired signal and a set of weighted AVs,which can be classified as three categories according to the orthogonality of their AVs and the optimality of the weight coefficients of the AVs. The AV filter with orthogonal AVs and optimal weight coefficients has the best performance, but requires considerable computational complexity and suffers from the numerical unstable operation. In order to reduce its computational load while keeping the superior performance, several low complexity algorithms are proposed to efficiently calculate the AVs and their weight coefficients. The diagonal loading technique is also introduced to solve the numerical unstability problem without complexity increase. The performance of the three types of AV filters is also compared through their application to Direct Sequence Code Division Multiple Access (DS-CDM A) systems for interference suppression.

  12. Utveckling av mjukglassomrörare : En studie för ökad luftinblandning

    OpenAIRE

    2010-01-01

    Den här rapporten är ämnad som underlag till ett fortsatt utvecklingsarbete av en omrörare för mjukglassmaskiner. I en mjukglassmaskin kyls glassen under kontinuerlig omrörning, på så vis blandas luft in och ger glassen fluffighet. Omrörarens huvudfunktioner är luftinblandning, avskrapning av iskristaller längs innerhöljet av kylcylindern samt utmatning av mjukglass mot öppningsdörr. Med en ny utformning ska omröraren bidra till en mer kostnadseffektiv mjukglass-maskin samt ge en godare glass...

  13. Handlingsplan för ägare av transformatorer med korrosiv olja

    OpenAIRE

    Weidemann, Stephan

    2016-01-01

    Sedan början av 2000-talet har ett stort antal transformatorer havererat av en initialt, okänd anledning. Problemet visade sig vara att en antioxidationstillsats i oljan, dibensyl disulfid (DBDS), reagerat med kopparen i lindningarna och vilket gett upphov till avlagringar på isolationspapperet i form av kopparsulfid. Kopparsulfiden i sin tur försvagade papperets isolationsförmåga och allvarliga driftstörningar eller driftstopp på grund av kortslutningar kan ske. Ett stort antal studier har g...

  14. NATO i krigen mot terror : En analyse av NATOs rolle i Afghanistan etter 11. september

    OpenAIRE

    Berg-Hansen, Susanne

    2007-01-01

    Denne oppgaven studerer NATOs rolle i den USA-ledede Operation Enduring Freedom i Afghanistan. Noen timer etter terrorangrepet mot USA 11. september 2001, påkalte NATO for første gang i historien sin grunnpilar, Artikkel 5 i NATO-traktaten, som fastslår at et angrep på ett av medlemmene er et angrep på alle NATO-landene. Til tross for alliansens påkallelse av Artikkel 5, ble NATO stående på sidelinjen i hovedfasen av "Operation Enduring Freedom". USA valgte å gjennomføre mesteparten av kamp...

  15. Tibetanisering : religiøs og etnisk utdanning av tibetanske flyktningbarn i Nord-India

    OpenAIRE

    Lind, Trude

    2007-01-01

    Religiøs sosialisering og nasjonal identitet blant tibetanske flyktningbarn i Nord-India er tema for denne oppgaven. Mye av materialet bygger på feltarbeidet jeg utførte ved Tibetan Children’s Village (TCV) Dharamsala høsten 2003. TCV regnes som en av de viktigste sekulære utdanningsinstitusjonene for tibetanerne i eksil. Siden den kinesiske invasjonen av Tibet i 1950 har mer en 100 000 tibetanere flyktet over fjellene i Himalaya til India, Nepal og Bhutan. Et av Dalai Lamas og eksilregje...

  16. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  17. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  18. Overvåking av vassdrag i Ringsaker - Undersøkelser av innsjøer og bekker i 2012

    OpenAIRE

    Løvik, J.; Brettum, Pål

    2013-01-01

    Rapporten omhandler vannkvalitet og miljøtilstand i fire innsjøer og fem mindre vassdrag i Ringsaker kommune i 2012. Hovedvekten er lagt på effekter av næringsstoffer, dvs. overgjødsling. Basert på mengder og sammensetning av planteplankton, sammensetning av dyreplankton samt fysisk/kjemiske støtteparametre vurderes innsjøenes økologiske tilstand mht. overgjødsling som følger: Ljøsvatnet: moderat, Sjusjøen: moderat, men nær grensen til god og Næra og Botsenden: god. Vurderingene bør betraktes...

  19. An uncommon case of spontaneous conversion from AV re-entry tachycardia to AV nodal re-entry tachycardia in a patient with dual tachycardia.

    Science.gov (United States)

    Zeljković, Ivan; Benko, Ivica; Manola, Šime; Radeljić, Vjekoslav; Pavlović, Nikola

    2015-01-01

    We report the case of a 46-year old patient in whom an electrophysiology study (EP) was performed due to paroxysmal supraventricular tachycardia documented in 12-lead ECG. During the EP study, supraventricular tachycardia was induced easily and it corresponded to orthodromic AV reentry tachycardia (AVRT) using a concealed left free wall accessory pathway. However, during the study AVRT spontaneously and repeatedly converted to the typical slow-fast AV node reentry tachycardia (AVNRT). Both accessory and AV nodal slow pathways were ablated, due to the finding that both AVRT and AVNRT were independently inducible during the EP study.

  20. Karakterisering av vannkjemisk status i bekker og innsjøer før utbygging av E 18 Grimstad-Kristiansand

    OpenAIRE

    Hindar, A.

    2005-01-01

    Førtilstanden er kartlagt for i alt 25 bekke- og innsjølokaliteter som blir krysset av planlagt E 18 fra Grimstad til Kristiansand. Forsuring har stått i fokus fordi deler av vegstrekningen vil gå gjennom sulfidgneis, og fordi det er avdekket omfattende problemer med avrenningsvann ved utsprengning i slik berggrunn. Det har vært et mål å forsøke å skille effekten av sur nedbør fra den påvirkning ueksponert og eksponert sulfidgneis gir. Naturtilstand i kombinasjon med sur nedbør gir sulfatkons...

  1. Harmonikk for det indre øret : En studie av harmonikk som assosiasjonsgiver i Bernard Herrmanns musikk til filmen Vertigo av Alfred Hitchcock

    OpenAIRE

    Bøe, Brynjar

    2012-01-01

    I denne oppgaven tar jeg for meg Bernard Herrmanns musikk til filmen Vertigo fra 1958, regissert av Alfred Hitchcock. Jeg vil forsøke å finne sammenhenger mellom komponistens bruk av harmonikk og filmfortellingen for øvrig. Jeg vil se hvilke hvordan filmkomponisten være med på å fortelle historien i filmen, og hvilke musikalske virkemidler, med vekt på harmonikkrelaterte sådan, han/hun har til rådighet for å gjøre dette. Jeg vil se på noen av de musikalske valgene Herrmann har tatt...

  2. Sensorisk realisme i Carlos Reygadas' Post Tenebras Lux (2012) - En undersøkelse av tilskuerhenvendelsen i lys av nyere realismeteori og filmfenomenologi

    OpenAIRE

    Johnson, Silja Espolin

    2015-01-01

    I dette prosjektet undersøker den meksikanske filmregissøren Carlos Reygadas fjerde og nyeste spillefilm Post Tenebras Lux (2012) i lys av den nærværsbaserte og "fysiske" tilskueropplevelsen den produserer. Prosjektet består av fire kapitler. I det første kapittelet presenterer jeg filmen i konteksten av en tendens som har markert seg på filmfestivaler verden over de siste to tiårene som går under flere navn, blant andre: slow cinema, hybridfilm og, det begrepet jeg har funnet mest fruktbart...

  3. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  4. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  5. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  6. Posthumanisme /nymaterialisme og nomadisme - affektive brytninger av barnehagens observasjonspraksiser

    Directory of Open Access Journals (Sweden)

    Ann Merete Otterstad

    2015-09-01

    Full Text Available This article challenges observation as a method in early childhood, justified as a mapping tool for creating knowledge about children. Observation as data material is about writing down already known categorisation about children and their development. Categories and categorisation make a foundation for correspondence and coherence   - connections that might create generalising knowledge about children in early years. The article is about a research project conducted in a child-centre over a two-year period. We had an on-going conversation with the personnel around theories about ‘child development’. In the article we experiment with observation based on posthuman/newmaterial theories. Our specific interests are to explore the complexities around observation by asking; why observations, what do we expect through observation, and what might observation as datamaterial be/become? We are inspired by the Norwegian film “Kitchen Stories” (Salmer fra Kjøkkenet, Hamer, 2003 both as affect/provocation and desire (Koro-Ljungberg & MacLure, 2013. We search for affective bending and messiness (Lather, 2007; Law, 2004 to disturb and challenge observation as dominating paradigm in the field of early years, to break some patterns around the positioning of data material. Artikkelen utfordrer observasjon i barnehagen ut fra at metoden brukes som verktøy for å kartlegge og danne grunnlaget for utvikling av kunnskap om barn.  Observasjon som datamateriale innebærer iakttagelser og nedtegnelser av allerede gitte kategoriseringer om barn og barns utvikling.  Kategorier og kategorisering legger grunnlag for mønster som har i seg ideer om korrespondanse og koherens – sammenhenger som kan bidra til generaliserende kunnskap om barna i barnehagen. Omrisset av artikkelen dreies rundt et forskningsarbeid gjort i en barnehage over en toårs-periode, der vi sammen med de ansatte diskuterer teorier om barn og barns ’utvikling’. Vi bruker posthumane

  7. EST Table: AV401818 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401818 heS00196 10/09/28 77 %/219 aa ref|NP_001103813.1| P-element somatic inhibi...tor [Bombyx mori] dbj|BAF91871.1| Bombyx homolog of P-element somatic inhibitor [Bombyx mori] 10/08/28 35 %/...irmed#UniProt: Q9BLA0#protein_id:AAK09071.1 10/09/10 33 %/182 aa AGAP011446-PA Pr...otein|3L:24763465:24770148:-1|gene:AGAP011446 10/09/10 47 %/174 aa gnl|Amel|GB18145-PA 10/09/10 46 %/184 aa gi|18

  8. EST Table: AV400561 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400561 br--1451 10/09/28 62 %/198 aa ref|XP_001843664.1| neuroendocrine protein 7...b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 42 %.../196 aa FBpp0240992|DwilGK11849-PA 10/08/27 54 %/104 aa T03D8.3#CE18921#WBGene00011392#locus:sbt-1#neuroendocrine...45-PA 10/09/10 51 %/199 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  9. EST Table: AV405781 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405781 wdV30227 10/09/28 88 %/272 aa ref|NP_001106136.1| Annexin IX isoform B [Bo...mbyx mori] dbj|BAA92810.1| annexin IX-B [Bombyx mori] 10/08/28 71 %/270 aa FBpp0280989|DpseGA19090-PA 10/08/...9 10/09/10 62 %/270 aa gnl|Amel|GB16448-PA 10/09/10 73 %/271 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 wdV3 ...

  10. EST Table: AV402401 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402401 heS00969 10/09/28 85 %/225 aa dbj|BAB16697.1| annexin [Bombyx mori] dbj|BAB16698.1| anne...a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein_id:CAA 82571.2 10/09/1... %/220 aa gnl|Amel|GB16448-PA 10/09/10 73 %/220 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 heS0 ...

  11. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  12. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  13. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  14. Framväxten av koncernfackligt samarbete inom metallindustrin

    OpenAIRE

    Kjellberg, Anders

    2006-01-01

    The chapter "Framväxten av koncernfackligt samarbete inom metallindustrin" (pp. 177-239) by Anders Kjellberg analyzes the rise and development of trade union cooperation within groups in Swedish metal industry. Special attention is paid to the two large metal enterprises in Finspång, situated in the northern part of the province of Östergötland: (1) the turbine company (for a long period of time called STAL), which were owned by the following groups: Asea, ABB, Alstom and today ...

  15. Gulliver's Travels av Jonathan Swift : fra politisk satire til barnebok

    OpenAIRE

    Krog, Kira Katarina

    2004-01-01

    Denne oppgaven tar for seg Jonathan Swifts bok Gulliver’s Travels’ (1727) utvikling fra politisk satire til barnebok. Med utgangspunkt i opplysningstidens tro på menneskets suverene fornuft og tradisjonen fra antikkens greske satire har oppgaven en historisk problemstilling. Den følger satirens og barnebokens utvikling gjennom tidene og ender i en lesning av en norsk barnebokversjon, utgitt nærmere 300 år etter førsteutgaven. Oppgaven har tre hoveddeler. Den første tar for seg hvordan bok...

  16. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  17. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  18. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  19. Fysiologiske effekter av delvis okklusjon under ettbeins utholdenhetsarbeid

    OpenAIRE

    Henriksen, Bjørnar Sandland

    2009-01-01

    Unilateral perifer aterosklerose i beinet har tidligere vist å gi en fysiologisk adaptasjon til sykdommen ved å endre den oksidative kapasiteten i muskelen (Jansson, 1988; Henriksson et al., 1980). Denne observasjonen er blitt fulgt opp med treningsstudier som har undersøkt effekten av ischemi ved sykkelarbeid hos friske (Sundberg, 1994), samt intervalltrening på tredemølle med okklusjon på begge beina (Abe et al., 2006). Det er imidlertid ikke utført noen treningsstudier med ett – beins knee...

  20. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI; Omgivningskontroll vid kaernkraftverken och Studsvik 1992-1993. Resultat fraan maetning av radionuklidhalter i miljoeprover, samt SSIs stickprovsmaetningar

    Energy Technology Data Exchange (ETDEWEB)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs.

  1. Endogenous RGS proteins modulate SA and AV nodal functions in isolated heart: implications for sick sinus syndrome and AV block.

    Science.gov (United States)

    Fu, Ying; Huang, Xinyan; Piao, Lin; Lopatin, Anatoli N; Neubig, Richard R

    2007-05-01

    G protein-coupled receptors play a pivotal role in regulating cardiac automaticity. Their function is controlled by regulator of G protein signaling (RGS) proteins acting as GTPase-activating proteins for Galpha subunits to suppress Galpha(i) and Galpha(q) signaling. Using knock-in mice in which Galpha(i2)-RGS binding and negative regulation are disrupted by a genomic Galpha(i2)G184S (GS) point mutation, we recently (Fu Y, Huang X, Zhong H, Mortensen RM, D'Alecy LG, Neubig RR. Circ Res 98: 659-666, 2006) showed that endogenous RGS proteins suppress muscarinic receptor-mediated bradycardia. To determine whether this was due to direct regulation of cardiac pacemakers or to alterations in the central nervous system or vascular responses, we examined isolated, perfused hearts. Isoproterenol-stimulated beating rates of heterozygote (+/GS) and homozygote (GS/GS) hearts were significantly more sensitive to inhibition by carbachol than were those of wild type (+/+). Even greater effects were seen in the absence of isoproterenol; the potency of muscarinic-mediated bradycardia was enhanced fivefold in GS/GS and twofold in +/GS hearts compared with +/+. A(1)-adenosine receptor-mediated bradycardia was unaffected. In addition to effects on the sinoatrial node, +/GS and GS/GS hearts show significantly increased carbachol-induced third-degree atrioventricular (AV) block. Atrial pacing studies demonstrated an increased PR interval and AV effective refractory period in GS/GS hearts compared with +/+. Thus loss of the inhibitory action of endogenous RGS proteins on Galpha(i2) potentiates muscarinic inhibition of cardiac automaticity and conduction. The severe carbachol-induced sinus bradycardia in Galpha(i2)G184S mice suggests a possible role for alterations of Galpha(i2) or RGS proteins in sick sinus syndrome and pathological AV block.

  2. InterProScan Result: AV398327 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398327 AV398327_4_ORF1 65C8DA7FC6C4D303 PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.3e-109 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium sym

  3. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523:SF15 SODIUM/POTASSIUM-D...EPENDENT ATPASE BETA SUBUNIT, INSECT NA ? IPR000402 unintegrated Molecular Function: sodium:potassium-exchan...ss: potassium ion transport (GO:0006813)|Biological Process: sodium ion transport (GO:0006814)|Cellular Component: membrane (GO:0016020) ...

  4. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523 SODIUM/POTASSIUM-DEPEND...ENT ATPASE BETA SUBUNIT 1.1e-19 T IPR000402 ATPase, P-type cation exchange, beta subunit Molecular Function: sodiu...006754)|Biological Process: potassium ion transport (GO:0006813)|Biological Process: sodiu

  5. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  6. InterProScan Result: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 AV399953_3_ORF1 920D8122A6A51D76 PFAM PF00175 NAD_binding_1 2.5e-08 T IPR001433 Oxido...reductase FAD/NAD(P)-binding Molecular Function: oxidoreductase activity (GO:0016491)|Biological Process: oxidation reduction (GO:0055114) ...

  7. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_1_ORF2 384AC61A6604E3FD PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) 1.8e-17 T IPR015500 unintegrated ...

  8. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  9. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  10. Pilot Implementation and Preliminary Evaluation of START:AV Assessments in Secure Juvenile Correctional Facilities.

    Science.gov (United States)

    Desmarais, Sarah L; Sellers, Brian G; Viljoen, Jodi L; Cruise, Keith R; Nicholls, Tonia L; Dvoskin, Joel A

    2012-01-01

    The Short-Term Assessment of Risk and Treatability: Adolescent Version (START:AV) is a new structured professional judgment guide for assessing short-term risks in adolescents. The scheme may be distinguished from other youth risk assessment and treatment planning instruments by its inclusion of 23 dynamic factors that are each rated for both vulnerability and strength. In addition, START:AV is also unique in that it focuses on multiple adverse outcomes-namely, violence, self-harm, suicide, unauthorized leave, substance abuse, self-neglect, victimization, and general offending-over the short-term (i.e., weeks to months) rather than long-term (i.e., years). This paper describes a pilot implementation and preliminary evaluation of START:AV in three secure juvenile correctional facilities in the southern United States. Specifically, we examined the descriptive characteristics and psychometric properties of START:AV assessments completed by 21 case managers on 291 adolescent offenders (250 boys and 41 girls) at the time of admission. Results provide preliminary support for the feasibility of completing START:AV assessments as part of routine practice. Findings also highlight differences in the characteristics of START:AV assessments for boys and girls and differential associations between the eight START:AV risk domains. Though results are promising, further research is needed to establish the reliability and validity of START:AV assessments completed in the field.

  11. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  12. Third-degree AV block sensitive to prednisolone 72 hours post AVNRT ablation.

    Science.gov (United States)

    Parwani, Abdul S; Schröder, Anna I; Blaschke, Daniela; Blaschke, Florian; Huemer, Martin; Attanasio, Philipp; Pieske, Burkert; Boldt, Leif-Hendrik; Haverkamp, Wilhelm

    2017-05-01

    A patient developed a transient first-degree AV block during a radiofrequency ablation of an atrioventricular nodal reentrant tachycardia. Three days later the patient presented with a third-degree AV block. It resolved within 24 h under antiphlogistic therapy. Patient was asymptomatic without necessity for pacemaker implantation at 12 months follow-up.

  13. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  14. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  15. InterProScan Result: AV399740 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399740 AV399740_3_ORF2 7A42A41D4F3F6388 PFAM PF00067 p450 1.2e-19 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  16. InterProScan Result: AV404187 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404187 AV404187_4_ORF1 AB84B56694D3FC58 PFAM PF00267 Porin_1 3.5e-13 T IPR001702 Por...in, Gram-negative type Molecular Function: transporter activity (GO:0005215)|Biological Process: transport (GO:0006810)|Cellular Component: membrane (GO:0016020) ...

  17. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 NA ? IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  18. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 1.4e-114 T IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  19. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  20. InterProScan Result: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 AV399741_2_ORF2 F87D90D9B5BA6C11 PFAM PF02778 tRNA_int_endo_N 5.4e-08 T IPR006678 tRNA intro...n endonuclease, N-terminal Molecular Function: tRNA-intron endonuclease activity (GO:0000213) ...

  1. InterProScan Result: AV405061 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405061 AV405061_3_ORF2 400BDC036077591E PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.8e-12 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium symp

  2. InterProScan Result: AV398727 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398727 AV398727_2_ORF2 9953252ABA69E49B PFAM PF00762 Ferrochelatase 8.4e-28 T IPR001015 Ferroche...latase Molecular Function: ferrochelatase activity (GO:0004325)|Biological Process: heme biosynthetic process (GO:0006783) ...

  3. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  4. InterProScan Result: AV403947 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403947 AV403947_3_ORF2 9625723E9868C46D PANTHER PTHR13768:SF2 GAMMA-SOLUBLE NSF A...TTACHMENT PROTEIN (SNAP-GAMMA) 8.7e-75 T IPR011990 unintegrated Molecular Function: binding (GO:0005488) ...

