WorldWideScience

Sample records for plants inventering av

  1. Pollen transmission of asparagus virus 2 (AV-2) may facilitate mixed infection by two AV-2 isolates in asparagus plants.

    Science.gov (United States)

    Kawamura, Ryusuke; Shimura, Hanako; Mochizuki, Tomofumi; Ohki, Satoshi T; Masuta, Chikara

    2014-09-01

    Asparagus virus 2 (AV-2) is a member of the genus Ilarvirus and thought to induce the asparagus decline syndrome. AV-2 is known to be transmitted by seed, and the possibility of pollen transmission was proposed 25 years ago but not verified. In AV-2 sequence analyses, we have unexpectedly found mixed infection by two distinct AV-2 isolates in two asparagus plants. Because mixed infections by two related viruses are normally prevented by cross protection, we suspected that pollen transmission of AV-2 is involved in mixed infection. Immunohistochemical analyses and in situ hybridization using AV-2-infected tobacco plants revealed that AV-2 was localized in the meristem and associated with pollen grains. To experimentally produce a mixed infection via pollen transmission, two Nicotiana benthamiana plants that were infected with each of two AV-2 isolates were crossed. Derived cleaved-amplified polymorphic sequence analysis identified each AV-2 isolate in the progeny seedlings, suggesting that pollen transmission could indeed result in a mixed infection, at least in N. benthamiana.

  2. Inventory of future power and heat production technologies; Inventering av framtidens el- och vaermeproduktionstekniker

    Energy Technology Data Exchange (ETDEWEB)

    Ekstroem, Clas (Vattenfall Research and Development AB, Stockholm (Sweden))

    2008-12-15

    The overall vision of the project has been to produce likely development scenarios for various electricity and heat generation techniques, to indicate the possibilities provided by their implementation, and to give an indication of when implementation could be effected. The aim has been to identify possible technical advances in electricity and district heating generation techniques from a 2020 and 2030 time perspective. As a basic scenario, the project chose SwedEnergy's analysis of how the European Commission's aims for reducing carbon dioxide emissions and increasing renewable energy and energy efficiencies could be implemented in Sweden. Based on results, the project's findings regarding potentially competitive techniques are as follows: Capacity increases in Swedish nuclear power plants and a further two Finnish nuclear reactors mean that there will be no need for new large-scale electricity generation for base load in the Nordic region until it becomes necessary to replace existing nuclear power plants. The most attractive alternatives are as follows: Nuclear power could prove to be the most competitive alternative, especially if fuel prices rise and/or technically neutral climate-related control measures continue to be in place. If new nuclear power is not accepted in Sweden, the most attractive alternative would appear to be large fossil fuel fired plants equipped with CCS. According to the analyses in Elforsk's 'Roadmap' project, the EU's aims for carbon dioxide reduction and renewable energy, signify that almost all new power capacity erected in the Nordic area in the next two decades will be renewable. The most attractive alternatives for Sweden are as follows: Environmentally-adapted hydropower appears to be the most competitive alternative. Its potential is however restricted by demands that there should be minimal - if any - encroachments on landscape and nature, and by ecological concerns arising from the EU

  3. Inventory of future power and heat production technologies. Partial report Gasification with gas turbine/engine for power plants; Incl. English lang. appendix of 24 p. titled 'Status of large-scale biomass gasification for power production'; Inventering av framtidens el och vaermeproduktionstekniker. Delrapport Foergasning med gasturbin/motor foer kraftvaerk

    Energy Technology Data Exchange (ETDEWEB)

    Waldheim, Lars; Larsson, Eva K. (TPS Termiska Processer, Nykoeping (Sweden))

    2008-12-15

    This subproject is limited to applications with gas turbines or engines from approximately 1 MWe and firing of gas in a boiler either as indirect cofiring or as separate firing of gas from waste gasification. Gasification with gas engine, BIG-ICE (Biomass Integrated Gasification Internal-Combustion Engine) is realized in approximately 10 plants in Europe between 1 and 7 MWe. The gas needs to be cleaned from particles and tar before it is fed to the engine. A number of different gasifiers and gas cleaning technologies are applied in these prototypes, and in certain cases a second generation is being built. Gas engines from GE Jenbacher are most common, but there are also other producers with engines for low-calorific-value gas. The exhausts from engines must, unlike gas turbines, be cleaned catalytically, but emissions of hydrocarbons in particular are still higher than from gas turbines. It is possible to increase the electricity generation by applying a 'bottoming cycle' in the form of a steam or an ORC cycle. Such a plant with ORC has been started in Austria this year. During the 1990's expectations were high concerning the development of biomass gasification with gas turbine in a combined cycle BIG-CC (Biomass Integrated Gasification Combined Cycle) towards commercialisation. Two demonstration plants were built for the same gas turbine model, Siemens SGT 100 (earlier Typhoon); Vaernamo with pressurised gasification and ARBRE in Eggborough, England, with atmospheric gasification. The atmospheric technology has basically the same demands on gas cleaning as in the engine application, but downstream the gas is compressed to the pressure required by the gas turbine. In pressurised gasification, the gasifier pressure is set by the gas turbine. The gas is not cooled below 350-400 deg C and is cleaned in a high-temperature filter. Despite successful demonstration in Vaernamo, no more plants have been built. The ARBRE plant was never put into regular

  4. Inventory of future power and heat production technologies. Partial report Gasification with gas turbine/engine for power plants; Incl. English lang. appendix of 24 p. titled 'Status of large-scale biomass gasification for power production'; Inventering av framtidens el och vaermeproduktionstekniker. Delrapport Foergasning med gasturbin/motor foer kraftvaerk

    Energy Technology Data Exchange (ETDEWEB)

    Waldheim, Lars; Larsson, Eva K. (TPS Termiska Processer, Nykoeping (Sweden))

    2008-12-15

    This subproject is limited to applications with gas turbines or engines from approximately 1 MWe and firing of gas in a boiler either as indirect cofiring or as separate firing of gas from waste gasification. Gasification with gas engine, BIG-ICE (Biomass Integrated Gasification Internal-Combustion Engine) is realized in approximately 10 plants in Europe between 1 and 7 MWe. The gas needs to be cleaned from particles and tar before it is fed to the engine. A number of different gasifiers and gas cleaning technologies are applied in these prototypes, and in certain cases a second generation is being built. Gas engines from GE Jenbacher are most common, but there are also other producers with engines for low-calorific-value gas. The exhausts from engines must, unlike gas turbines, be cleaned catalytically, but emissions of hydrocarbons in particular are still higher than from gas turbines. It is possible to increase the electricity generation by applying a 'bottoming cycle' in the form of a steam or an ORC cycle. Such a plant with ORC has been started in Austria this year. During the 1990's expectations were high concerning the development of biomass gasification with gas turbine in a combined cycle BIG-CC (Biomass Integrated Gasification Combined Cycle) towards commercialisation. Two demonstration plants were built for the same gas turbine model, Siemens SGT 100 (earlier Typhoon); Vaernamo with pressurised gasification and ARBRE in Eggborough