  5. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PROFILE PS50141 A_DEAMIN_EDITASE 15.862 T IPR002466 Adenosine deam...inase/editase Molecular Function: RNA binding (GO:0003723)|Molecular Function: adenosine deam

  6. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE NA ? IPR0...01365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  7. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PANTHER PTHR10910:SF17 ADENOSINE DEAMINAS...ular Function: adenosine deaminase activity (GO:0004000)|Biological Process: RNA processing (GO:0006396) ...

  8. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE 6e-56 T I...PR001365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  9. InterProScan Result: AV401888 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401888 AV401888_3_ORF1 2F04E8AA567F7BCF PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 1.5e-119 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  10. InterProScan Result: AV402282 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402282 AV402282_2_ORF1 D1F0DCC6A8296985 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 5e-97 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  11. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  12. Selvbestemmelse og oppdragelse : en teoretisk analyse av oppdragelsens påvirkning på utviklingen av selvbestemmelse

    OpenAIRE

    2007-01-01

    1) Problemstilling Hensikten med oppgaven er å rette fokus mot oppdragelse som en påvirkningsfaktor på utviklingen av selvbestemmelsen, og hvilken betydning behovstilfredsstillelse har for individets subjektive velvære. Oppdragelse er et populært tema som stadig blir debattert i mediene. Det diskuteres blant annet hvorfor oppdragelse er viktig, hvordan det er mulig å oppdra barn på best mulig måte og hvem som er viktige oppdragere i dagens samfunn. Vår oppgave handler om individets selvbes...

  13. 中国新一代图像编码格式"AVS"%Chinese new Video coding format AVS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ 中国在光盘、无线LAN、家庭内部网络等各种领域不断推出自己的规格.其中,包括中国计划2004年实现标准化的新一代图像编码格式"AVS".中国科学院有关负责人将在NAB2004技术论坛"Leading Edge Tech for TV"上,就定位相当于"MPEG"的AVS规格发表演讲.

  14. Endrer motivasjonen seg i løpet av de fire første ukene av livsstilsendringskurset EasyLife?

    OpenAIRE

    Strand, Hanne Embretsen; Nordengen, Solveig

    2011-01-01

    Vi har undersøkt motivasjonsregulering hos deltagere i et livsstilsendringsprogram. Teoretisk har vi benyttet oss av Helseoppfatningsmodellen (The Health Belief Model; Rosenstock, 1966), Den transteoretiske modellen (The Transtheoretical Model; DiClemente & Prochaska, 1982; Marcus & Simkin, 1994), Selvbestemmelsesteorien (Self-Determination Theory; Deci & Ryan, 2000) og Rosenstocks fire modeller for ansvar. For å kartlegge motivasjonsregulering har vi benyttet oss av BREQ-2 (Markland & Tobin ...

  15. Kosttilskudd og doping : metabolisme av synefrin og oktopamin og utskillelse i urin etter inntak av tilsvarende kosttilskuddsprodukter hhv. et spesielt matinntak

    OpenAIRE

    Stensrud, Linda Sørvang

    2010-01-01

    Etter at efedrin ble forbudt som tilsetningsstoff i kosttilskuddsprodukter på grunn av faren for uheldige bivirkninger, har det de senere årene dukket opp flere produkter med innhold av synefrin. Synefrin er et stimulerende stoff med lignende struktur som efedrin, men den sentralstimulerende effekten er mindre. En vanlig kilde til synefrin, som blir brukt som tilsetningsstoff i kosttilskuddspreparater og næringsmidler, er Citrus aurantium (bitterappelsin). Et annet stimulerende stoff med lign...

  16. Skolebasert forebygging av røyking blant ungdom

    Directory of Open Access Journals (Sweden)

    Ola Jøsendal m.fl

    2009-10-01

    Full Text Available SAMMENDRAGI første del av denne artikkelen gjennomgås en del utvalgte studier av skolebaserte tiltak mot røyking. Utviklingenhar gått gjennom tre faser der den siste generasjonen er de omfattende tiltakene som baserer seg på ensosial påvirkningsmodell. Godt planlagte tiltak som er basert på denne modellen har vist seg å føre til at færrebegynner å røyke. I artikkelens andre del presenteres et prosjekt som gjennomføres av Den NorskeKreftforening og som omfatter 4 441 elever fra 195 klasser ved 99 ungdomsskoler. Valg av undervisningstemaog pedagogiske tilnærminger er begrunnet i aktuelle sosialpsykologiske begreper og modeller ogerfaringer fra tidligere forskning. Intervensjonen bygger et stykke på vei på en sosial påvirkningsmodell.Skolene er delt i fire grupper. Gruppe A er kontrollgruppe. Elevene i gruppe B gjennomgår et undervisningsprogram,foreldrene involveres og lærerne gjennomgår kurser i hvordan de skal gjennomføre intervensjonen.I gruppe C gjør en det samme som i gruppe B, men lærerne kurses ikke. I gruppe D gjør en det samme som igruppe B, men foreldrene involveres ikke. Underveis gjennomføres det blant annet spørreskjemaundersøkelserblant elevene for å studere endringer i røykevaner, hvilke grupper av elever en lykkes best i å nå,hvordan elevene reagerer på tiltakene og hva som kan forklare eventuelle positive virkninger av intervensjonene.Foreløpige analyser av resultatene etter et halvt års oppfølging tyder på at det er færrest sombegynner å røyke i gruppe B, med andre ord at virkningene av tiltakene er best der lærerne kurses ogforeldrene involveres.Jøsendal O, Aarø LE, Bergh IH. School-based prevention of smoking among youths.Nor J Epidemiol ENGLISH SUMMARYThe first part of this article presents selected studies of school-based intervention programmes againstsmoking. Historically it can be distinguished between three phases in the development of such programmes.The last generation are the

  17. Examination of office visit patient preferences for the after-visit summary (AVS).

    Science.gov (United States)

    Neuberger, Marolee; Dontje, Katherine; Holzman, Greg; Corser, Bill; Keskimaki, Abigail; Chant, Ericka

    2014-01-01

    The federal government advocates the practice of routinely providing an after-visit summary (AVS) to patients after each office-based visit as an element of stage 1 meaningful use. A significant potential benefit of the AVS is improved patient engagement achieved by enabling patients and family members to better understand and retain key health information. The methodology for this study was a mixed-methods pilot study to examine, through the perspectives of adult primary care patients, how relevant and actionable data can be better formatted in the AVS. Results of this study suggest that the goal of the AVS to serve as a communication tool to engage and support patients is frequently not being met. Further study is needed to understand, from the viewpoints of patients and providers, what barriers are keeping them from optimally providing and using the information on the AVS.

  18. 77 FR 12163 - Airworthiness Directives; 328 Support Services GmbH (Type Certificate Previously Held by AvCraft...

    Science.gov (United States)

    2012-02-29

    ... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier...: 2012-04-06 328 Support Services GmbH (Type Certificate Previously Held by AvCraft Aerospace...

  19. Vurdering av andrespråksinnlærere - en utfordring i skolen

    Directory of Open Access Journals (Sweden)

    Kirsten Palm

    2014-06-01

    Full Text Available Vurdering av andrespråkselevers språkkompetanse og språkutvikling er en sentral del av læreres arbeid, og forskning har vist at dette er en utfordring for skolene. Det er stor variasjon i vurderingsformer, og skolene mangler ofte vurderingskompetanse. På bakgrunn av dette utarbeidet Utdanningsdirektoratet i 2007 vurderingsverktøyet Kartleggingsmateriell. Språkkompetanse i grunnleggende norsk for språklige minoriteter. Materiellet er utarbeidet blant annet med referanse til Common European Framework of Reference for Languages (CEFR. I artikkelen redegjør vi for en undersøkelse der målet var å finne ut hvorvidt dette kartleggingsmateriellet er hensiktsmessig for å vurdere andrespråkselevers språkkompetanse. Hoveddataene er innhentet gjennom kasusstudier ved tre grunnskoler, der vi intervjuet skoleledelse og lærere samt observerte kartleggingssituasjoner og klasseromsundervisning. Kasusstudiene ble senere fulgt opp av to spørreundersøkelser, én til de samme skolene, og én til et større antall skoler for å få bredere innsikt i kartleggingspraksis og skolers oppfatninger av denne formen for vurdering. Undersøkelsen viser at flere av informantene mener verktøyet kan bidra til mer tilpasset og systematisk andrespråkopplæring og bedre vurdering av andrespråkselevenes språkkompetanse. Samtidig er det utfordringer knyttet til å bruke vurderingsverktøyet, dette skyldes blant annet mangelfull kompetanse i skolen når det gjelder andrespråkstilegnelse og vurdering av elevenes språkkompetanse. Det er ikke tidligere forsket på bruk av et slikt konkret kartleggingsverktøy i norsk grunnskole. Undersøkelsen kan gi et bidrag til økt kunnskap om vurdering av andrespråkskompetanse og tilpasset undervisning for andrespråksinnlærere.

  20. [(18) F]AV-1451 tau positron emission tomography in progressive supranuclear palsy.

    Science.gov (United States)

    Whitwell, Jennifer L; Lowe, Val J; Tosakulwong, Nirubol; Weigand, Stephen D; Senjem, Matthew L; Schwarz, Christopher G; Spychalla, Anthony J; Petersen, Ronald C; Jack, Clifford R; Josephs, Keith A

    2017-01-01

    The [(18) F]AV-1451 positron emission tomography ligand allows the in vivo assessment of tau proteins in the brain. It shows strong binding in Alzheimer's dementia, but little is known about how it performs in progressive supranuclear palsy, a primary 4R tauopathy. The objectives of this study were to determine whether [(18) F]AV-1451 uptake can be observed in progressive supranuclear palsy and to characterize the regional distribution when compared with controls and Alzheimer's dementia. [(18) F]AV-1451 positron emission tomography was performed in 10 patients with probable progressive supranuclear palsy. These patients were age- and gender-matched to 50 controls and 10 Alzheimer's dementia patients who had undergone identical [(18) F]AV-1451 imaging. Regional comparisons of [(18) F]AV-1451 uptake were performed across the whole brain using region-of-interest and voxel-level analyses, and correlations between regional [(18) F]AV-1451 and the progressive supranuclear palsy rating scale were assessed. An elevated [(18) F]AV-1451 signal was observed in progressive supranuclear palsy when compared with controls in the pallidum, midbrain, dentate nucleus of the cerebellum, thalamus, caudate nucleus, and frontal regions. Signal in the cerebellar dentate and pallidum were also greater in progressive supranuclear palsy when compared with Alzheimer's dementia. Conversely, the [(18) F]AV-1451 signal across the cortex was higher in Alzheimer's dementia when compared with progressive supranuclear palsy. The [(18) F]AV-1451 signal in a number of regions correlated with the progressive supranuclear palsy rating scale. Progressive supranuclear palsy is associated with an elevated [(18) F]AV-1451 signal in a characteristic and distinct regional pattern that correlates with disease severity and differs from the patterns observed in Alzheimer's dementia. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  1. In vivo retention of (18)F-AV-1451 in corticobasal syndrome.

    Science.gov (United States)

    Smith, Ruben; Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer; Hansson, Oskar

    2017-08-22

    To study the usefulness of (18)F-AV-1451 PET in patients with corticobasal syndrome (CBS). We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, (18)F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent (18)F-FDG-PET. In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of (18)F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using (18)F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of (18)F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where (18)F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased (18)F-fluorodeoxyglucose uptake were more widespread than (18)F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. This study provides Class III evidence that (18)F-AV-1451 PET distinguishes between CBS and AD or PSP. Copyright © 2017 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of the American Academy of Neurology.

  2. In vivo retention of 18F-AV-1451 in corticobasal syndrome

    Science.gov (United States)

    Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer

    2017-01-01

    Objective: To study the usefulness of 18F-AV-1451 PET in patients with corticobasal syndrome (CBS). Methods: We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, 18F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent 18F-FDG-PET. Results: In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of 18F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using 18F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of 18F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where 18F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Conclusions: Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased 18F-fluorodeoxyglucose uptake were more widespread than 18F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. Classification of evidence: This study provides Class III evidence that 18F-AV-1451 PET distinguishes between CBS and AD or PSP. PMID:28754841

  3. Value of the adenosine test for diagnosis of dual AV nodal physiology in patients with AV nodal reentrant tachycardia

    Institute of Scientific and Technical Information of China (English)

    周斌全; 胡申江; 鲁端; 王建安

    2002-01-01

    Objectives: This study was aimed at assessing the value of the adenosine test for noninvasive diagnosis of dual AV nodal physiology(DAVNP) in patients with AV nodal reentrant tachycardia (AVNRT). Methods: 53 patients with paroxysmal supraventricular tachycardia (PSVT) were given incremental doses of adenosine intravenously during sinus rhythm before electrophysiological study. The adenosine test was repeated on a subset of 18 patients with AVNRT after radiofrequency catheter ablation. Results: Sudden increments of PR interval of more than 60 msec between two consecutive beats were observed in 26(83.9%) of 31 patients with typical AVNRT and 2 (9.1%) of 22 patients with AVRT and AT (P<0.01). The maximal PR increment between 2 consecutive beats in the AVNRT group(105±45ms) was significantly greater than that in the AVRT and AT group (20±13ms) (P<0.01).In postablation adenosine test, DAVNP was eliminated in all 8 patients who underwent slow pathway abolition that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS showed the slow pathway persisted. Six of 10 patients who exhibited persistent duality showed a marked reduction in the number of beats conducted in the slow pathway after adenosine injection(P<0.01).Conclusions: Administration of adenosine during sinus rhythm may be a useful bedside test for diagnosis of DAVNP in high percentage of patients with typical AVNRT and additionally for evaluating the effects of radiofrequency ablation.

  4. Realization of AVS +DVB -S2 Professional Integrated Receiver Decoder%AVS +DVB -S2专业解码器的实现方法

    Institute of Scientific and Technical Information of China (English)

    周钦光; 杨雪松

    2015-01-01

    AVS +是我国自主创新的视频编码技术,可解决广播电视行业面临的频道资源问题。介绍了一种具备 DVB -S2专业多流接收和多节目再复用解密功能的 AVS +专业高清解码器的实现方法,该设备不仅能完成传统专业数字卫星解码器的所有功能,而且能进行 DVB -S2专业接收、再复用、多节目的CI 接口任意组合解密和 AVS +高清解码,为广电运营商提供了一种成本低、功能强大的 DVB -S2专业AVS +解码设备,将为早日实现 AVS +端到端应用的全覆盖做出一定的贡献。%AVS +is a Chinese independent innovative technology for video encoding.Its objective is to solve frequency resource problem in broadcasting television industry.This article shows the realization of AVS +high definition Integrated Receiver decoder,which can not only all functions of traditional and professional digital satellite decoder,but also the functions of DVB -S2 professional receiving,re-multiplexing for CI combination decrypting of multiple programs,and AVS +high definition decoding.In other words,this decoder provides op-erators with a low-cost but powerful functioning DVB -S2 professional receiving and AVS +high definition de-coding solution,making a certain contribution to the overall coverage of AVS +end -to -end application.

  5. BMP2 expression in the endocardial lineage is required for AV endocardial cushion maturation and remodeling.

    Science.gov (United States)

    Saxon, Jacob G; Baer, Daniel R; Barton, Julie A; Hawkins, Travis; Wu, Bingruo; Trusk, Thomas C; Harris, Stephen E; Zhou, Bin; Mishina, Yuji; Sugi, Yukiko

    2017-10-01

    Distal outgrowth, maturation and remodeling of the endocardial cushion mesenchyme in the atrioventricular (AV) canal are the essential morphogenetic events during four-chambered heart formation. Mesenchymalized AV endocardial cushions give rise to the AV valves and the membranous ventricular septum (VS). Failure of these processes results in several human congenital heart defects. Despite this clinical relevance, the mechanisms governing how mesenchymalized AV endocardial cushions mature and remodel into the membranous VS and AV valves have only begun to be elucidated. The role of BMP signaling in the myocardial and secondary heart forming lineage has been well studied; however, little is known about the role of BMP2 expression in the endocardial lineage. To fill this knowledge gap, we generated Bmp2 endocardial lineage-specific conditional knockouts (referred to as Bmp2 cKO(Endo)) by crossing conditionally-targeted Bmp2(flox/flox) mice with a Cre-driver line, Nfatc1(Cre), wherein Cre-mediated recombination was restricted to the endocardial cells and their mesenchymal progeny. Bmp2 cKO(Endo) mouse embryos did not exhibit failure or delay in the initial AV endocardial cushion formation at embryonic day (ED) 9.5-11.5; however, significant reductions in AV cushion size were detected in Bmp2 cKO(Endo) mouse embryos when compared to control embryos at ED13.5 and ED16.5. Moreover, deletion of Bmp2 from the endocardial lineage consistently resulted in membranous ventricular septal defects (VSDs), and mitral valve deficiencies, as evidenced by the absence of stratification of mitral valves at birth. Muscular VSDs were not found in Bmp2 cKO(Endo) mouse hearts. To understand the underlying morphogenetic mechanisms leading to a decrease in cushion size, cell proliferation and cell death were examined for AV endocardial cushions. Phospho-histone H3 analyses for cell proliferation and TUNEL assays for apoptotic cell death did not reveal significant differences between control

  6. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing.

  7. Ansatte perspektiver på utvikling av tverrfaglighet i ny sykehusavdeling

    Directory of Open Access Journals (Sweden)

    Hildfrid V. Brataas

    2009-02-01

    Full Text Available Artikkelen omhandler en følgestudie om ansattes perspektiver på teamorganisert og brukerinvolvert tverrfaglig samarbeid i en ny rehabiliteringsavdeling i et norsk sykehus. Studiens formål var å bringe frem mer kunnskap om forhold av betydning ved utvikling av tverrfaglige arbeidsformer i sammensatte helsetjenester.Metode: Undersøkelsen var kvalitativt beskrivende og fortolkende med bruk av fokusgruppeintervjuer tre og fem år etter oppstart av rehabiliteringsavdelingen.Resultater: Over en femårsperiode var praksis erfart å endre karakter, fra flerfaglig samarbeid til funksjonelt tverrfaglig samarbeid. Profesjonsoverbyggende teori om rehabiliterings-virksomheten og ledelsens kvalitetsorientering var erfart som hjelp for teamenes utvikling av funksjonell tverrfaglighet.Konklusjon: Langsiktighet, kvalitetsorientert ledelse og teamorganisert rehabiliteringsarbeid basert på profesjonsoverbyggende teoriramme synes å underbygge utvikling av funksjonell tverrfaglighetsforståelse og praksis. Denne kunnskapen er relevant ved omlegging til teamorganisert rehabiliteringsvirksomhet i eksisterende og nye virksomheter. Det er behov for mer forskning om betydning av personfaktorer og motivasjon, ledelse og overbyggende teorirammeverk for samarbeidsutvikling og kvalitet i praksis.

  8. Nodal recovery, dual pathway physiology, and concealed conduction determine complex AV dynamics in human atrial tachyarrhythmias.

    Science.gov (United States)

    Masè, Michela; Glass, Leon; Disertori, Marcello; Ravelli, Flavia

    2012-11-15

    The genesis of complex ventricular rhythms during atrial tachyarrhythmias in humans is not fully understood. To clarify the dynamics of atrioventricular (AV) conduction in response to a regular high-rate atrial activation, 29 episodes of spontaneous or pacing-induced atrial flutter (AFL), covering a wide range of atrial rates (cycle lengths from 145 to 270 ms), were analyzed in 10 patients. AV patterns were identified by applying firing sequence and surrogate data analysis to atrial and ventricular activation series, whereas modular simulation with a difference-equation AV node model was used to correlate the patterns with specific nodal properties. AV node response at high atrial rate was characterized by 1) AV patterns of decreasing conduction ratios at the shortening of atrial cycle length (from 236.3 ± 32.4 to 172.6 ± 17.8 ms) according to a Farey sequence ordering (conduction ratio from 0.34 ± 0.12 to 0.23 ± 0.06; P AV block patterns occurring during regular atrial tachyarrhythmias. The characterization of AV nodal function during different AFL forms constitutes an intermediate step toward the understanding of complex ventricular rhythms during atrial fibrillation.

  9. Baseline HV-interval predicts complete AV-block secondary to transcatheter aortic valve implantation.

    Science.gov (United States)

    Shin, Dong-In; Merx, Marc W; Meyer, Christian; Kirmanoglou, Kiriakos; Hellhammer, Katharina; Ohlig, Jan; Katsani, Dimitra; Zeus, Tobias; Westenfeld, Ralf; Eickholt, Christian; Linke, Axel; Kelm, Malte

    2015-10-01

    Development of AV-block is a frequent complication associated with transcatheter aortic valve implantation (TAVI). To date little is known about the predictive value of the HV-interval prior to TAVI with respect to the risk of AV-block development. HV-interval was determined in 25 consecutive elderly patients with severe aortic valve stenosis (AS) before and immediately after TAVI. All patients subsequently underwent TAVI and 8 of these 25 patients (32%) developed complete AV-block during the TAVI procedure requiring permanent pacemaker implantation. Six of these 8 patients (75%) had marked HV prolongation (>54 ms). Pre-procedural HV-interval was significantly prolonged in the subgroup developing complete AV-block (62.1 ms±13.0 vs 49.2 ms±12.9; P=0.029). Prolongation of the HV-interval above 54 ms was associated with a higher rate of complete AV-block (sensitivity 75.0%, specificity 77.8%, P=0.01). HV-interval was prolonged in approximately one third of our elderly patients with aortic valve stenosis and associated with a high rate of complete AV-block following TAVI. HV-interval is easily obtained during TAVI screening procedures, thus facilitating identification of patients at risk for complete AV-block due to TAVI and consequently enabling bespoke risk management.

  10. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  11. Performance Comparison of AVS and H.264/AVC Video Coding Standards

    Institute of Scientific and Technical Information of China (English)

    Xin-Fu Wang; De-Bin Zhao

    2006-01-01

    A new audio and video compression standard of China, known as advanced Audio Video coding Standard (AVS),is emerging. This standard provides a technical solution for many applications within the information industry such as digital broadcast, high-density laser-digital storage media, and so on. The basic part of AVS, AVS1-P2, targets standard definition (SD) and high definition (HD) format video compression, and aims to achieve similar coding efficiency as H.264/AVC but with lower computational complexity. In this paper, we first briefly describe the major coding tools in AVS1-P2, and then perform the coding efficiency comparison between AVS1-P2 Jizhun profile and H.264/AVC main profile. The experimental results show that the AVS1-P2 Jizhun profile has an average of 2.96% efficiency loss relative to H.264/AVC main profile in terms of bit-rate saving on HD progressive-scan sequences, and an average of 28.52% coding loss on interlace-scan sequences.Nevertheless, AVS1-P2 possesses a valuable feature of lower computational complexity.

  12. Developing a computational model of human hand kinetics using AVS

    Energy Technology Data Exchange (ETDEWEB)

    Abramowitz, Mark S. [State Univ. of New York, Binghamton, NY (United States)

    1996-05-01

    As part of an ongoing effort to develop a finite element model of the human hand at the Institute for Scientific Computing Research (ISCR), this project extended existing computational tools for analyzing and visualizing hand kinetics. These tools employ a commercial, scientific visualization package called AVS. FORTRAN and C code, originally written by David Giurintano of the Gillis W. Long Hansen`s Disease Center, was ported to a different computing platform, debugged, and documented. Usability features were added and the code was made more modular and readable. When the code is used to visualize bone movement and tendon paths for the thumb, graphical output is consistent with expected results. However, numerical values for forces and moments at the thumb joints do not yet appear to be accurate enough to be included in ISCR`s finite element model. Future work includes debugging the parts of the code that calculate forces and moments and verifying the correctness of these values.

  13. EST Table: AV398400 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398400 NV021766 10/09/28 97 %/109 aa ref|NP_001091759.1| annexin isoform 2 [Bomby.../27 47 %/107 aa T07C4.9a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein...1|gene:ANXB10B 10/09/10 low homology 10/09/10 48 %/104 aa gi|91090858|ref|XP_967143.1| PREDICTED: similar to annexin B13a isoform 1 [Tribolium castaneum] NM_001098288 NV02 ... ...x mori] gb|ABD36280.1| annexin isoform 2 [Bombyx mori] 10/08/28 67 %/103 aa FBpp0123640|DanaGF20448-PA 10/08

  14. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  15. EST Table: AV404143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404143 pg--0524 11/12/09 n.h 10/09/28 100 %/131 aa pdb|3FZB|A Chain A, Crystal Structure... Of The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|B Chain B, Crystal Structure Of T...he Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|C Chain C, Crystal Structure Of The Tail Term...inator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|D Chain D, Crystal Structure O...f The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|E Chain E, Crystal Structure Of The Tail T

  16. En språkfundert kompetansemodell for planlegging av undervisning

    Directory of Open Access Journals (Sweden)

    Erik Knain

    2016-04-01

    Full Text Available I utdanningsvitenskapelig litteratur er ulike former for ”literacy” et vedvarende fokus både teoretisk og empirisk. I engelskspråklig naturfagdidaktisk litteratur brukes betegnelsen ”scientific literacy”. Jeg skisserer i denne artikkelen et planleggingsverktøy for undervisning som bygger på en eksplisitt teoretisk modell for deltakelse gjennom språk. Modellen er bindeledd mellom et generalisert kompetansebegrep og planlegging av undervisning ved at den knytter sammen de didaktiske spørsmålene hva, hvem, hvordan og hvorfor med en modell for funksjonell deltakelse. Modellen er spesielt relevant for et allmenndannende ”naturfag for alle”, men favner også et naturfag som fokuserer på utdanning av framtidas naturvitere. Artikkelen retter seg mot naturfag i skolen, men modellen bør kunne anvendes også i andre skolefag. Modellen peker mot et situert og transformativt kompetansebegrep.Nøkkelord: naturfag , kompetanse , diskurs , deltakelse, undervisning og læringAbstractVarious forms of literacy have long been the focus of educational discourses, not the least in science education where the term “scientific literacy” has been an enduring concern for decades. In this article I describe a tool for designing teaching based on a theoretical perspective on participation through language. The model connects a general conception of competence with the planning of teaching. To do so it drowe on the didactical questions of “what, who, how and why”. The model is particularly relevant in a “science for all” perspective but also for the educating of future science specialists. Although school science is the primary focus in this article, the model should be applicable to other school subjects as well. The model opens for a situated and transformative notion of competence.Keywords: scientific literacy, discourse, participation, teaching and learning

  17. Stöttning av skrivande i ett digitalt diskussionsforum

    Directory of Open Access Journals (Sweden)

    Stina Hållsten

    2017-07-01

    Full Text Available Vi vet att studenter ofta upplever akademiskt skrivande som svårt. Att skrivandet dessutom förläggs till en digital lärplattform underlättar kanske inte alltid. Större studentgrupper och minskade resurser, parallellt med ett större utbud av distanskurser, gör att digitala lärplattformar blir än viktigare inom högre utbildning. Forskning visar dock att vi i första hand använder lärplattformar i administrativt syfte, trots möjligheter till en mer pedagogisk användning, exempelvis genom mer interaktion och ett större fokus på skrivandet. Hur kan lärplattformens design och användning utvecklas pedagogiskt, närmare bestämt med ett genrepedagogiskt upplägg?Empirin för artikeln är en distanskurs i kriminologi, där all kursaktivitet skedde över utbildningens lärplattform. Kursdesignen och lärarnas aktivitet (instruktioner, responsgivande och annan stöttning analyserades tillsammans med ett mindre antal studenters användande av lärplattformen i arbetet med uppgiften Lärandedialogen. Vilka genrepedagogiska drag uppvisas redan i kursdesignen, och vilka skulle kunna förstärkas? Genrepedagogiken tar fasta på den muntliga dialogen kring text och innehåll. Därför diskuteras även hur man kan se den skriftliga, asynkrona diskussionen som något liknande det muntliga seminariesamtalet.

  18. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  19. Subcortical (18) F-AV-1451 binding patterns in progressive supranuclear palsy.

    Science.gov (United States)

    Cho, Hanna; Choi, Jae Yong; Hwang, Mi Song; Lee, Seung Ha; Ryu, Young Hoon; Lee, Myung Sik; Lyoo, Chul Hyoung

    2017-01-01

    Accumulation of cortical and subcortical tau pathology is the primary pathological substrate for progressive supranuclear palsy (PSP). (18) F-AV-1451, a radiotracer that binds to the pathological tau protein, may be helpful for in vivo visualization and quantitation of tau pathology in PSP. The objectives of this study were to investigate cortical and subcortical (18) F-AV-1451 binding patterns in patients with PSP. We recruited 14 PSP patients and compared their cortical and subcortical binding patterns in (18) F-AV-1451 positron emission tomography (PET) studies with those of 15 Parkinson's disease (PD) patients and 15 healthy controls. In both the PD and PSP groups, subcortical (18) F-AV-1451 binding did not correlate with the severity of motor dysfunctions, and cortical binding did not differ between the controls and each patient group. However, the PSP patients showed greater (18) F-AV-1451 binding in the putamen, globus pallidus, subthalamic nucleus, and dentate nucleus when compared with the controls, whereas the PD patients showed lower (18) F-AV-1451 binding in the substantia nigra than controls. The PSP and PD patients showed distinct subcortical (18) F-AV-1451 binding patterns reflecting subcortical tau pathology in PSP and reduced nigral neuromelanin in PD. However, there was no correlation with the severity of motor dysfunction, no cortical regions with increased binding in PSP patients, and variable degrees of subcortical binding even in the controls. Therefore, the (18) F-AV-1451 PET may be less than ideal for assessing tau pathology in PSP. Further studies will be required to validate the clinical correlation and to understand the clinical utility of (18) F-AV-1451 PET for PSP patients. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  20. Pathological correlations of [F-18]-AV-1451 imaging in non-alzheimer tauopathies.

    Science.gov (United States)

    Marquié, Marta; Normandin, Marc D; Meltzer, Avery C; Siao Tick Chong, Michael; Andrea, Nicolas V; Antón-Fernández, Alejandro; Klunk, William E; Mathis, Chester A; Ikonomovic, Milos D; Debnath, Manik; Bien, Elizabeth A; Vanderburg, Charles R; Costantino, Isabel; Makaretz, Sara; DeVos, Sarah L; Oakley, Derek H; Gomperts, Stephen N; Growdon, John H; Domoto-Reilly, Kimiko; Lucente, Diane; Dickerson, Bradford C; Frosch, Matthew P; Hyman, Bradley T; Johnson, Keith A; Gómez-Isla, Teresa

    2017-01-01

    Recent studies have shown that positron emission tomography (PET) tracer AV-1451 exhibits high binding affinity for paired helical filament (PHF)-tau pathology in Alzheimer's brains. However, the ability of this ligand to bind to tau lesions in other tauopathies remains controversial. Our goal was to examine the correlation of in vivo and postmortem AV-1451 binding patterns in three autopsy-confirmed non-Alzheimer tauopathy cases. We quantified in vivo retention of [F-18]-AV-1451 and performed autoradiography, [H-3]-AV-1451 binding assays, and quantitative tau measurements in postmortem brain samples from two progressive supranuclear palsy (PSP) cases and a MAPT P301L mutation carrier. They all underwent [F-18]-AV-1451 PET imaging before death. The three subjects exhibited [F-18]-AV-1451 in vivo retention predominantly in basal ganglia and midbrain. Neuropathological examination confirmed the PSP diagnosis in the first two subjects; the MAPT P301L mutation carrier had an atypical tauopathy characterized by grain-like tau-containing neurites in gray and white matter with heaviest burden in basal ganglia. In all three cases, autoradiography failed to show detectable [F-18]-AV-1451 binding in multiple brain regions examined, with the exception of entorhinal cortex (reflecting incidental age-related neurofibrillary tangles) and neuromelanin-containing neurons in the substantia nigra (off-target binding). The lack of a consistent significant correlation between in vivo [F-18]-AV-1541 retention and postmortem in vitro binding and tau measures in these cases suggests that this ligand has low affinity for tau lesions primarily made of straight tau filaments. AV-1451 may have limited utility for in vivo selective and reliable detection of tau aggregates in these non-Alzheimer tauopathies. ANN NEUROL 2017;81:117-128. © 2016 American Neurological Association.

  1. Disposal of residue from sifting of combustible waste; Avsaettning av siktrest fraan foerbehandling av braennbart avfall

    Energy Technology Data Exchange (ETDEWEB)

    Niklasson, Fredrik

    2012-11-01

    In waste to energy plants, unwanted species in the fuel may cause corrosion, deposits, agglomeration in the fuel bed, and emissions of pollutants. Countermeasures to such problems are often costly. For at least some of the waste, the fuel properties can be improved by introducing a pretreatment system in which the fine fraction is separated from the waste by sifting. This method has been studied in an earlier Waste Refinery project, WR-06. That study pointed at advantages in performance of the boiler plant and a rough economical analysis indicated substantial benefits. The drawback of the pretreatment was that the residue (the fine fraction) showed as high content of total organic carbon (TOC) as 37 %, by weight. Such a waste fraction is not allowed to be landfilled in Sweden. High TOC content is also a limiting factor for usage as a secondary construction material. To become an applicable pretreatment method, it is necessary to find an appropriate disposal method for the residue material. Present work investigates different possibilities to handle the sifting residue, assuming it has the same properties as in previous study. The residue from sifting needs further treatment, preferably with energy recovery. There are some alternatives, such as combustion, gasification, anaerobic or aerobic digestion. To reduce problems associated by combustion, the waste may be burnt in another more suitable furnace. An alternative is gasification, but that treatment method is not yet an established process for waste fuels. Another option is treatment by anaerobic or aerobic digestion. The high concentrations of metals, however, limit the use of the biologically treated waste to landfilling sites, where it may be utilized as a construction material. The high metal concentrations in the sifting residue imply that it must be kept separate from other biodegradable wastes which are used to produce fertilizers. Thus, this treatment alternative will likely require substantial new

  2. AV interval optimization using pressure volume loops in dual chamber pacemaker patients with maintained systolic left ventricular function.

    Science.gov (United States)

    Eberhardt, Frank; Hanke, Thorsten; Fitschen, Joern; Heringlake, Matthias; Bode, Frank; Schunkert, Heribert; Wiegand, Uwe K H

    2012-08-01

    Atrioventricular (AV) interval optimization is often deemed too time-consuming in dual-chamber pacemaker patients with maintained LV function. Thus the majority of patients are left at their default AV interval. To quantify the magnitude of hemodynamic improvement following AV interval optimization in chronically paced dual chamber pacemaker patients. A pressure volume catheter was placed in the left ventricle of 19 patients with chronic dual chamber pacing and an ejection fraction >45 % undergoing elective coronary angiography. AV interval was varied in 10 ms steps from 80 to 300 ms, and pressure volume loops were recorded during breath hold. The average optimal AV interval was 152 ± 39 ms compared to 155 ± 8 ms for the average default AV interval (range 100-240 ms). The average improvement in stroke work following AV interval optimization was 935 ± 760 mmHg/ml (range 0-2,908; p AV interval changes the average stroke work by 207 ± 162 mmHg/ml. AV interval optimization also leads to improved systolic dyssynchrony indices (17.7 ± 7.0 vs. 19.4 ± 7.1 %; p = 0.01). The overall hemodynamic effect of AV interval optimization in patients with maintained LV function is in the same range as for patients undergoing cardiac resynchronization therapy for several parameters. The positive effect of AV interval optimization also applies to patients who have been chronically paced for years.

  3. Inventory of future power and heat production technologies. Partial report Gasification with gas turbine/engine for power plants; Incl. English lang. appendix of 24 p. titled 'Status of large-scale biomass gasification for power production'; Inventering av framtidens el och vaermeproduktionstekniker. Delrapport Foergasning med gasturbin/motor foer kraftvaerk

    Energy Technology Data Exchange (ETDEWEB)

    Waldheim, Lars; Larsson, Eva K. (TPS Termiska Processer, Nykoeping (Sweden))

    2008-12-15

    This subproject is limited to applications with gas turbines or engines from approximately 1 MWe and firing of gas in a boiler either as indirect cofiring or as separate firing of gas from waste gasification. Gasification with gas engine, BIG-ICE (Biomass Integrated Gasification Internal-Combustion Engine) is realized in approximately 10 plants in Europe between 1 and 7 MWe. The gas needs to be cleaned from particles and tar before it is fed to the engine. A number of different gasifiers and gas cleaning technologies are applied in these prototypes, and in certain cases a second generation is being built. Gas engines from GE Jenbacher are most common, but there are also other producers with engines for low-calorific-value gas. The exhausts from engines must, unlike gas turbines, be cleaned catalytically, but emissions of hydrocarbons in particular are still higher than from gas turbines. It is possible to increase the electricity generation by applying a 'bottoming cycle' in the form of a steam or an ORC cycle. Such a plant with ORC has been started in Austria this year. During the 1990's expectations were high concerning the development of biomass gasification with gas turbine in a combined cycle BIG-CC (Biomass Integrated Gasification Combined Cycle) towards commercialisation. Two demonstration plants were built for the same gas turbine model, Siemens SGT 100 (earlier Typhoon); Vaernamo with pressurised gasification and ARBRE in Eggborough, England, with atmospheric gasification. The atmospheric technology has basically the same demands on gas cleaning as in the engine application, but downstream the gas is compressed to the pressure required by the gas turbine. In pressurised gasification, the gasifier pressure is set by the gas turbine. The gas is not cooled below 350-400 deg C and is cleaned in a high-temperature filter. Despite successful demonstration in Vaernamo, no more plants have been built. The ARBRE plant was never put into regular

  4. Den blivande förskollärarens formering. En studie av verksamhetsförlagda handledningssamtal, argumentationstraditioner och metaforik

    Directory of Open Access Journals (Sweden)

    Marie-Louise Hjort

    2014-06-01

    Full Text Available I denna studie analyserar vi hur erfarna förskollärare i rollen som handledare introducerar förskollärarstudenter i professionen. Studien genomförs mot bakgrund av ett delvis nytt uppdrag som förskolan fått under senare år, som bland annat yttrar sig i att förskolan nu är en del av utbildningssystemet. Med utgångspunkt i det teoretiska begreppet argumentationstraditioner och genom att analysera metaforiken i deltagarnas resonerande, studeras hur erfarna och blivande förskollärare navigerar spänningar centrala för professionen. Deltagarnas betoning av vissa argumentationstraditioner och användningen av viss metaforik diskuteras i termer av vad de implicerar för utvecklingen av de barn som deltar i en förskoleverksamhet som formas av dessa.

  5. LNG tidscertepartier : En innføring generelt og regulering av boil-off spesielt

    OpenAIRE

    Bull, Johan Storm

    2005-01-01

    Oppgaven gir en innføring i langsiktige LNG tidscertepartier. Den tar for seg både hva som er særegent for denne kontraktstypen generelt, og gir en oversikt over typiske sider ved den konkrete reguleringen av et utvalg certepartier. Som et spesialemne, tar oppgaven for seg reguleringen av ansvaret for boil-off mellom partene. Dette er et fenomen som er spesielt for LNG farten. LNG certepartier tar for seg transport av LNG med skip. LNG står for Liquefied Natural Gas, eller flytende naturg...

  6. Måleegenskaper ved den norske versjonen av Teacher's Report Form (TRF)

    OpenAIRE

    Kornør, Hege; Drugli, May Britt

    2011-01-01

    Beskrivelse. TRF inngår som én av tre tester i Achenbach System of Empirically Based Assessment (ASEBA). Thomas Achenbach og Leslie Rescorla står bak denne testen, som kom ut i sin originalversjon på engelsk 2001. Torunn S. Nøvik og Sonja Heyerdahl publiserte den norske oversettelsen av TRF i 2002. TRF skal besvares av lærere for å kartlegge faglig fungering, tilpasning og problemområder hos barn og ungdom i skolealder. Problemdelen har én totalskåre som danner utgangspunkt for...

  7. "The Power of Christ Compels You". En studie av eksorsisme i tre filmer.

    OpenAIRE

    Morland, Espen Steensnæs

    2014-01-01

    Denne oppgaven er en studie av fenomenet eksorsisme i de tre filmene The Exorcist (1973), The Exorcist III (1990) og The Exorcism of Emily Rose (2005). Målet har vært å finne ut hvilke roller eksorsisme, kjønnsroller, det overnaturlige og Den katolske kirke spiller i disse tre filmene. I tillegg inneholder oppgaven en sammenligning av de tre filmene. De tre filmene er både like og forskjellige når det gjelder deres tilnærming til eksorsisme. En viktig del av det katolske eksorsismeritualet...

  8. [The functional dissociation of conduction within the human AV-node (author's transl)].

    Science.gov (United States)

    Runge, M; Narula, O S; Ehlers, E; Luckmann, E; Pantlen, H

    1980-07-15

    The functional dissociation (FD) of conduction within the AV-node is characterized by sudden prolongations and/or shortenings of the AH-time during stimulation. Examples for FD are presented during regular atrial stimulation and atrial extrastimulus technique. The appearance of FD is no proof for functional impairment of the AV-node. The blockade of the parasympathetic nervous system abolishes FD and leads to the well known continuous and regular adaptation of the AH-time with the various kinds of stimulation examined. It is recommended to replace the term "pathways" by the more comprehensive concept of functional dissociation with the AV-node.

  9. Om inflammatorisk tarmsykdom, samt protokollutvikling for isolasjon av enkeltceller fra colonslimhinnebiopsier

    OpenAIRE

    Dahl, Jim André; Krokstrand, Tobias Tysnes

    2011-01-01

    Inflammatorisk tarmsykdom (IBD) omfatter primært de to tilstandene, ulcerøs kolitt (UC) og morbus Crohn (MbC). Begge tilstandene karakteriseres ved kronisk inflammasjon i fordøyelseskanalen. Etiologien er ukjent, men en teori som har blitt fremmet er dysregulasjon av immunresponsen mot den kommensale tarmflora hos genetisk predisponerte individer. Insidensen av IBD er høyere i den vestlige verden enn i utviklingsland, og Norge er et av landene med høyest registrert insidens. Tilstanden kan...

  10. Langtidseffekten av kalking på lystgassemisjonen frå dyrka organisk jord

    OpenAIRE

    Hovlandsdal, Linn

    2011-01-01

    Kultivert jord er den viktigaste antropogene kjelda til dinitrogenoksid (N2O), også kalla lystgass. N2O er ein klimagass og bidreg til øydelegging av stratosfærisk ozon. Dyrka myrjord har ein større emisjon av N2O enn mineraljord. Sjølv om dyrka myrjord berre utgjer 7 – 8 % av det totale dyrka arealet i Noreg, kan dei potensielt vere ein stor bidragsytar til N2O - emisjonen frå norsk jordbruk. pH i jord er ein nøkkelvariabel for dei fleste biologiske prosessane i jorda. Kalking kan føre ti...

  11. Religion, visdom och humanism : en teologisk läsning av Hermann Hesses Siddhartha

    OpenAIRE

    Sandström, Henning E.

    2007-01-01

    Hermann Hesse (1877-1962) er en av 1900-tallets mest leste og innflytelserike forfattere. Hele hans forfatterskap kan sies å være historien om hans egen søken etter sannhet. Han var influert av Freud, Jung, mystikk og østerlandsk filosofi, men ønsket ikke å bli plassert under en etikette. I flere av sine mest berømte verker forteller han om en person som samtidig er han selv og en representant for menneskeheten. Denne personen søker sannheten om seg selv og den absolutte sannheten, men kan i...

  12. Vad vill kvinnor ha? : En undersökning av en lokaltidnings bilaga i form av ett livsstilsmagasin.

    OpenAIRE

    Heurling, Åsa; Lovisa, Lesse

    2011-01-01

    Folkbladet är en dagstidning i Norrköping med en stark lokal prägel vars prenumeranter till största delen är sportintresserade män. För att försöka bredda sin läsekrets har man sedan 2009 gett ut en tidning kallad Trend, som vänder sig till kvinnor i åldern 20 - 50 år. Denna tidning med lokal prägel, i form av ett livsstilsmagasin för kvinnor, handlar om mode, skönhet, heminredning och resor. Maga- sinet ges ut i fyra nummer per år och delas ut gratis till alla hushåll i Norrköping med omnejd...

  13. Value of the adenosine test for diagnosis of dual AV nodal physiology in patients with AV nodal reentrant tachycardia

    Institute of Scientific and Technical Information of China (English)

    周斌全; 胡申江; 等

    2002-01-01

    Objectives:This study was aimed at assessing the value of the adenosine test for noninvasive diagnosis of dual AV nodal physiology(DAVNP) in patients with AV nodal reentrant tachycardia(VANRT).Methods:53 patients with paroxysmal supraventricular tachycardia(PSVT) were given incremental doses of adenosine intravenously during sinus rhythm before electrophysiological study.The adenosine test was repeated on a subset of 18 patients with AVNRT after radiofrequency catheter ablation.Results:Sudden increments of PR interval of more than 60 msec between two consecutive beats were observed in 26(83.9%) of 31 patients with typical AVNRT and 2(9.1%) of 22 patients with AVRT and AT(P<0.01),The maximal PR increment between 2 consecutive beats in the AVNRT group(105±45ms) was significantly greater than that in the AVRT and AT group[(20±13ms) (P<0.01),In postablation adenosine test,DAVNP was eliminated in all 8 patients who underwent slow pathway abolition that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS whosed the slow pathway persisted.Six of 10 patients whw exhibited persistent duality showed a marked reduction in the number of beats conducted in the slow pathway after adenosine injection(P<0.01),COnclusions:Administration of adenosine during sinus rhythm may be a useful bedside test for diagnosis of DAVNP in high percentage of patients with typical AVNRT and additionally for evaluating the effects of radiofrequency ablation.

  14. Inventory of future power and heat production technologies. Partial report Gasification with gas turbine/engine for power plants; Incl. English lang. appendix of 24 p. titled 'Status of large-scale biomass gasification for power production'; Inventering av framtidens el och vaermeproduktionstekniker. Delrapport Foergasning med gasturbin/motor foer kraftvaerk

    Energy Technology Data Exchange (ETDEWEB)

    Waldheim, Lars; Larsson, Eva K. (TPS Termiska Processer, Nykoeping (Sweden))

    2008-12-15

    This subproject is limited to applications with gas turbines or engines from approximately 1 MWe and firing of gas in a boiler either as indirect cofiring or as separate firing of gas from waste gasification. Gasification with gas engine, BIG-ICE (Biomass Integrated Gasification Internal-Combustion Engine) is realized in approximately 10 plants in Europe between 1 and 7 MWe. The gas needs to be cleaned from particles and tar before it is fed to the engine. A number of different gasifiers and gas cleaning technologies are applied in these prototypes, and in certain cases a second generation is being built. Gas engines from GE Jenbacher are most common, but there are also other producers with engines for low-calorific-value gas. The exhausts from engines must, unlike gas turbines, be cleaned catalytically, but emissions of hydrocarbons in particular are still higher than from gas turbines. It is possible to increase the electricity generation by applying a 'bottoming cycle' in the form of a steam or an ORC cycle. Such a plant with ORC has been started in Austria this year. During the 1990's expectations were high concerning the development of biomass gasification with gas turbine in a combined cycle BIG-CC (Biomass Integrated Gasification Combined Cycle) towards commercialisation. Two demonstration plants were built for the same gas turbine model, Siemens SGT 100 (earlier Typhoon); Vaernamo with pressurised gasification and ARBRE in Eggborough, England, with atmospheric gasification. The atmospheric technology has basically the same demands on gas cleaning as in the engine application, but downstream the gas is compressed to the pressure required by the gas turbine. In pressurised gasification, the gasifier pressure is set by the gas turbine. The gas is not cooled below 350-400 deg C and is cleaned in a high-temperature filter. Despite successful demonstration in Vaernamo, no more plants have been built. The ARBRE plant was never put into regular

  15. Värdering och redovisning till verkligt värde av finansiella instrument : en studie av IAS 39 och SFAS 157

    OpenAIRE

    Campner, Britta; Liang, Yucong; Melkersson, Rickard

    2009-01-01

    Bakgrund och problem: Som ett steg i konvergeringsprocessen med FASB startade IASB år2006 ett projekt med syfte att skapa en enhetlig standard för värdering till verkligt värde i helaIFRS. I den inledande fasen av projektet utformades ett discussion paper, där denamerikanska motsvarigheten för värdering till verkligt värde, SFAS 157, användes somutgångspunkt. En av de standarder som i hög grad innefattar värdering till verkligt värde ochsåledes berörs i stor utsträckning av projektet är IAS 3...

  16. Utveckling av fryssäker vaccinväska : För transport av vaccin till svårtillgängliga områden

    OpenAIRE

    TILLQVIST, VIKTOR; Sandqvist, Viktor

    2014-01-01

    Detta projekt fokuserar på att förhindra att vaccinet förstörs vid transport, samt underlätta för vårdpersonal som arbetar för att transportera vaccin till otillgängliga områden. Vaccin måste förvaras kylt. Därför utgörs transporten av vaccin av en så kallad kylkedja. Projektet behandlar den sista delen i kylkedjan, den så kallade last miltransportation. Idag varierar kunskapen hos arbetarna vilket medför variationer i utförandet av de rutiner som är utvecklade för att på ett säkert sätt pake...

  17. Analys av miljöanpassad ogräsbekämpning

    OpenAIRE

    2013-01-01

    Svenska Kraftnät är ett statligt affärsverk vars huvuduppgift är drift och underhåll av det svenska elstamnätet. Bekämpningen av oönskad vegetation är en del i underhållsarbetet i anläggningarna och sker i dagsläget med det kemiska bekämpningsmedlet Roundup. Svenska Kraftnät önskar att minska eller ersätta den kemiska ogräsbekämpningen med en miljöanpassad metod och rapporten syftar till att undersöka den möjligheten.  En av de möjliga metoderna, NCC Spuma, testades i ett fältförsök i en av S...

  18. Transformasjon av Lækjargata : fra transportåre til en levende bygate

    OpenAIRE

    Pétursdóttir, Tinna Rut

    2016-01-01

    Lækjargata, en av de viktigste bygatene i Reykjavík, og temaet for dette prosjektet, er et eksempel på en gate som har blitt overtatt av privatbiler med lite fokus på myke trafikanter. Gaten er et svært viktig innslag i bybildet, har stor historisk betydning og en sterk identitet, som man dessverre ikke kan nyte på grunn av bilene. Målet med oppgaven er å finne en måte å transformere Lækjargata til å bli en levende bygate ved hjelp av blå og grønne strukturer og samtidig bidra til å skape en ...

  19. Eksklusive fellesskap: Et kritisk blikk på nyurbanismen i lys av Kentlands, USA

    Directory of Open Access Journals (Sweden)

    Bengt Andersen

    2008-10-01

    Full Text Available Denne artikkelen tar utgangspunkt i nyurbanismen, en amerikansk byplanleggingsbevegelse, og deres byutviklingsprosjekt Kentlands i Maryland, USA. Deres påstand er at en gjennom de rette designprinsippene vil få det ønskede samfunnet. Her argumenteres det for at den fysiske determinismen som ligger til grunn for den nyurbanistiske ideologien er for enkel. Mens nyurbanistene hevder at de skaper heterogene og lokaliserte fellesskap gjennom realiseringen av deres egne designprinsipper, hevdes det her med støtte i en sosialantropologisk studie av Kentlands at dannelsen av slike fellesskap er noe mer komplisert. Innbyggerne viste seg i praksis til og med å handle mot et slikt ideal. Sosial praksis, de nyurbanistiske designreglene, samt den felles interessen for å opprettholde eiendomsverdiene, førte til etableringen av en "eksklusiv enklave" snarere enn et inkluderende bomiljø.Nøkkelord: Nyurbanisme, byplanlegging, designregler, eksklusive enklaver

  20. Consequences of increased extraction of forest fuel; Konsekvenser av ett oekat uttag av skogsbraensle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    Sweden, but it might increase and it is often mixed with other solid biofuel at the plants. The review is based on a large number of scientific reports. It focuses mainly on Swedish conditions, consequently studies from northern Europe dominates, but we refer also to a large number of studies from other parts of the world. In Sweden, most of the relevant studies have been financed by the Swedish Energy Agency. Therefore, we have analysed all projects within the research programmes funded by the Swedish Energy Agency. This means not only reading scientific papers, but also all kinds of reports, as well as interviews with project leaders. Our result has been examined and discussed at a number of seminars and workshops. Connected to our work we had a reference group with members representing authorities, forestry companies and NGOs. To be able to evaluate the consequences of increased biomass extraction we have related our result to environmental objectives, and goals for forest production, set up by the society (the Swedish parliament). In Sweden we have adopted 16 environmental objectives (http://www.miljomal.nu/Environmental-Objectives-Portal/, in English). Of these especially five objectives are most relevant for our analysis: Reduced climate impact, Natural acidification only, A non-toxic environment, Zero eutrophication and Sustainable forests. The forest production goal is described in the forestry policy (Government proposition 1992/92: 226, in Swedish)

  1. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523:SF15 SODIUM/POTASSIUM-D...EPENDENT ATPASE BETA SUBUNIT, INSECT 1.1e-19 T IPR000402 unintegrated Molecular Function: sodium:potassium-e...Process: potassium ion transport (GO:0006813)|Biological Process: sodium ion transport (GO:0006814)|Cellular Component: membrane (GO:0016020) ...

  2. The Galactic NH - AV Relation and its Application to Historical Galactic SNRs

    CERN Document Server

    Tian, Wen-Wu; Xiang, F Y

    2013-01-01

    We refine a classic relation between the hydrogen column density (NH) and optical extinction (Av) by employing 39 Galactic Supernova Remnants (SNRs) with X-rays, optical and/or infra-red data available. We find NH = (1.69+/-0.07)*10^21 Av cm^(-2) mag^(-1) . Applying this relation to three Galactic SNRs with good historical records allows us to further constrain either their progenitor's distances or magnitudes, which is independent access to their distances.

  3. [(18)F]AV-1451 binding to neuromelanin in the substantia nigra in PD and PSP.

    Science.gov (United States)

    Coakeley, Sarah; Cho, Sang Soo; Koshimori, Yuko; Rusjan, Pablo; Ghadery, Christine; Kim, Jinhee; Lang, Anthony E; Houle, Sylvain; Strafella, Antonio P

    2017-09-07

    This study investigated binding of [(18)F]AV-1451 to neuromelanin in the substantia nigra of patients with Parkinson's disease (PD) and progressive supranuclear palsy (PSP). [(18)F]AV-1451 is a positron emission tomography radiotracer designed to bind pathological tau. A post-mortem study using [(18)F]AV-1451 discovered off-target binding properties to neuromelanin in the substantia nigra. A subsequent clinical study reported a 30% decrease in [(18)F]AV-1451 binding in the midbrain of PD patients. A total of 12 patients and 10 healthy age-matched controls were recruited. An anatomical MRI and a 90-min PET scan, using [(18)F]AV-1451, were acquired from all participants. The standardized uptake value ratio (SUVR) from 60 to 90 min post-injection was calculated for the substantia nigra, using the cerebellar cortex as the reference region. The substantia nigra was delineated using automated region of interest software. An independent samples ANOVA and LSD post hoc testing were used to test for differences in [(18)F]AV-1451 SUVR between groups. Substantia nigra SUVR from 60 to 90 min was significantly greater in HC compared to both PSP and PD groups. Although the PD group had the lowest SUVR, there was no significant difference in substantia nigra uptake between PD and PSP. [(18)F]AV-1451 may be the first PET radiotracer capable of imaging neurodegeneration of the substantia nigra in parkinsonisms. Further testing must be done in PD and atypical parkinsonian disorders to support this off-target use of [(18)F]AV-1451.

  4. Dynamics of AV coupling during human atrial fibrillation: role of atrial rate.

    Science.gov (United States)

    Masè, M; Marini, M; Disertori, M; Ravelli, F

    2015-07-01

    The causal relationship between atrial and ventricular activities during human atrial fibrillation (AF) is poorly understood. This study analyzed the effects of an increase in atrial rate on the link between atrial and ventricular activities during AF. Atrial and ventricular time series were determined in 14 patients during the spontaneous acceleration of the atrial rhythm at AF onset. The dynamic relationship between atrial and ventricular activities was quantified in terms of atrioventricular (AV) coupling by AV synchrogram analysis. The technique identified n:m coupling patterns (n atrial beats in m ventricular cycles), quantifying their percentage, maximal length, and conduction ratio (= m/n). Simulations with a difference-equation AV model were performed to correlate the observed dynamics to specific atrial/nodal properties. The atrial rate increase significantly affected AV coupling and ventricular response during AF. The shortening of atrial intervals from 185 ± 32 to 165 ± 24 ms (P AV patterns with progressively decreasing m/n ratios (from conduction ratio = 0.34 ± 0.09 to 0.29 ± 0.08, P AV block and coupling instability at higher atrial rates were associated with increased ventricular interval variability (from 123 ± 52 to 133 ± 55 ms, P AV pattern transitions and coupling instability in patients were predicted, assuming the filtering of high-rate irregular atrial beats by the slow recovery of nodal excitability. These results support the role of atrial rate in determining AV coupling and ventricular response and may have implications for rate control in AF. Copyright © 2015 the American Physiological Society.

  5. Utilization of Electrocardiographic P-wave Duration for AV Interval Optimization in Dual-Chamber Pacemakers.

    Science.gov (United States)

    Sorajja, Dan; Bhakta, Mayurkumar D; Scott, Luis Rp; Altemose, Gregory T; Srivathsan, Komandoor

    2010-09-05

    Empiric programming of the atrio-ventricular (AV) delay is commonly performed during pacemaker implantation. Transmitral flow assessment by Doppler echocardiography can be used to find the optimal AV delay by Ritter's method, but this cannot easily be performed during pacemaker implantation. We sought to determine a non-invasive surrogate for this assessment. Since electrocardiographic P-wave duration estimates atrial activation time, we hypothesized this measurement may provide a more appropriate basis for programming AV intervals. A total of 19 patients were examined at the time of dual chamber pacemaker implantation, 13 (68%) being male with a mean age of 77. Each patient had the optimal AV interval determined by Ritter's method. The P-wave duration was measured independently on electrocardiograms using MUSE® Cardiology Information System (version 7.1.1). The relationship between P-wave duration and the optimal AV interval was analyzed. The P-wave duration and optimal AV delay were related by a correlation coefficient of 0.815 and a correction factor of 1.26. The mean BMI was 27. The presence of hypertension, atrial fibrillation, and valvular heart disease was 13 (68%), 3 (16%), and 2 (11%) respectively. Mean echocardiographic parameters included an ejection fraction of 58%, left atrial index of 32 ml/m(2), and diastolic dysfunction grade 1 (out of 4). In patients with dual chamber pacemakers in AV sequentially paced mode and normal EF, electrocardiographic P-wave duration correlates to the optimal AV delay by Ritter's method by a factor of 1.26.

  6. Tungstate and Carbonate Ions Sorption Using Anion Exchangers AV-17-8 and Purolite A400

    Directory of Open Access Journals (Sweden)

    Chegrintsev S.

    2016-01-01

    Full Text Available The current paper shows the results of tungstate and carbonate ion sorption using strongly basic anion exchangers AV-17-8 and Purolite A400. It has been established that anion exchanger AV-17-8 in the chloride form with parameters of 168 g of tungstate ion and 157 g of carbonate ion per 1 kg of anion exchanger has the maximum capacity for the tungstate and carbonate ions.

  7. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  8. InterProScan Result: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 AV399741_2_ORF2 F87D90D9B5BA6C11 SUPERFAMILY SSF55267 tRNA-intron endonucl...ease N-terminal domain-like 8.3e-06 T IPR006678 tRNA intron endonuclease, N-terminal Molecular Function: tRNA-intron endonuclease activity (GO:0000213) ...

  9. Kvalitetsutvärdering av biomedicin och närliggande huvudområden

    DEFF Research Database (Denmark)

    Leffler, Hakon; Fex Svenningsen, Åsa; Emgård, Mia

    2014-01-01

    UKÄ:s utvärdering av biomedicinutbildningar visar på en mycket varierad kvalitet. Nio av 21 utbildningar håller toppklass medan mer än hälften bedöms vara bristande. 21 utbildningar inom biomedicin har satts under lupp. Kvaliteten bedöms som vanligt efter en tregradig skala: mycket hög kvalitet...

  10. [F-18]-AV-1451 binding correlates with postmortem neurofibrillary tangle Braak staging.

    Science.gov (United States)

    Marquié, Marta; Siao Tick Chong, Michael; Antón-Fernández, Alejandro; Verwer, Eline E; Sáez-Calveras, Nil; Meltzer, Avery C; Ramanan, Prianca; Amaral, Ana C; Gonzalez, Jose; Normandin, Marc D; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-06-13

    [F-18]-AV-1451, a PET tracer specifically developed to detect brain neurofibrillary tau pathology, has the potential to facilitate accurate diagnosis of Alzheimer's disease (AD), staging of brain tau burden and monitoring disease progression. Recent PET studies show that patients with mild cognitive impairment and AD dementia exhibit significantly higher in vivo [F-18]-AV-1451 retention than cognitively normal controls. Importantly, PET patterns of [F-18]-AV-1451 correlate well with disease severity and seem to match the predicted topographic Braak staging of neurofibrillary tangles (NFTs) in AD, although this awaits confirmation. We studied the correlation of autoradiographic binding patterns of [F-18]-AV-1451 and the stereotypical spatiotemporal pattern of progression of NFTs using legacy postmortem brain samples representing different Braak NFT stages (I-VI). We performed [F-18]-AV-1451 phosphor-screen autoradiography and quantitative tau measurements (stereologically based NFT counts and biochemical analysis of tau pathology) in three brain regions (entorhinal cortex, superior temporal sulcus and visual cortex) in a total of 22 cases: low Braak (I-II, n = 6), intermediate Braak (III-IV, n = 7) and high Braak (V-VI, n = 9). Strong and selective [F-18]-AV-1451 binding was detected in all tangle-containing regions matching precisely the observed pattern of PHF-tau immunostaining across the different Braak stages. As expected, no signal was detected in the white matter or other non-tangle containing regions. Quantification of [F-18]-AV-1451 binding was very significantly correlated with the number of NFTs present in each brain region and with the total tau and phospho-tau content as reported by Western blot and ELISA. [F-18]-AV-1451 is a promising biomarker for in vivo quantification of brain tau burden in AD. Neuroimaging-pathologic studies conducted on postmortem material from individuals imaged while alive are now needed to confirm these observations.

  11. Adaptationer av Esaias Tegnérs Frithiofs saga

    DEFF Research Database (Denmark)

    Nordenfors, Ola

    2008-01-01

    Tegnérs versepos över urnordiska myter hade länge ett starkt om den nordiska läsande allmänheten - därtill starkt understött av Bernhard Crusells omtyckta tonsättningar av dikterna. Men också i Tyskland har Frithiofs saga haft en påfallande genomslagskraft. I uppsatsen granskas särskilt tonsättar...

  12. Et sosiologisk blikk på mobbing. En teoretisk studie av paradigmet og fenomenet mobbing

    OpenAIRE

    Stemland, Linn

    2007-01-01

    Mobbing er et tema som har fått stadig mer oppmerksomhet i samfunnsdebatten. Det er gjort lite sosiologisk forskning omkring fenomenet mobbing. Forskningsfeltet mobbing er i dag konstruert og dominert av psykologiens begreper og forståelse. I denne oppgaven prøver jeg å nærme meg en sosiologisk forståelse av begrepet og fenomenet mobbing.

  13. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  14. Phylogenetic position and replication kinetics of Heliothis virescens ascovirus 3h (HvAV-3h isolated from Spodoptera exigua.

    Directory of Open Access Journals (Sweden)

    Guo-Hua Huang

    Full Text Available Insect-specific ascoviruses with a circular genome are distributed in the USA, France, Australia and Indonesia. Here, we report the first ascovirus isolation from Spodoptera exigua in Hunan, China. DNA-DNA hybridization to published ascoviruses demonstrated that the new China ascovirus isolate is a variant of Heliothis virescens ascovirus 3a (HvAV-3a, thus named HvAV-3h. We investigated the phylogenetic position, cell infection, vesicle production and viral DNA replication kinetics of HvAV-3h, as well as its host-ranges. The major capsid protein (MCP gene and the delta DNA polymerase (DNA po1 gene of HvAV-3h were sequenced and compared with the available ascovirus isolates for phylogenetic analysis. This shows a close relationship with HvAV-3g, originally isolated from Indonesia, HvAV-3e from Australia and HvAV-3c from United States. HvAV-3h infection induced vesicle production in the SeE1 cells derived from S. exigua and Sf9 cells derived from S. frugiperda, resulting in more vesicles generated in Sf9 than SeE1. Viral DNA replication kinetics of HvAV-3h also demonstrated a difference between the two cell lines tested. HvAV-3h could readily infect three important insect pests Helicoverpa armigera (Hübner, Spodoptera exigua (Hübner and Spodoptera litura (Fabricius from two genera in different subfamilies with high mortalities.

  15. First-degree AV block-an entirely benign finding or a potentially curable cause of cardiac disease?

    Science.gov (United States)

    Holmqvist, Fredrik; Daubert, James P

    2013-05-01

    First-degree atrioventricular (AV) block is a delay within the AV conduction system and is defined as a prolongation of the PR interval beyond the upper limit of what is considered normal (generally 0.20 s). Up until recently, first-degree AV block was considered an entirely benign condition. In fact, some complain that it is a misnomer since there is only delay and no actual block in the AV conduction system (usually within the AV node). However, it has long been acknowledged that extreme forms of first-degree AV block (typically a PR interval exceeding 0.30 s) can cause symptoms due to inadequate timing of atrial and ventricular contractions, similar to the so-called pacemaker syndrome. Consequently, the current guidelines state that permanent pacemaker implantation is reasonable for first-degree AV block with symptoms similar to those of pacemaker syndrome or with hemodynamic compromise, but also stresses that there is little evidence to suggest that pacemakers improve survival in patients with isolated first-degree AV block. Recent reports suggest that it may be time to revisit the impact of first-degree AV block. Also, several findings in post hoc analyses of randomized device trials give important insights in possible treatment options. The present review aims to provide an update on the current knowledge concerning the impact of first-degree AV block and also to address the issue of pacing in patients with this condition. ©2013, Wiley Periodicals, Inc.

  16. Patients' and procedural characteristics of AV-block during slow pathway modulation for AVNRT-single center 10year experience.

    Science.gov (United States)

    Wasmer, Kristina; Dechering, Dirk G; Köbe, Julia; Leitz, Patrick; Frommeyer, Gerrit; Lange, Phillip S; Kochhäuser, Simon; Reinke, Florian; Pott, Christian; Mönnig, Gerold; Breithardt, Günter; Eckardt, Lars

    2017-10-01

    Permanent AV-block is a recognized and feared complication of slow pathway modulation for AVNRT. We aimed to assess incidence of transient and permanent AV-block as well as consequences of transient AV-block in a large contemporary AVNRT ablation cohort. We searched our single center prospective ablation database for occurrence of transient and permanent AV-block during slow pathway modulation between January 2004 and October 2015. We analyzed patients' and procedural characteristics as well as outcome of patients in whom transient or permanent AV-block occurred. Of 9170 patients who underwent a catheter ablation at our institution between January 2004 and October 2015, 2101 patients (64% women, mean age 50±18years) underwent slow pathway modulation. In three patients, permanent AV-block occurred during RF application. Additional two patients had transient AV-block that recovered (after a few minutes and 25min), but recurred within two days of the procedure. All five patients underwent dual chamber pacemaker implantation (0.2%). Transient AV-block related to RF delivery occurred in 44 patients (2%). Transient mechanical AV-block occurred in additional 17 patients (0.8%). In 12 patients, ablation was continued despite transient AV-block. One of these patients developed permanent AV-block. Permanent AV-block following slow pathway modulation is a rare event, occurring in 0.2% of patients in a large contemporary single center cohort. Transient AV-block is more frequent (2%). Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Cost estimations for deep disposal of spent nuclear fuels; Kostnadsberaekning av djupfoervaring av det anvanda kaernbraenslet

    Energy Technology Data Exchange (ETDEWEB)

    Palmqvist, K.; Wallroth, T. [BERGAB - Berggeologiska Undersoekningar AB, Goeteborg (Sweden); Green, L.; Joensson, Lars [Peab Berg AB, Goeteborg (Sweden)

    1999-10-01

    According to the Act on the Financing of Future Expenses for Spent Nuclear Fuel etc. (Financing Act), the Swedish Nuclear Fuel and Waste Management Co. (SKB) must submit, every year, to the Swedish Nuclear Power Inspectorate (SKI), a cost estimate for the management of spent nuclear fuel and for the decommissioning and dismantling of the nuclear power plants. After SKI has examined and evaluated the cost estimates, SKI must submit a proposal to the Government concerning the fee which should be paid by the nuclear power companies per kWh of generated electricity. According to the Financing Act, the reactor owners must pledge collateral in the event that the accumulated fees should be found to be insufficient as a result of early closure of reactors or as a result of underestimating the future expenses of managing the spent nuclear fuel and of decommissioning and dismantling the reactors. The future total expenses resulting from the Financing Act are estimated at about SEK 48 billion at the January 1998 price level. Of this amount, the cost of the final disposal of spent nuclear fuel in SKB's programme is expected to amount to about SEK 12 billion. SKB's estimate comprises the cost of siting, construction and operation of a deep repository for spent nuclear fuel, based on the KBS-3 concept, and a rock cavern for other long-lived waste which SKB plans to locate next to the spent fuel repository. The cost estimate also includes the dismantling and closure of the facility once all of the fuel and the long-lived waste are deposited. The calculations are based on all of the fuel, which will be generated through the operation of the 12 Swedish reactors during a period of 25 years and for every additional year of operation. At the beginning of 1998, SKI commissioned BERGAB to evaluate the cost estimate for the deep disposal of the spent nuclear fuel. The task was divided into two stages, namely a study which was submitted in June 1998 concerning the technical

  18. Amyloid deposition after cerebral hypoperfusion: evidenced on [(18)F]AV-45 positron emission tomography.

    Science.gov (United States)

    Huang, Kuo-Lun; Lin, Kun-Ju; Ho, Meng-Yang; Chang, Yeu-Jhy; Chang, Chien-Hung; Wey, Shiaw-Pyng; Hsieh, Chia-Ju; Yen, Tzu-Chen; Hsiao, Ing-Tsung; Lee, Tsong-Hai

    2012-08-15

    Animal studies have shown that cerebral hypoperfusion may be associated with amyloid plaque accumulation. Amyloid plaque is known to be associated with dementia and [(18)F]AV-45 is a positron emission tomography (PET) ligand that binds to extracelluar plaques. We hypothesized that demented patients with cerebral hypoperfusion may have increased [(18)F]AV-45 uptake. Five demented patients with cerebral hypoperfusion due to unilateral carotid artery stenosis (CAS) were examined with [(18)F]AV-45 PET, and the results were compared with six elderly controls. The standard uptake value ratio (SUVR) of each region of interest (ROI) was created using whole cerebellum as the reference region. All subjects underwent magnetic resonance imaging (MRI) for obtaining structural information. Patients with dementia and unilateral CAS had a higher global [(18)F]AV-45 SUVR (1.34 ± 0.06) as compared with controls (1.10 ± 0.04, p=0.0043), especially over the frontal, temporal, precuneus, anterior cingulate and occipital regions. The statistical distribution maps revealed a significantly increased [(18)F]AV-45 SUVR in the medial frontal, caudate, thalamus, posterior cingulate, occipital and middle and superior temporal regions ipsilateral to the side of CAS (pAV-45 binding is increased in demented patients with CAS, and its distribution is lateralized to the CAS side, suggesting that amyloid-related dementia may occur under cerebral hypoperfusion. Copyright © 2012 Elsevier B.V. All rights reserved.

  19. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Science.gov (United States)

    Inai, Kei; Burnside, Jessica L; Hoffman, Stanley; Toole, Bryan P; Sugi, Yukiko

    2013-01-01

    Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV) valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM) components, versican and hyaluronan (HA), and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH) stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC) aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  20. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Directory of Open Access Journals (Sweden)

    Kei Inai

    Full Text Available Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM components, versican and hyaluronan (HA, and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  1. Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family

    DEFF Research Database (Denmark)

    Nilsson, Stefan K; Lookene, Aivar; Beckstead, Jennifer A;

    2007-01-01

    Apolipoprotein A-V is a potent modulator of plasma triacylglycerol levels. To investigate the molecular basis for this phenomenon we explored the ability of apolipoprotein A-V, in most experiments complexed to disks of dimyristoylphosphatidylcholine, to interact with two members of the low densit...... to receptor-covered sensor chips. Our results indicate that apolipoprotein A-V may influence plasma lipid homeostasis by enhancing receptor-mediated endocytosis of triacylglycerol-rich lipoproteins. Udgivelsesdato: 2007-Mar-27......Apolipoprotein A-V is a potent modulator of plasma triacylglycerol levels. To investigate the molecular basis for this phenomenon we explored the ability of apolipoprotein A-V, in most experiments complexed to disks of dimyristoylphosphatidylcholine, to interact with two members of the low density...... lipoprotein receptor family, the low density lipoprotein receptor-related protein and the mosaic type-1 receptor, SorLA. Experiments using surface plasmon resonance showed specific binding of both free and lipid-bound apolipoprotein A-V to both receptors. The binding was calcium dependent and was inhibited...

  2. Dementia care mapping – en mulig metode for utvikling av demensomsorg i sykehjem

    Directory of Open Access Journals (Sweden)

    Anne Marie Mork Rokstad

    2009-02-01

    Full Text Available Artikkelen omhandler en studie av Dementia Care Mapping (DCM anvendt i et norsk sykehjem. Hensikten med studien var å undersøke om det skjer et perspektivskifte i personalgruppen ved bruk av DCM-metoden, og om dette får konsekvenser for praksis. I studien inngikk fokusgruppeintervju med personalet i sykehjemsavdelingen. Bakgrunnsopplysningene som sykepleierne reflekterte over, var kartlegging av trivsel og velvære hos pasientene innsamlet gjennom DCM-metoden, og meldt tilbake til personalet. Personalet opplevde at tilbakemeldingene førte til økt bevissthet i samhandling med pasientene. Ifølge deres utsagn medførte prosjektet flere konkrete endringer i måten de møtte pasientene på. Kartleggingen foretatt etter tre måneder viste større grad av trivsel og velvære i pasientgruppen. Dette peker i retning av at DCM kan være en nyttig metode for kvalitetsutvikling av demensomsorgen i sykehjem. Det er imidlertid behov for videre forskning med et strammere design og et større utvalg for å bekrefte funnene.

  3. ADVANCED VITRIFICATION SYSTEM (RIC AVS) RESEARCH AND DEVELOPMENT PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    J.R. Powell; M. Reich

    2003-06-30

    The objective of this AVS testing program is to use bench-scale test equipment to produce a vitrified product at maximum waste loading from the specified AZ-101 waste simulant and conduct a TTT analysis using laboratory scale melts to show compliance with the DOE Waste Acceptance Product Specifications for Vitrified High-Level Waste Forms (WAPS). The vitrified product complies with the following WAPS. A borosilicate glass with a waste loading of 60.9-wt% was produced from a slurry feed of AZ101 simulant. Glass durability testing, glass characterization testing, and testing methodology were performed in accordance with the Department of Energy approved Test Plan. The glass has two crystalline phases and good uniformity of composition. The Product Consistency Test on the 6 location-specific samples are at least 1 to 2 orders of magnitude below the mean PCT results for the EA glass. Standard deviations were less than 10% of measured values. The glass transition temperature averaged 658 {+-} 9 C. A TTT diagram was produced. There was measured cesium loss of about 2%, and compliance with the Universal Treatment Standards.

  4. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  5. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  6. Whether noninvasive optimization of AV and VV delays improves the response to cardiac resynchronization therapy.

    Science.gov (United States)

    Urbanek, Bożena; Chudzik, Michał; Klimczak, Artur; Rosiak, Marcin; Lewek, Joanna; Wranicz, Jerzy Krzysztof

    2013-01-01

    Device optimization is not routinely performed in patients who underwent cardiac resynchronization therapy (CRT) device implantation. Noninvasive optimization of CRT devices by measurement of cardiac output (CO) can be used as a simple method to assess ventricular systolic performance. The aim of this study was to assess whether optimization of atrioventricular (AV) and interventricular (VV) delay can improve hemodynamic response to CRT and whether this optimization should be performed for each patient individually. Twenty patients with advanced heart failure New York Heart Association (NYHA) class III/IV, left ventricular ejection fraction ≤ 35% and left bundle branch block (QRS ≥ 120 ms) in sinus rhythm were evaluated from 24 h to 48 h after implantation of a CRT device by means of impedance cardiography (ICG). CO was first measured at each patient's intrinsic rhythm. Patients then underwent adjustments of AV and VV delay from 80 ms to 140 ms and from -60 ms to +60 ms, respectively in 20 ms increment steps and CO at each setting was measured by ICG. Both AV and VV delays were programmed according to the greatest improvement in CO compared to intrinsic rhythm. There was a statistically signifi cant increase in CO measured at the intrinsic rhythm compared to different AV delay by mean of 21% (3.8 ± 1.0 vs. 4.6 ± 0.1 L/min, p AV/VV delays with left ventricle-preexcitation or simultaneous biventricular pacing caused additional increased CO from intrinsic rhythm by mean of 32.6% (3.8 ± 1.0 vs. 5.04 ± ± 1.0 L/min, p AV/VV setting delays also resulted in improved hemodynamic responses compared to VV factory setting delay. Both AV and VV delay optimization should be performed in clinical practice. Optimal AV delay improved outcome. However, combination of optimized AV/VV delays provided the best hemodynamic response. Optimized AV/VV delays with left ventricle-preexcitation or simultaneous biventricular pacing increased hemodynamic output compared to intrinsic

  7. Universell utforming og den vanskelige avgrensingen av «alle»

    Directory of Open Access Journals (Sweden)

    Lars Christian Risan

    2013-12-01

    Full Text Available Universell utforming er et prinsipp hvor målsetningen er at «utforming av produkter og omgivelser [skal skje] på en slik måte at de kan brukes av alle mennesker, i så stor utstrekning som mulig, uten behov for tilpassing og en spesiell utforming.» (Aslaksen mfl, 1997, den første norske definisjonen I løpet av de siste 15 årene har dette prinsippet blitt fremmet i Norge som et utvetydig fremskritt. Det kan imidlertid være farlig å tro at en ren teknisk løsning kan bygge bro over politiske kontroverser (Imrie 2012, og i denne artikkelen vil vi vise hvordan viktige ideologiske premisser er skjult under paraplyen om universalitet. Vårt empiriske felt er norsk boligpolitikk fra etterkrigstiden og fram til i dag. Innenfor dette feltet ser vi at det har vært argumentert for ulike versjoner av «universell utforming» de siste 40 årene, selv om navnet «universell utforming» er av nyere dato. Vi vil vise hvordan prinsippet har endret seg fra å ha et sosialdemokratisk innhold – før det ble omdøpt til «universell utforming» – for å bli inkorporert i et nyliberalt boligpolitisk paradigme de siste 15 årene. De sosialdemokratiske forgjengerne til «universell utforming» ble til dels formulert som videreutviklinger av en boligpolitikk for sosial rettferdighet og økonomisk likhet. Med innføringen av begrepet «universell utforming» har denne brede sosiale rammen forsvunnet, men under dekke av universalitet og entydig framskrittsoptimisme har denne politiske endringen blitt underkommunisert.[i] [i] Prosjektet er finansiert av Husbanken. Prosjektmedarbeiderne har bestått av NIBR-forskerne Erik Henningsen, Siri Nørve og Lars Risan. Underveis har disse forskerne intervjuet og snakket med en rekke personer innenfor feltene funksjonshemming- og boligpolitikk. Vi takker også Jon Guttu, Olav Rand Bringa, Tore Lange for mange konstruktive innspill. 

  8. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p AV node (p AV node during AF by saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  9. 阿弗菌素链霉菌突变株AV-m-481发酵产物的研究%Fermentation Products of AV-m-481, A Mutant Strain of Streptomyces avermitilis

    Institute of Scientific and Technical Information of China (English)

    叶少兵; 冯军; 赵文杰; 程晴华; 林纲

    2003-01-01

    高产菌株Streptomyces avermitilis AV-h-169用亚硝基胍进行处理后得到了一不产阿弗菌素的突变株AV-m-481,从该突变株的发酵产物中分离纯化出化合物AV-L-1和AV-L-2.质谱和核磁共振谱等测定表明它们分别为阿弗菌素A1a和A2a的糖苷配基.

  10. Flåtten Ixodes ricinus som sykdomsvektor i Sør-Norge. Etablering og utvikling av PCR-baserte påvisningsmetoder og påvisning av Babesia, Borrelia og Anaplasma

    OpenAIRE

    2004-01-01

    NORSK SAMMENDRAG: Hensikten med denne undersøkelsen var å undersøke flåtten Ixodes ricinus som smittebærer av Ehrlichia/ Anaplasma, Borrelia burgdorferi sensu lata og Babesia i Sør-Norge, og å etablere DNA-basert metode for påvisning av Babesia og forbedre metode for påvisning av Ehrlichia/ Anaplasma. For å kontrollere variasjon i følsomheten av Ehrlichia/ Anaplasma PCR med 16s rDNA primere Ehr 521/747, ble en internkontroll konstruert. Internkontrollen er et DNA-fragment so...

  11. A Practical ECG Criterion to Unmask Left Accessory AV Connections in Patients With Subtle Preexcitation.

    Science.gov (United States)

    Thompson, J Jenkins; Shah, Jignesh; Charnigo, Richard; Tackett, Andrea; Darrat, Yousef H; Bailey, Alison; Delisle, Brian; Kakavand, Bahram; DI Biase, Luigi; Natale, Andrea; Morales, Gustavo; Elayi, Claude S

    2015-05-20

    Accessory AV-connections capable of antegrade conduction need to be recognized because of the potential for life-threatening arrhythmias. However, the preexcited ECG pattern may be subtle, especially among left-sided AV-connections. We explored whether additional ECG criteria might help identify left-sided AV-connections. We analyzed 156 patients who underwent an electrophysiology study (EPS) and ablation for paroxysmal supraventricular tachycardias (PSVT). Patients were divided into 2 groups: those with left-sided AV-connections (Group 1) and all other PSVT (Group 2). Various ECG parameters were compared before and after ablation in both groups. The EPS identified left-sided AV-connections among 43 patients (Group 1) and excluded it among 113 (Group 2). Baseline ECG in Group 1 demonstrated obvious preexcitation among 24/43 patients (55.8%), the remaining 19/43 missing obvious preexcitation. R/S ratio > 0.5 in V1 was noted in 38/43 (88.4%) patients in Group 1 before ablation (median 1.00; IQR 0.58-2.20), including 16/19 (84.2%) patients lacking obvious left-sided AVconnections. Conversely, only 10/113 (8.8%) patients in Group 2 had R/S ratios in V1 ≥ 0.5 (0.20; 0.10-0.31), P AV-connections (sensitivity 93.0%). The negative predictive value of this combined criterion was 103/106 (97.2%). In symptomatic patients, combining the R/S ratio (≥ 0.5) in lead V1 with the classic preexcitation pattern on ECG markedly improved the sensitivity to diagnose left-sided AV-connections. This ratio may be particularly useful among patients lacking obvious preexcitation. © 2015 Wiley Periodicals, Inc.

  12. A novel curve fitting method for AV optimisation of biventricular pacemakers.

    Science.gov (United States)

    Dehbi, Hakim-Moulay; Jones, Siana; Sohaib, S M Afzal; Finegold, Judith A; Siggers, Jennifer H; Stegemann, Berthold; Whinnett, Zachary I; Francis, Darrel P

    2015-09-01

    In this study, we designed and tested a new algorithm, which we call the 'restricted parabola', to identify the optimum atrioventricular (AV) delay in patients with biventricular pacemakers. This algorithm automatically restricts the hemodynamic data used for curve fitting to the parabolic zone in order to avoid inadvertently selecting an AV optimum that is too long.We used R, a programming language and software environment for statistical computing, to create an algorithm which applies multiple different cut-offs to partition curve fitting of a dataset into a parabolic and a plateau region and then selects the best cut-off using a least squares method. In 82 patients, AV delay was adjusted and beat-to-beat systolic blood pressure (SBP) was measured non-invasively using our multiple-repetition protocol. The novel algorithm was compared to fitting a parabola across the whole dataset to identify how many patients had a plateau region, and whether a higher hemodynamic response was achieved with one method.In 9/82 patients, the restricted parabola algorithm detected that the pattern was not parabolic at longer AV delays. For these patients, the optimal AV delay predicted by the restricted parabola algorithm increased SBP by 1.36 mmHg above that predicted by the conventional parabolic algorithm (95% confidence interval: 0.65 to 2.07 mmHg, p-value = 0.002).AV optima selected using our novel restricted parabola algorithm give a greater improvement in acute hemodynamics than fitting a parabola across all tested AV delays. Such an algorithm may assist the development of automated methods for biventricular pacemaker optimisation.

  13. Increased basal ganglia binding of (18) F-AV-1451 in patients with progressive supranuclear palsy.

    Science.gov (United States)

    Smith, Ruben; Schain, Martin; Nilsson, Christer; Strandberg, Olof; Olsson, Tomas; Hägerström, Douglas; Jögi, Jonas; Borroni, Edilio; Schöll, Michael; Honer, Michael; Hansson, Oskar

    2017-01-01

    Progressive supranuclear palsy (PSP) is difficult to diagnose accurately. The recently developed tau PET tracers may improve the diagnostic work-up of PSP. Regional tau accumulation was studied using (18) F-AV-1451 PET in 11 patients with PSP and 11 age-matched healthy controls in the Swedish BioFinder study. (18) F-AV-1451 standard uptake volume ratios were significantly higher in the basal ganglia in PSP patients when compared with controls (globus pallidus 1.75 vs 1.50; putamen 1.51 vs 1.35). Retention in the basal ganglia was correlated with age in both groups (r = .43-.78, P AV-1451 retention was observed in the cerebral cortex or white matter of either PSP patients or controls, and autoradiography did not reveal any specific binding of AV-1451 to PSP tau aggregates. We found higher (18) F-AV-1451 retention in the basal ganglia of PSP patients when compared with healthy elderly controls, but also increases with age in both controls and patients. As a result of the overlap in retention between diagnostic groups and the age-dependent increase present also in controls, (18) F-AV-1451 PET might not reliably distinguish individual patients with PSP from controls. However, further studies are needed to evaluate whether (18) F-AV-1451 PET might be useful as a progression marker in clinical PSP trials. © The Authors. Movement Disorders published by Wiley Periodicals, Inc. on behalf of International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  14. Integrated rate-dependent and dual pathway AV nodal functions: principles and assessment framework.

    Science.gov (United States)

    Billette, Jacques; Tadros, Rafik

    2014-01-15

    The atrioventricular (AV) node conducts slowly and has a long refractory period. These features sustain the filtering of atrial impulses and hence are often modulated to optimize ventricular rate during supraventricular tachyarrhythmias. The AV node is also the site of a clinically common reentrant arrhythmia. Its function is assessed for a variety of purposes from its responses to a premature protocol (S1S2, test beats introduced at different cycle lengths) repeatedly performed at different basic rates and/or to an incremental pacing protocol (increasingly faster rates). Puzzlingly, resulting data and interpretation differ with protocols as well as with chosen recovery and refractory indexes, and are further complicated by the presence of built-in fast and slow pathways. This problem applies to endocavitary investigations of arrhythmias as well as to many experimental functional studies. This review supports an integrated framework of rate-dependent and dual pathway AV nodal function that can account for these puzzling characteristics. The framework was established from AV nodal responses to S1S2S3 protocols that, compared with standard S1S2 protocols, allow for an orderly quantitative dissociation of the different factors involved in changes in AV nodal conduction and refractory indexes under rate-dependent and dual pathway function. Although largely based on data from experimental studies, the proposed framework may well apply to the human AV node. In conclusion, the rate-dependent and dual pathway properties of the AV node can be integrated within a common functional framework the contribution of which to individual responses can be quantitatively determined with properly designed protocols and analytic tools.

  15. Left-sided approach of AV junction ablation for drug refractory atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yoga Yuniadi

    2006-06-01

    Full Text Available AV junction ablation has been proven effective to treat symptomatic atrial fibrillation refractory to antiarrhythmias or fail of pulmonary vein isolation. However, about 15% of conventional right-sided approach AV junction ablation failed to produce complete heart block. This study aimed to characterize His bundle potential at ablation site during conventional or left-sided approach of AV junction ablation. Twenty symptomatic AF patient (age of 60.5 ± 9.28 and 11 are females underwent conventional AV junction ablation. If 10 applications of radiofrequency energy are failed, then the ablation was performed by left-sided approach. Seventeen patients are successfully ablated by conventional approach. In 3 patients, conventional was failed but successfully ablated by left-sided approach. The His bundle amplitude at ablation site was significantly larger in left-sided than correspondence right-sided (16.0 ± 4.99 mm vs. 6.9 ± 4.02 mm respectively, p = 0.001, 95% CI -14.0 to -4.3. ROC analysis of His bundle potential amplitude recorded from right-sided revealed that cut off point of > 4.87 mm given the sensitivity of 81.3% and specificity of 53.8% for successful right-sided approach of AV junction ablation. In case of failed conventional approach, the left-sided approach is effective for AV junction ablation. An early switch to the left-sided approach may avoid multiple RF applications in patients with a low amplitude His-bundle potential (< 4.87 mm. (Med J Indones 2006; 15:109-14Keywords: Atrial fibrillation, AV junction ablation, left-sided approach

  16. Mygg och Bti i nedre Dalälven : Utvärdering av ett vetenskapligt uppföljningsprogram

    OpenAIRE

    Nilsson, Christer; Malm-Renöfält, Birgitta

    2009-01-01

    Denna rapport redovisar uppdraget att granska den vetenskapliga uppföljningen avmyggkontrollprogrammet i nedre Dalälven. Rapporten beskriver hur frågorna iuppföljningsprogrammet besvarats samt diskuterar relevansen av de frågor somingått i uppdraget. Det konstateras att den vetenskapliga uppföljningen av eventuellaeffekter av spridning av Bti brustit i försöksdesign och analys. Det insamladematerialet ger inte underlag för de slutsatser som dragits. De frågor som ingått iuppdraget har därmed ...

  17. Videodokumentasjon ved gjennomføring av praktisk eksamen i sykepleie - hvordan kan dette forbedre studentens praksiske ferdigheter?

    Directory of Open Access Journals (Sweden)

    Gjertrud Husøy

    2014-02-01

    Full Text Available Hensikten med studiet var å belyse hvordan videodokumentasjon av praktiske handlinger i sykepleie kunne brukes som evalueringordning av studenter. Artikkelen tar utgangspunkt i et forskningsprosjekt for utprøving av nye lærings og evalueringsformer i bachelorutdanningen i sykepleie, der 13 studentgrupper gjennomførte sin praktiske eksamen ved innlevering av video av 16 utvalgte øvelser. Tradisjonell praktisk eksamen i samme studentkull ble gjennomført for 10 studentgrupper. Prosjektet er en kvalitativ kasusstudie og analyse er gjort etter inspirasjon av Giorgi‘s empiriske fenomenologi. Diskusjonen tar utgangspunkt i Vygotsky‘s sosiokulturelle syn på læring og Dewey‘s prinsipp om at all læring er basert på erfaring. Funnene er presentert i følgende deler: Første del omhandler videodokumentasjon og refleksjon. De to neste delene viser funn i forhold til mesterlæring og situert læring på vei mot forståelse av hva sykepleie er. Deretter er teknisk utfordringer belyst, og til slutt en drøfting av forhold ved oppøving av praktiske sykepleieferdigheter. Konklusjonen her er at video egner seg til å dokumentere sykepleiehandlinger. Dette har størst verdi for læring og refleksjon, i mindre grad som eksamensform.

  18. Vannkjemisk og økologisk tilstand i sidevassdrag til Orkla. - Undersøkelser av vannkvalitet, bunndyr, yngel-/ungfisk og hydromorfologiske påvirkninger

    OpenAIRE

    Bergan, M.

    2011-01-01

    Det er foretatt vannkjemiske og biologiske undersøkelser i tilsammen 12 vannforekomster i Vannområde Orkla høsten 2010. Vannforekomstene er typifisert på bakgrunn av kalsiuminnhold og fargetall i henhold til ny vannforskrift. Det er foretatt en klassifisering og vurdering av vannkjemisk tilstand på bakgrunn av punktprøvenes innhold av fosfor, nitrogen, KOF og TKB. Økologisk tilstand er klassifisert ved bruk av bunndyr som kvalitetselement i 10 vannforekomster, der 9 av 10 har en tilstand som ...

  19. Hvor moralsk tenker fotballspillere? – en empirisk studie av toppfotball

    Directory of Open Access Journals (Sweden)

    Lars Tore Ødegård

    2015-11-01

    Full Text Available Det er en utbredt oppfatning at det økende prestasjonskravet i toppfotball fører til en svekkelse av moral og fair play-holdninger. Men hvordan tenker toppfotballspillere i forhold til ulike dilemmaer som oppstår på banen, og er det forskjeller mellom toppfotballspillere og spillere på lavere nivå?  For å avklare dette gjennomførte vi en empirisk undersøkelse der vi intervjuet spillere og trener i én toppklubb og én breddeklubb. Vi var interessert i to hovedproblemstillinger:  1 Hva tenker fotballspillere på ulike prestasjonsnivå om etikk og moralske dilemmaer i fotball? 2 Hvilke faktorer påvirker spillerne, direkte og indirekte, i deres vurderinger og handlinger? Resultatene fra undersøkelsen viser at det er store forskjeller mellom de to prestasjonsnivåene. Spillerne på breddenivået føler generelt et større ansvar for å opptre ærlig på banen enn hva som er tilfelle på toppnivået. Vi fant 4 spesifikke faktorer i toppfotballen som bidrar til umoralsk opptreden. For det første opplever spillerne en forventning om at de prioriterer resultat foran fair play. For det andre bidrar tilstedeværelsen av supportere på kamper til en slik prioritering. For det tredje vil handlinger som er i strid med fair play signaliseres som akseptable internt i miljøet, selv om de ofte signaliseres som uakseptable overfor media og omverdenen. For det fjerde kan spillere oppleve det som vanskelig å gå i mot trenerens oppfordringer til en pragmatisk og resultatfokusert opptreden.Nøkkelord: moral, etikk, fair play, footballEnglish summary: How morally do football players think? – an empirical study of moral dilemmas in elite footballIt is a common view that the increasing focus on achievement and success in elite football leads to a weakening of moral and fair play attitudes. But how do elite players think and what do they think about different dilemmas that appear on the field, and is there a difference between elite players and lower

  20. 18F-AV-1451 positron emission tomography in Alzheimer's disease and progressive supranuclear palsy.

    Science.gov (United States)

    Passamonti, Luca; Vázquez Rodríguez, Patricia; Hong, Young T; Allinson, Kieren S J; Williamson, David; Borchert, Robin J; Sami, Saber; Cope, Thomas E; Bevan-Jones, W Richard; Jones, P Simon; Arnold, Robert; Surendranathan, Ajenthan; Mak, Elijah; Su, Li; Fryer, Tim D; Aigbirhio, Franklin I; O'Brien, John T; Rowe, James B

    2017-03-01

    The ability to assess the distribution and extent of tau pathology in Alzheimer's disease and progressive supranuclear palsy in vivo would help to develop biomarkers for these tauopathies and clinical trials of disease-modifying therapies. New radioligands for positron emission tomography have generated considerable interest, and controversy, in their potential as tau biomarkers. We assessed the radiotracer 18F-AV-1451 with positron emission tomography imaging to compare the distribution and intensity of tau pathology in 15 patients with Alzheimer's pathology (including amyloid-positive mild cognitive impairment), 19 patients with progressive supranuclear palsy, and 13 age- and sex-matched controls. Regional analysis of variance and a support vector machine were used to compare and discriminate the clinical groups, respectively. We also examined the 18F-AV-1451 autoradiographic binding in post-mortem tissue from patients with Alzheimer's disease, progressive supranuclear palsy, and a control case to assess the 18F-AV-1451 binding specificity to Alzheimer's and non-Alzheimer's tau pathology. There was increased 18F-AV-1451 binding in multiple regions in living patients with Alzheimer's disease and progressive supranuclear palsy relative to controls [main effect of group, F(2,41) = 17.5, P AV-1451 binding was significantly increased in patients with Alzheimer's disease, relative to patients with progressive supranuclear palsy and with control subjects, in the hippocampus and in occipital, parietal, temporal, and frontal cortices (t's > 2.2, P's AV-1451 binding was elevated in the midbrain (t = 2.1, P AV-1451 uptake in the putamen, pallidum, thalamus, midbrain, and in the dentate nucleus of the cerebellum (t's > 2.7, P's AV-1451 strongly bound to Alzheimer-related tau pathology, but less specifically in progressive supranuclear palsy. 18F-AV-1451 binding to the basal ganglia was strong in all groups in vivo. Postmortem histochemical staining showed absence of

  1. Kjøring med mistanke om påvirkning av andre rusmidler enn alkohol

    Directory of Open Access Journals (Sweden)

    Asbjørg S. Christophersen

    2009-10-01

    Full Text Available  SAMMENDRAGStatens rettstoksikologiske institutt har i løpet av de siste år registrert en stor økning av prøver fra bilføreremistenkt for kjøring under påvirkning av andre rusmidler enn alkohol. Antall positive saker økte 42% fra1994 til 1995. De hyppigste påviste stoffer er tetrahydrocannabinol, amfetamin, benzodiazepiner og opiater(morfin/kodein. Bruk av tyngre narkotiske stoffer har blitt mer vanlig i trafikksammenheng og antall positivetilfeller har økt betydelig mer enn totalt antall saker. Fra 1994 til 1995 økte antall positive amfetaminprøvermed 75% (fra 533 til 937 og antall positive prøver som følge av heroininntak økte med 87% (fra 92 til 172.Bruk av flere stoffer samtidig er vanlig, over 60 % av sakene i 1995 var positive på mer enn ett stoff, alkoholikke medregnet. De fleste tilfeller var representert av menn i alderen 25-32 år (37%. Kvinner var representerti ca. 11% av sakene.Christophersen AS, Skurtveit S, Mørland J. Drivers suspected to drive under the influence of drugs otherthan alcohol. Nor J Epidemiol 1996; 6 (1: 45-48.ENGLISH SUMMARYThe National Institute of Forensic Toxicology has registered a large increase in the number of samples fromdrivers suspected to drive under influence of drugs other than alcohol. The number of drug positive casesincreased 42% from 1994 to 1995. The most frequent drugs detected are tetrahydrocannabinol, amphetamine,benzodiazepines and opiates (morphine/codeine. The frequency of hard narcotic drug use has increased morethan the total number of cases. From 1994 to 1995, the number of amphetamine positive samples increased75% (from 533 to 937 and the number of samples positive due to heroin use (detection of the metabolite 6-monoacetylmorphine in urine increased 87%. Multi-drug use is common and more than one drug wasdetected in more than 60% of the cases from 1995, alcohol not included. Most of the cases were representedby men 25-32 years old (37%. Women were represented in about

  2. Vorticity-divergence semi-Lagrangian global atmospheric model SL-AV20: dynamical core

    Science.gov (United States)

    Tolstykh, Mikhail; Shashkin, Vladimir; Fadeev, Rostislav; Goyman, Gordey

    2017-05-01

    SL-AV (semi-Lagrangian, based on the absolute vorticity equation) is a global hydrostatic atmospheric model. Its latest version, SL-AV20, provides global operational medium-range weather forecast with 20 km resolution over Russia. The lower-resolution configurations of SL-AV20 are being tested for seasonal prediction and climate modeling. The article presents the model dynamical core. Its main features are a vorticity-divergence formulation at the unstaggered grid, high-order finite-difference approximations, semi-Lagrangian semi-implicit discretization and the reduced latitude-longitude grid with variable resolution in latitude. The accuracy of SL-AV20 numerical solutions using a reduced lat-lon grid and the variable resolution in latitude is tested with two idealized test cases. Accuracy and stability of SL-AV20 in the presence of the orography forcing are tested using the mountain-induced Rossby wave test case. The results of all three tests are in good agreement with other published model solutions. It is shown that the use of the reduced grid does not significantly affect the accuracy up to the 25 % reduction in the number of grid points with respect to the regular grid. Variable resolution in latitude allows us to improve the accuracy of a solution in the region of interest.

  3. An av-RGD integrin inhibitor toolbox: drug discovery insight, challenges and opportunities.

    Science.gov (United States)

    Hatley, Richard; Macdonald, Simon; Slack, Robert; Le, Joelle; Ludbrook, Steve; Lukey, Pauline

    2017-09-25

    There is a requirement for efficacious and safe medicines to treat diseases with high unmet need. The resurgence in av RGD integrin inhibitor drug discovery is poised to contribute to this requirement. However, drug discovery in the av integrin space is notoriously difficult due to the receptors being structurally very similar as well as the polar zwitterionic nature of the pharmacophore. This review aims to guide drug discovery research in this field through an av inhibitor toolbox, consisting of small molecules and antibodies. Small molecule av tool compounds with extended profiles in avb1, 3, 5, 6 and 8 cell adhesion assays, with key physicochemical properties, have been collated to assist in the selection of the right tool for the right experiment. This should also facilitate an understanding of partial selectivity profiles of compounds generated in different assays across research institutions. Prospects for further av integrin research and the critical importance of target validation are discussed, where increased knowledge of the selectivity for individual RGD v integrins is key. Insights into the design of small molecule RGD chemotypes for topical or oral administration are provided and clinical findings on advanced molecules are examined. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Electrocardiographic and chronobiological features of paroxysmal AV block recorded by ambulatory electrocardiography.

    Science.gov (United States)

    Saito, Ken; Takeda, Shiho; Saito, Yuko; Kawamura, Mami; Yoshikawa, Yoko; Yano, Hayato; Sata, Masataka

    2014-01-01

    The goal of this study was to investigate the electrocardiographic and chronobio-logical features of paroxysmal atrioventricular (AV) block (PAVB) using data from ambulatory electrocardiography (AECG). The study population consisted of five men and six women aged from 47 to 82 years of age. Main presenting symptoms were pre-syncope in five patients (45.5%) and syncope in three patients (27.3%). Organic cardiovascular diseases were seen in eight patients (72.7%), and AV conduction disturbances were seen in six patients (54.5%), such as right bundle branch block, first to second degree AV block on standard 12-lead electrocardiography. Incidence of PAVB events were 1-329 (37.9 ± 98.0) episodes/patient/day, and the maximum pause during Holter recordings was 3.3-12.4 (6.39 ± 3.09) seconds. This maximum pause caused by intrinsic AV block was longer than that of vagally mediated AV block (8.4 ± 3.2 sec vs 4.7 ± 1.0 sec, p<0.05). In chronobiological analysis, episodes of PAVB exhibited a circadian rhythm characterized by a peak between 2:00 am and 4:00 am and a trough between 0:00 pm and 2:00 pm. AECG is a useful tool to detect the maximum pause occurring during sleep and provides critical data necessary to prevent the sudden cardiac death caused by PAVB.

  5. sugE: A gene involved in tributyltin (TBT) resistance of Aeromonas molluscorum Av27.

    Science.gov (United States)

    Cruz, Andreia; Micaelo, Nuno; Félix, Vitor; Song, Jun-Young; Kitamura, Shin-Ichi; Suzuki, Satoru; Mendo, Sónia

    2013-01-01

    The mechanism of bacterial resistance to tributyltin (TBT) is still unclear. The results herein presented contribute to clarify that mechanism in the TBT-resistant bacterium Aeromonas molluscorum Av27. We have identified and cloned a new gene that is involved in TBT resistance in this strain. The gene is highly homologous (84%) to the Aeromonas hydrophila-sugE gene belonging to the small multidrug resistance gene family (SMR), which includes genes involved in the transport of lipophilic drugs. In Av27, expression of the Av27-sugE was observed at the early logarithmic growth phase in the presence of a high TBT concentration (500 μM), thus suggesting the contribution of this gene for TBT resistance. E. coli cells transformed with Av27-sugE become resistant to ethidium bromide (EtBr), chloramphenicol (CP) and tetracycline (TE), besides TBT. According to the Moriguchi logP (miLogP) values, EtBr, CP and TE have similar properties and are substrates for the sugE-efflux system. Despite the different miLogP of TBT, E. coli cells transformed with Av27-sugE become resistant to this compound. So it seems that TBT is also a substrate for the SugE protein. The modelling studies performed also support this hypothesis. The data herein presented clearly indicate that sugE is involved in TBT resistance of this bacterium.

  6. Gjenstand for saksbehandling og verdi som dokumentasjon – analyse av journalføringskriteriene i arkivforskriften

    Directory of Open Access Journals (Sweden)

    Trine Nesland

    2014-11-01

    Full Text Available Artikkelen handler om hvordan journalføringskriteriene «gjenstand for saksbehandling» og «verdi som dokumentasjon» er ment å skulle forstås, basert på hvordan kriteriene er omtalt og definert i eksisterende teori og litteratur.Artikkelen viser at det ikke eksisterer en omforent forståelse av kriterienes innhold, det vil si at kriteriene er tillagt ulik betydning i ulike tekster. Det har tegnet seg et bilde av at de relativt få tekstene som faktisk inneholder beskrivelser av journalføringskriteriene og begrepene kriteriene er bygget opp av, i hovedsak nærmer seg kriteriene enten på en dialektisk-relasjonell eller på en semiotisk-relasjonell måte, hvilket gir to tilsynelatende ulike tolkningsresultater. Det foreligger med andre ord en viss tolkningsmotstrid, hvilket nødvendigvis innebærer at det fortsatt er vanskelig å svare entydig på spørsmålet om hvordan journalføringskriteriene er ment å skulle forstås, og samtidig gir grunn til kritikk av det etablerte systemet.

  7. Context-Aware UPnP-AV Services for Adaptive Home Multimedia Systems

    Directory of Open Access Journals (Sweden)

    Roland Tusch

    2008-01-01

    Full Text Available One possibility to provide mobile multimedia in domestic multimedia systems is the use of Universal Plug and Play Audio Visual (UPnP-AV devices. In a standard UPnP-AV scenario, multimedia content provided by a Media Server device is streamed to Media Renderer devices by the initiation of a Control Point. However, there is no provisioning of context-aware multimedia content customization. This paper presents an enhancement of standard UPnP-AV services for home multimedia environments regarding context awareness. It comes up with context profile definitions, shows how this context information can be queried from the Media Renderers, and illustrates how a Control Point can use this information to tailor a media stream from the Media Server to one or more Media Renderers. Moreover, since a standard Control Point implementation only queries one Media Server at a time, there is no global view on the content of all Media Servers in the UPnP-AV network. This paper also presents an approach of multimedia content integration on the Media Server side that provides fast search for content on the network. Finally, a number of performance measurements show the overhead costs of our enhancements to UPnP-AV in order to achieve the benefits.

  8. Brain uptake of a non-radioactive pseudo-carrier and its effect on the biodistribution of [(18)F]AV-133 in mouse brain.

    Science.gov (United States)

    Wu, Xianying; Zhou, Xue; Zhang, Shuxian; Zhang, Yan; Deng, Aifang; Han, Jie; Zhu, Lin; Kung, Hank F; Qiao, Jinping

    2015-07-01

    9-[(18)F]Fluoropropyl-(+)-dihydrotetrabenazine ([(18)F]AV-133) is a new PET imaging agent targeting vesicular monoamine transporter type II (VMAT2). To shorten the preparation of [(18)F]AV-133 and to make it more widely available, a simple and rapid purification method using solid-phase extraction (SPE) instead of high-pressure liquid chromatography (HPLC) was developed. The SPE method produced doses containing the non-radioactive pseudo-carrier 9-hydroxypropyl-(+)-dihydrotetrabenazine (AV-149). The objectives of this study were to evaluate the brain uptake of AV-149 by UPLC-MS/MS and its effect on the biodistribution of [(18)F]AV-133 in the brains of mice. The mice were injected with a bolus including [(18)F]AV-133 and different doses of AV-149. Brain tissue and blood samples were harvested. The effect of different amounts of AV-149 on [(18)F]AV-133 was evaluated by quantifying the brain distribution of radiolabelled tracer [(18)F]AV-133. The concentrations of AV-149 in the brain and plasma were analyzed using a UPLC-MS/MS method. The concentrations of AV-149 in the brain and plasma exhibited a good linear relationship with the doses. The receptor occupancy curve was fit, and the calculated ED50 value was 8.165mg/kg. The brain biodistribution and regional selectivity of [(18)F]AV-133 had no obvious differences at AV-149 doses lower than 0.1mg/kg. With increasing doses of AV-149, the brain biodistribution of [(18)F]AV-133 changed significantly. The results are important to further support that the improved radiolabelling procedure of [(18)F]AV-133 using an SPE method may be suitable for routine clinical application. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. The Unusual Resistance of Avian Defensin AvBD7 to Proteolytic Enzymes Preserves Its Antibacterial Activity

    Science.gov (United States)

    Bailleul, Geoffrey; Kravtzoff, Amanda; Joulin-Giet, Alix; Lecaille, Fabien; Labas, Valérie; Meudal, Hervé; Loth, Karine; Teixeira-Gomes, Ana-Paula; Gilbert, Florence B.; Coquet, Laurent; Jouenne, Thierry; Brömme, Dieter; Schouler, Catherine; Landon, Céline; Lalmanach, Gilles; Lalmanach, Anne-Christine

    2016-01-01

    Defensins are frontline peptides of mucosal immunity in the animal kingdom, including birds. Their resistance to proteolysis and their ensuing ability to maintain antimicrobial potential remains questionable and was therefore investigated. We have shown by bottom-up mass spectrometry analysis of protein extracts that both avian beta-defensins AvBD2 and AvBD7 were ubiquitously distributed along the chicken gut. Cathepsin B was found by immunoblotting in jejunum, ileum, caecum, and caecal tonsils, while cathepsins K, L, and S were merely identified in caecal tonsils. Hydrolysis product of AvBD2 and AvBD7 incubated with a panel of proteases was analysed by RP-HPLC, mass spectrometry and antimicrobial assays. AvBD2 and AvBD7 were resistant to serine proteases and to cathepsins D and H. Conversely cysteine cathepsins B, K, L, and S degraded AvBD2 and abolished its antibacterial activity. Only cathepsin K cleaved AvBD7 and released Ile4-AvBD7, a N-terminal truncated natural peptidoform of AvBD7 that displayed antibacterial activity. Besides the 3-stranded antiparallel beta-sheet typical of beta-defensins, structural analysis of AvBD7 by two-dimensional NMR spectroscopy highlighted the restricted accessibility of the C-terminus embedded by the N-terminal region and gave a formal evidence of a salt bridge (Asp9-Arg12) that could account for proteolysis resistance. The differential susceptibility of avian defensins to proteolysis opens intriguing questions about a distinctive role in the mucosal immunity against pathogen invasion. PMID:27561012

  10. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    GintasView ver 1.3 includes the possibility for time tagging using a mobile device. After simulation the time tagged file is exported to the AV software on the laptop and appears as an integrated video feed/timeline. Conclusions We have found that it is possible to deliver multi-camera video assisted......In situ simulation is simulation done in the actual clinical environment exceeding the simulation immersion compared to that of the embedded simulation centers and facilitating an increased realistic learning experience. Doing this without compromising (all) the educational principals used...... in simulation centers, we sought to include an audio-visual (AV) system for video assisted debriefing (VAD). The difference being that components must be portable and adaptable to a range of clinical environments. A mobile AV system would ideally feature: • Multi camera video capture capability. • Time tagging...

  11. Kvinnans upplevelser under tredje trimestern av sin första graviditet

    OpenAIRE

    Oscarsson, Nathalie

    2011-01-01

    Syftet med studien var att nå en djupare förståelse i hur kvinnan upplever sin första graviditet. Det teoretiska perspektivet var Katie Erikssons ontologiska hälsomodell där ”hälsa som görande- varande-vardande” har används. Designen är kvalitativ och som metod har innehållsanalys används. Materialet består av fem böcker, där kvinnor skriver om sina upplevelser om graviditeten. Frågeställning: Hur upplever kvinnan slutskedet av sin första graviditet? Studien är deduktiv i av...

  12. Samling, sökning och visualisering av loggfiler från testenheter

    OpenAIRE

    Rosenqvist, Fredrik; Henriksson, Thomas

    2015-01-01

    Idag genererar företag stora mängder av loggfiler vilket gör det svårt att hitta och undersöka felmeddelanden i alla loggfiler. En loggsamlare med Logstash, Elasticsearch och Kibana som bas har implementerats hos Ericsson Linköping. Loggsamlarens syfte är att samla loggar från testenheter och möjliggöra sökning och visualisering av dem. En utvärdering av Elasticsearch har genomförts för att se i vilken grad söktiden för sökfrågor ökar med ökad datamängd. Utvärderingen gav en indikation om att...

  13. Utvärdering av arbetsmiljön på en träbränslemottagning : En studie om spridning av trämögelsporer

    OpenAIRE

    Svensson-Höök, Anders

    2015-01-01

    Karlstads Energi AB:s vågstation vid Hedenverket i Karlstad är en anläggning där invägning och analys av träbränsle utförs. Provtagning och hantering av träbränsle hör till de dagliga arbetsuppgifterna för personalen. Vid nära hantering av trämaterial finns risken att exponeras för trämögelsporer. Exponering av mikrobiologiska luftföroreningar kan orsaka hälsobesvär på lungor och luftvägar hos människor. Efter utförd riskbedömning av vågstationen noterades en oro att trämögelsporer och dammpa...

  14. Multinational evaluation of the interpretability of the iterative method of optimisation of AV delay for CRT.

    Science.gov (United States)

    Raphael, Claire E; Kyriacou, Andreas; Jones, Siana; Pabari, Punam; Cole, Graham; Baruah, Resham; Hughes, Alun D; Francis, Darrel P

    2013-09-20

    AV delay optimisation of biventricular pacing devices (cardiac resynchronisation therapy, CRT) is performed in trials and recommended by current guidelines. The Doppler echocardiographic iterative method is the most commonly recommended. Yet whether it can be executed reliably has never been tested formally. 36 multinational specialists, familiar with using the echocardiographic iterative method of CRT optimisation, were shown 20-40 sets of transmitral Doppler traces at 6-8 AV settings and asked to select the optimal AV delay. Unknown to the specialists, some Doppler datasets appeared in duplicate, allowing assessment of both inter and intra-specialist interpretation. On the Kappa scale of agreement (1 = perfect agreement, 0 = chance alone), the agreement regarding optimal AV delay between specialists was poor (kappa=0.12 ± 0.08). More importantly, agreement of specialists with themselves (i.e. viewing identical sets of traces, twice) was also poor, with Kappa=0.23 ± 0.07 and mean absolute difference in optimum AV delay of 83 ms between first and second viewing of the same traces. Iterative AV optimisation is not executed reliably by experts, even in an artificially simplified context where biological variability and variation in image acquisition are eliminated by use of identical traces. This cannot be blamed on insufficient skills of some experts or discordant methods of selecting the optimum, because operators also showed poor agreement with themselves when assessing the same trace. Instead, guidelines should retract any recommendation for this algorithm. Guideline-development processes might usefully begin with a rudimentary check on proposed algorithms, to establish at least minimal credibility. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  15. AV-1451 tau and β-amyloid positron emission tomography imaging in dementia with Lewy bodies.

    Science.gov (United States)

    Kantarci, Kejal; Lowe, Val J; Boeve, Bradley F; Senjem, Matthew L; Tosakulwong, Nikki; Lesnick, Timothy G; Spychalla, Anthony J; Gunter, Jeffrey L; Fields, Julie A; Graff-Radford, Jonathan; Ferman, Tanis J; Jones, David T; Murray, Melissa E; Knopman, David S; Jack, Clifford R; Petersen, Ronald C

    2017-01-01

    Patients with probable dementia with Lewy bodies (DLB) often have Alzheimer's disease (AD)-related pathology. Our objective was to determine the pattern of positron emission tomography (PET) tau tracer AV-1451 uptake in patients with probable DLB, compared to AD, and its relationship to β-amyloid deposition on PET. Consecutive patients with clinically probable DLB (n = 19) from the Mayo Clinic Alzheimer's Disease Research Center underwent magnetic resonance imaging, AV-1451, and Pittsburgh compound-B (PiB) PET examinations. Age- and sex-matched groups of AD dementia (n = 19) patients and clinically normal controls (n = 95) from an epidemiological cohort served as a comparison groups. Atlas- and voxel-based analyses were performed. The AD dementia group had significantly higher AV-1451 uptake than the probable DLB group, and medial temporal uptake completely distinguished AD dementia from probable DLB. Patients with probable DLB had greater AV-1451 uptake in the posterior temporoparietal and occipital cortex compared to clinically normal controls, and in probable DLB, the uptake in these regions correlated with global cortical PiB uptake (Spearman rho = 0.63; p = 0.006). Medial temporal lobe AV-1451 uptake distinguishes AD dementia from probable DLB, which may be useful for differential diagnosis. Elevated posterior temporoparietal and occipital AV-1451 uptake in probable DLB and its association with global cortical PiB uptake suggest an atypical pattern of tau deposition in DLB. ANN NEUROL 2017;81:58-67. © 2016 The Authors. Annals of Neurology published by Wiley Periodicals, Inc. on behalf of American Neurological Association.

  16. Litterær kompetanse - portrett av tre lesarar

    Directory of Open Access Journals (Sweden)

    Hallvard Kjelen

    2015-08-01

    Full Text Available Artikkelen drøfter eit sentralt problemfelt innom litteraturdidaktikken, nemleg tilhøvet mellom litterær lesing som fagleg kompetanse og litterær lesing som oppleving. Problemfeltet er særleg knytt til Louise Rosenblatts arbeid. Ho viser ved hjelp av omgrepa efferent og estetisk lesing korleis det er ei utfordring for litteraturlæraren å utvikle ei litteraturundervisning som i tilstrekkeleg grad tek omsyn til kjensler og røynsler. I ein litteraturteoretisk kontekst er subjektive responsar på litterære tekstar irrelevante, men i ein litteraturdidaktisk kontekst er subjektive responsar høgst relevante. Denne artikkelen bidrar inn i diskusjon-en mellom anna ved å trekkje inn meir empirisk basert litteraturteori som referanseramme. Artikkelen presenterer tre lesarars litterære responsar, og viser korleis kunnskap om individuelle lesarresponsar kan vere utgangspunkt for ei litteraturundervisning som balanserer ei fagleg tilnærming til litteratur opp mot ei meir opplevingsbasert tilnærming.Emneord: Litteraturundervisning, litterær kompetanse, empirisk litteraturteori, lesarresponsAbstractThe article discusses a key issue in literature didactics, namely the relation between literary reading as an academic competence, and literary reading as an experience. The discussion draws heavily on Louise Rosenblatt’s work. By using the concepts efferent and aesthetic reading, she shows how it is a challenge for the teacher of literature to develop literature teaching that adequately takes emotions and experience into account. In a literature-theoretical context, subjective responses to literary texts are irrelevant; but in a didactics context, the subjective responses are highly relevant.  This article contributes to the discussion by bringing in a more empirically based literature theory as a frame of reference. The article presents three readers’ literary responses, and shows how knowledge of individual reader responses can be the basis for

  17. 76 FR 3391 - Endangered and Threatened Wildlife and Plants; Endangered Status for the Sheepnose and...

    Science.gov (United States)

    2011-01-19

    ... Interior Fish and Wildlife Service 50 CFR Part 17 Endangered and Threatened Wildlife and Plants; Endangered... Wildlife Service 50 CFR Part 17 RIN 1018-AV93 Endangered and Threatened Wildlife and Plants; Endangered... endangered under the Endangered Species Act of 1973, as amended (Act). If we finalize this rule as...

  18. 77 FR 41400 - AV Solar Ranch 1, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request...

    Science.gov (United States)

    2012-07-13

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AV Solar Ranch 1, LLC; Supplemental Notice That Initial Market- Based Rate...-referenced proceeding of AV Solar Ranch 1, LLC's application for market-based rate authority, with an...

  19. Norsk pelsdyrhold – bærekraftig utvikling eller styrt avvikling? — Gjennomgang av pelsdyrnæringen

    DEFF Research Database (Denmark)

    Hamre, Anne Karin; Steine, Torstein; Tveito, Guri

    2014-01-01

    Utvalget for gjennomgang av pelsdyrnæringen i Norge ble oppnevnt ved kongelig resolusjon 4. oktober 2013. Utvalget gir med dette sin utredning.......Utvalget for gjennomgang av pelsdyrnæringen i Norge ble oppnevnt ved kongelig resolusjon 4. oktober 2013. Utvalget gir med dette sin utredning....

  20. Pseudobegivenheter i nyhetsmediene : Hvilke faktorer påvirker publiseringen av arrangerte PR-nyheter?

    OpenAIRE

    2013-01-01

    I 1961 navngav den amerikanske kulturhistorikeren Daniel J. Boorstin et fenomen han kalte «pseudobegivenheter». Pseudobegivenheter er arrangerte begivenheter som først og fremst er tilrettelagt for mediedekning. Denne masteroppgavens tar for seg hvilke faktorer som påvirker publiseringen av slike arrangerte PR-nyheter i nyhetsmediene. De relevante faktorene ble funnet gjennom grundige undersøkelser av tre forskningsspørsmål med vekt på hvilke nyhetsverdier som har betydning for publiseringen,...

  1. Rate-adaptive AV delay and exercise performance following cardiac resynchronization therapy.

    Science.gov (United States)

    Shanmugam, Nesan; Prada-Delgado, Oscar; Campos, Ana Garcia; Grimster, Alex; Valencia, Oswaldo; Baltabaeva, Aigul; Jones, Sue; Anderson, Lisa

    2012-11-01

    Physiological shortening of the atrioventricular (AV) interval with increasing heart rate is well documented in normal human beings and is an established component of dual-chamber pacing for bradycardia. To assess the effect of exercise on optimal AV delay and the impact of a patient-specific rate-adaptive AV delay (RAAVD) on exercise capacity in patients with heart failure following cardiac resynchronization therapy. Phase 1: We performed iterative AV optimization at rest and exercise in 52 cardiac resynchronization therapy patients in atrial-sensed mode (mean age 71.6 ± 9.2 years, 25% females). Phase 2: Subsequently, 20 consecutive volunteers from this group (mean age 69.2 ± 9.6 years, 15% females) underwent cardiopulmonary exercise testing with RAAVD individually programmed ON (RAAVD-ON) or OFF (RAAVD-OFF). Phase 1: In 94% of the patients, there was a marked reduction (mean 50%) in optimal AV delay with exercise. The optimal resting vs exercise AV delay was 114.2 ± 29 ms at a heart rate of 64.4 ± 7.1 beats/min vs 57 ± 31 ms at a heart rate of 103 ± 13 beats/min (P AV delay with exercise, and 3 (6%) showed no change. Phase 2: With RAAVD-ON, significantly better exercise times were achieved (8.7 ± 3.2 minutes) compared with RAAVD-OFF (7.9 ± 3.2 minutes; P = .003), and there was a significant improvement in Vo(2)max (RAAVD-ON 16.1 ± 4.0 vs RAAVD-OFF 14.9 ± 3.7 mL/(kg · min); P = .024). There was a dramatic reduction in optimal AV delay with physiological exercise in the majority of this heart failure cardiac resynchronization therapy cohort. Replicating this physiological response with a programmable RAAVD translated into a 10% improvement in exercise capacity. Copyright © 2012 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  2. Framtagning av ny lyftytrystning för gasturbin SGT-600/700

    OpenAIRE

    Sjöberg, Emma

    2008-01-01

    I detta Examensarbete har en ny lyftutrustning till gasturbin SGT-600/700 olika moduler tagits fram. Examensarbetet har utförts på Siemens Industrial Turbomachinery AB i Finspång på avdelningen GPTP (leverans gasturbin teknik package installation). Målet med arbetet har varit att skapa en lyftutrustning som är mer flexibel än den befintliga lyftutrustningen och klarar samlyft (lyft med hjälp av två kranar). Arbetet har utförts med hjälp av olika metoder som QFD, funktionsmedel-träd och morpho...

  3. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    Directory of Open Access Journals (Sweden)

    Arne Rognmo

    2013-03-01

    Full Text Available Forsøkene (viste at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre første ukene etter kalving. Det ble heller ikke på noe punkt funnet signifikante forskjeller gruppene imellom når det gjelder kalvenes klimatiske toleranse. Det er dog bemerkelsesverdig at det var stor dødelighet blant de små kalvene etter unge små simler i GRUPPE L. Dette funn er interessant sett i sammenheng med resultatene fra Røros (se bidrag fra Dag Lenvik, side som viser at avkastningen fra en flokk kan økes markant om man konsentrerte slakteuttaket på små kalver og forhindrer bedekning av små, unge simler gjennom fjerning av eldre, store bukker. Med det forbehold at våre forsøk er utført på dyr i innhegning med et lavt aktivitetsnivå, kan man fra våreforsøk foreløpig konkludere med at tillegsfor ing av simler i siste halvdel av drektighetsperioden har effekt på kalvenes fødselsvekt, men at vektutviklingen for kalven er uavhengig av simlenes ernæringshistorie, om sistnevnte tilbys høyverdig ernæring etter kalving. Da små kalver etter underernærte simler viste høy dødelighet like etter fødselen, vil imidlertid tilleggsforing kunne øke avkastningen om det er mange unge simler i flokken. Resultatene fra Røros tyder imidlertid på at dette resultat normalt kan oppnås uten ekstra omkostninger gjennom et selektivt slakteuttak.

  4. Kriminalromanen: En undersøkelse av dens popularitet og kvalitet

    OpenAIRE

    Hopland, Maria Lüpke

    2013-01-01

    De siste årene har kriminalromanen oppnådd enorm popularitet hos det norske publikum. Samtidig blir den til tider svært hardt angrepet av akademikere og intellektuelle i dagspressen. Denne oppgaven utforsker forskjellene i denne mottakelsen. To forskjellige teoretiske tilnærminger ser ut til å bli brukt i lesningen og forståelsen av kriminalromanen. Den ene forstår kriminalromanen som en type formellitteratur, som har som mål å følge sin formel på best mulig måte, mens de...

  5. Når eplet faller langt fra stammen ... : en studie av voksne utenlandsadopterte i Norge

    OpenAIRE

    Rasmussen, Mariann

    2000-01-01

    Utenlandsadopsjon er et tema som stort sett har blitt drøftet og undersøkt i forhold til foreldre og barn. Ettersom den første generasjonen av adopterte nå har blitt voksne er det verdifull kunnskap å hente ut fra deres egne erfaringer og tanker rundt det å være adoptert. Det viser seg at deres formidling av erfaringer kan være med på å sette utenlandsadopsjon i et nytt perspektiv og rette fokus mot problemstillinger som ikke har blitt gitt så mye oppmerksomhet tidligere. Jeg har vært i ...

  6. Kilgore Trout - He Tried : en tematisk analyse av Kilgore Trouts rolle i forfatterskapet til Kurt Vonnegut

    OpenAIRE

    Glomsrød, Jannicke Storm

    2007-01-01

    Hvilke roller og funksjoner innehar Kilgore Trout-karakteren i Kurt Vonneguts forfatterskap? Hvilken betydning har han og hva ligger til grunn for denne gjennomgangsfigurens ankomst og endelige avgang i litteraturen? I denne oppgaven søker jeg å undersøke og finne svaret på disse spørsmålene. Kilgore Trout går igjen i syv av Vonneguts fjorten romaner og er en gjennomgangsfigur i drøye 32 år av dennes forfatterskap, som strekker seg over 53 år med Player Piano fra 1952 i den ene enden og A ...

  7. Correlliansk Wicca -En analyse av et nyreligiøst trossamfunn i vekst-

    OpenAIRE

    Johansen, Monica Frankrig

    2015-01-01

    Correlliansk wicca er en tradisjon innenfor wicca som baserer sin praksis på læren til High- Correll familien. Den correllianske wicca- tradisjonen ble grunnlagt av Caroline High- Correll. Correllianere anser seg selv for å være åpne for mange ulike livssyn og praksiser. De tror at det guddommelige kommer innenfra oss selv, og at religion eksisterer for å hjelpe oss til å finne det guddommelige i hver av oss, og ikke for å forsøke å erstatte denne guddommeligheten. Correllianere mener at alle...

  8. Gaskromatografisk metod för analys av GHB i urin

    OpenAIRE

    2009-01-01

    En metod för detektering och kvantifiering av gamma-hydroxysmörsyra (GHB) i urin med gaskromatografi (GC) är framtagen på Sahlgrenska universitetssjukhuset. Metoden är relativt unik då den inte kräver upparbetning i form av derivatisering, indunstning eller extraktion. Urinen surgörs med koncentrerad saltsyra och internstandard, gamma-valerolakton, tillsätts. GHB övergår då till laktonformen, gamma-butyrolakton (GBL). Därefter injiceras provet direkt på en GC-FID med en kapillärkolonn för gly...

  9. Overvåking av Tokke-Vinje-vassdraget 2009-2011

    OpenAIRE

    Kaste, Ø.; Skancke, L.; Eriksen, T.; Kile, M.; Nylend, Anne

    2012-01-01

    Rapporten viser resultater fra vanndirektiv-relatert overvåking i 2009-2011 i Tokke-Vinje-vassdraget i Telemark. Omfanget av overvåkingen har variert mellom årene, men kvalitetselementene planteplankton, dyreplankton, påvekstalger og bunndyr, samt vannkjemiske og bakteriologiske støtteparametre har inngått i minst ett av årene. Målet med overvåkingen var å klassifisere tilstanden i utvalgte vannforekomster i forhold til vanndirektivets bestemmelser, samt identifisere lokaliteter hvor det er b...

  10. Implementering av NSAID-profylakse mot post-ERCP pankreatitt - et kvalitetsforbedringsprosjekt ved Gastrolab, Drammen sykehus

    OpenAIRE

    Brummenæs, Kristine Aase; Dahl, Kamilla Haug; Giske, Anna Havnevik; Hovind, Magrit Jarlsdatter; Nordberg, Eva Kibsgaard; Xalid, Mahabad

    2014-01-01

    Bakgrunn: Bakgrunn for valg av oppgave var spørsmålet om pankreatitt som komplikasjon til ERCP (endoskopisk retrograd cholangiopankreatografi) kunne forebygges svært enkelt med en engangsdose NSAID gitt i forbindelse med prosedyren. Selv om pasientgruppen som årlig gjennomgår ERCP er liten, og komplikasjoner relativ sjelden, kan noen av disse likevel bli svært alvorlig og i verste fall livstruende. Kunnskapsgrunnlaget/Metode: Det ble gjort søk i McMasterPlus, PubMed, og retningslinjer. Innfør...

  11. Kartlegging og overvåking av eremitt Osmoderma eremita i Norge 2012

    OpenAIRE

    Endrestøl, Anders; Flåten, Magne*; Hanssen, Oddvar

    2013-01-01

    Eremitten Osmoderma eremita er en stor, brunsvart bille i familien skarabider. Den lever i gamle, hule løvtrær og er vurdert som truet i store deler av Europa. I Norge ble den antatt å være utdødd inntil den ble gjenfunnet i Tønsberg i 2008. Den er listet i kategori kritisk truet (CR) i Norsk rødliste for arter 2010, og er en prioritert art (fredet) i Norge. I tillegg er den vurdert som nær truet (NT) på global rødliste. Handlingsplanen for eremitt ble publisert av Direktoratet fo...

  12. Byte av kommunikationsstrategi när nationsobligatoriet faller : En fallstudie av hur nationerna i Uppsala bör agera om nationsobligatoriet faller

    OpenAIRE

    Rantakokko, Elin

    2008-01-01

    Abstract Title: Change of communication strategy when the compulsory nation membership falls (Byte av kommunikationsstrategi när nationsobligatoriet faller) Number of pages: 51 (58 including enclosures) Author: Elin Rantakokko Tutor: Peder Hård af Segerstad Course: Media and Communication Studies 30 hp Period: Spring of 2008 University: Division of Media and Communication, Department of Information Science, Uppsala University Purpose/Aim: This essay will result in some guidelines how the nati...

  13. Påvising og karakterisering av PGE2 reseptorar med omsyn på regulering av matriks metalloproteinasar frå osteosarkomcellelinjer

    OpenAIRE

    Oma, Hildegunn

    2007-01-01

    Enkelte kroniske inflammatoriske sjukdommar er kjent å disponere for utvikling av kreft. Ettersom fleire COX-2 hemmarar har synt kjemoterapeutisk effekt er det skapt stor interesse kring PGE2 si generelle rolle, og relevans i høve til kreft. PGE2 regulerer ei rekkje cellulære prosessar gjennom binding til fire prostaglandin E reseptorar (EP reseptorar). Matriks metalloproteinsar (MMPar) er ei gruppe enzym som er vist å vere involvert mellom anna ved tumorinvasjon, metastasering og angiogense....

  14. Efficient production of automotive biofuels; Effektiv produktion av biodrivmedel

    Energy Technology Data Exchange (ETDEWEB)

    Gode, Jenny; Hagberg, Linus; Rydberg, Tomas; Raadberg, Henrik; Saernholm, Erik

    2008-07-01

    The report describes opportunities and consequences associated with biomass polygeneration plants, in particular the role that heat plants (HP) or combined heat and power plants (CHP) in district heating systems can play in the production of automotive biofuels. The aim of the report is to provide a knowledge base to stakeholders to help assess energy and environmental benefits associated with collaborative approaches in planning, constructing and operating energy plants. Several configurations are possible for an energy polygeneration plant, but this report focuses on configurations in which a plant for automotive biofuel production and a district heating system with HPs or CHPs have been integrated in some way in order to achieve added value. The modes of integration are several, e.g.: - Supply of process steam from the CHP to the fuel plant, by which the time of operation for the CHP can be extended; Supply of surplus heat from the fuel plant to the district heating system; Material exchange between the systems, by use of residue streams from the fuel plant as fuel in the HP/CHP; Surplus heat from the fuel plant used for drying of the solid fuel to the HP/CHP or for drying of raw material for pellets production; Co-location providing opportunities for shared infrastructure for raw material handling, service systems, utilities and/or logistics. The report principally addresses integration options of the first three types, but describes briefly also pellets production. The starting point for the analysis of integration options is the description of technologies of interest for the production of automotive biofuels. Commercially available technologies are of prime interest, but also a couple of technologies under development are included in this part of the study. In addition to outlining the process characteristics for these processes, surrounding conditions and system requirements are briefly outlined. The results are summarized in Table S1. Ethanol fermentation

  15. Design of alarm systems in Swedish nuclear power plants; Utformning av larmsystem i svenska kaernkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Thunberg, Anna; Osvalder, Anna-Lisa (Dept. of Product and Production Development, Chalmers Univ. of Technology, Goeteborg (Sweden))

    2008-04-15

    Research within the area of improving alarm system design and performance has mainly focused on new alarm systems. However, smaller modernisations of legacy systems are more common in the Swedish nuclear industry than design of totally new systems. This imposes problems when the new system should function together with the old system. This project deals with the special concerns raised by modernisation projects. The objective of the project has been to increase the understanding of the relationship between the operator's performance and the design of the alarm system. Of major concern has been to consider the cognitive abilities of the operator, different operator roles and work situations, and varying need of information. The aim of the project has been to complement existing alarm design guidance and to develop user-centred alarm design concepts. Different case studies have been performed in several industry sectors (nuclear, oil refining, pulp and paper, aviation and medical care) to identify best practice. Several empirical studies have been performed within the nuclear area to investigate the operator's need of information, performance and workload in different operating modes. The aspect of teamwork has also been considered. The analyses show that the operator has different roles in different work situations which affect both the type of information needed and how the information is processed. In full power operation, the interaction between the operator and the alarm system is driven by internal factors and the operator tries to maintain high situation awareness by actively searching for information. The operator wants to optimise the process and need detailed information with possibilities to follow-up and get historical data. In disturbance management, the operator is more dependent on external information presented by the alarm system. The new compilation of alarm guidance is based on the operator's varying needs in different working situations and is applicable in modernisation projects. The division of the guidelines has been performed according to which part of human-machine-interaction they touch upon (e.g., control room layout, user interface design, navigation or support function) and in which design stage (e.g. conceptual design or detailed design) they are relevant. The results indicate that general guidelines (e.g. use a documented alarm philosophy) are very important to consider and define to ensure consistency between different modernisation projects. Further, the requirement on consistency can override detailed guidance on e.g. colour coding or font size. The operators in the control room should experience the system as one system. In connection to modernisations it is also of outmost importance to consider the operator's existing knowledge and experience. The guidelines have been used for the development of a new alarm design concept. The new concept tries to indicate relevant information clearer than existing systems; it integrates information to a larger extent and has better connections between events, objects, alarms, and procedures. The developed concept should be evaluated and validated by operators in usability tests. The most important aspects to consider in modernisation projects are: - Future systems must be more flexible and offer possibilities to adapt to varying needs of information in different operational modes and work situations. - The cognitive and physical abilities of the operator should not be exceeded. - Reliable work procedures acquired by practice are difficult to change and should be retained. Tasks performed often and/or in quiet conditions should be changed to obtain higher efficiency. - The alarm system should be well integrated in the overall instrumentation and control system in the control room. - A documented alarm philosophy is needed to ensure consistency between different projects. - The alarm system should guide the operator to the relevant information and should facilitate early detection of deviations. - Every alarm should require a response

  16. Evaluation of a small-scale wind power plant; Utvaerdering av smaaskaligt vindkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Arvidsson, Ulf; Hilding, Sten [Elforsk AB, Stockholm (Sweden)

    2001-12-01

    The aim of this work is to evaluate the electrical performance of the 20 kW Pitch Wind turbine. The work was originally intended to focus on evaluating the first machine in a series of three, which should be a machine ready for series production. However, the control system of the machine was not tested and verified so instead a large part of the work has been to check that the electrical system and the control system operates as intended and to adjust and suggest improvements. The design includes a self-regulating variable speed wind turbine coupled to a permanent magnet generator and a converter.

  17. Design of alarm systems in Swedish nuclear power plants; Utformning av larmsystem i svenska kaernkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Thunberg, Anna; Osvalder, Anna-Lisa (Dept. of Product and Production Development, Chalmers Univ. of Technology, Goeteborg (Sweden))

    2008-04-15

    Research within the area of improving alarm system design and performance has mainly focused on new alarm systems. However, smaller modernisations of legacy systems are more common in the Swedish nuclear industry than design of totally new systems. This imposes problems when the new system should function together with the old system. This project deals with the special concerns raised by modernisation projects. The objective of the project has been to increase the understanding of the relationship between the operator's performance and the design of the alarm system. Of major concern has been to consider the cognitive abilities of the operator, different operator roles and work situations, and varying need of information. The aim of the project has been to complement existing alarm design guidance and to develop user-centred alarm design concepts. Different case studies have been performed in several industry sectors (nuclear, oil refining, pulp and paper, aviation and medical care) to identify best practice. Several empirical studies have been performed within the nuclear area to investigate the operator's need of information, performance and workload in different operating modes. The aspect of teamwork has also been considered. The analyses show that the operator has different roles in different work situations which affect both the type of information needed and how the information is processed. In full power operation, the interaction between the operator and the alarm system is driven by internal factors and the operator tries to maintain high situation awareness by actively searching for information. The operator wants to optimise the process and need detailed information with possibilities to follow-up and get historical data. In disturbance management, the operator is more dependent on external information presented by the alarm system. The new compilation of alarm guidance is based on the operator's varying needs in different working situations and is applicable in modernisation projects. The division of the guidelines has been performed according to which part of human-machine-interaction they touch upon (e.g., control room layout, user interface design, navigation or support function) and in which design stage (e.g. conceptual design or detailed design) they are relevant. The results indicate that general guidelines (e.g. use a documented alarm philosophy) are very important to consider and define to ensure consistency between different modernisation projects. Further, the requirement on consistency can override detailed guidance on e.g. colour coding or font size. The operators in the control room should experience the system as one system. In connection to modernisations it is also of outmost importance to consider the operator's existing knowledge and experience. The guidelines have been used for the development of a new alarm design concept. The new concept tries to indicate relevant information clearer than existing systems; it integrates information to a larger extent and has better connections between events, objects, alarms, and procedures. The developed concept should be evaluated and validated by operators in usability tests. The most important aspects to consider in modernisation projects are: - Future systems must be more flexible and offer possibilities to adapt to varying needs of information in different operational modes and work situations. - The cognitive and physical abilities of the operator should not be exceeded. - Reliable work procedures acquired by practice are difficult to change and should be retained. Tasks performed often and/or in quiet conditions should be changed to obtain higher efficiency. - The alarm system should be well integrated in the overall instrumentation and control system in the control room. - A documented alarm philosophy is needed to ensure consistency between different projects. - The alarm system should guide the operator to the relevant information and should facilitate early detection of deviations. - Every alarm should require a response. The intention with the developed design concepts is to facilitate for the operator to detect and correct deviations before alarms occur. If alarms occur, the aim is to better support and guide the operator independent of operating mode and thus to increase the possibilities for correct situation management

  18. Economic impact of reversion; Oekonomiske virkninger av hjemfall

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    Estimations of the Norwegian hydropower production and various reversion models' market value have been made. The value of the Norwegian hydropower production until 01.01.2007 is estimated to about Nok 289 billion after taxes, or about 2,42 Nok/kWh medium production, given an expected future electricity price of around 0,25 Nok/kWh and a discount rate at 6,5 percent in nominal terms after taxes. The estimate is slightly above the level of prices for Norwegian hydropower plants in the last 8-10 years. The value of reversion in private plants which today have a limited licence time is estimated to Nok 5,5 billion. The value of reversion in public-owned Norwegian hydropower plants are about Nok 21 billion with a 60 year licence period from 01.01.2007, and about 12 billion for 75 years (ml)

  19. Economic impact of reversion; Oekonomiske virkninger av hjemfall

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    Estimations of the Norwegian hydropower production and various reversion models' market value have been made. The value of the Norwegian hydropower production until 01.01.2007 is estimated to about Nok 289 billion after taxes, or about 2,42 Nok/kWh medium production, given an expected future electricity price of around 0,25 Nok/kWh and a discount rate at 6,5 percent in nominal terms after taxes. The estimate is slightly above the level of prices for Norwegian hydropower plants in the last 8-10 years. The value of reversion in private plants which today have a limited licence time is estimated to Nok 5,5 billion. The value of reversion in public-owned Norwegian hydropower plants are about Nok 21 billion with a 60 year licence period from 01.01.2007, and about 12 billion for 75 years (ml)

  20. Boiler system lay-up; Avstaellning och konservering av pannanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Hellman, Mats

    2007-04-15

    Corrosion in power plant equipment is to a large extent a result of poor lay-up procedures. This applies for all equipment on the water and steam side e.g. condensers, boilers, turbines, heat exchangers etc. In theory, lay-up procedures are quite straightforward. The main objective is to avoid a combination of water and oxygen on the steel surfaces within the system. When using dry lay-up procedure, a totally dry environment is essential. The corrosion of steel cannot take place if there is no humidity; in spite of the abundance of oxygen i.e. air. As an alternative the steam side system can be purged with nitrogen so that no air ingress can take place. When using wet lay-up procedures it is important to achieve an oxygen free environment. Creating a slight over-pressure thus avoiding air in leakage can achieve this. Oxygen scavengers might be used as an alternative. Usually problems of maintaining the above mentioned conditions are rarely of technical art. More likely it is due to a lack of knowledge and commitment or short sighted economical considerations. This report summarises the experiences gathered at several visits at plants and discussions with vendors, users and consultants in the power industry. In addition to that, guidelines from well-reputed organisations, international and domestic, have been studied. In many cases the power plant managers believe they have proper lay-up routines but often the routines just regard long time lay-up. This may be regarded as the most important case. However, a number of shorter plant outages in combination with poor lay-up routines can result in severe damages. There is a consensus that a proper lay-up can only be achieved by plant specific lay-up procedures. Each unit is unique in terms of needs and requirements. In order to have as low corrosion as possible a systematic review to evaluate and revise lay-up procedures is preferred. A high in-house knowledge of the power plant enhances the possibility to maintain the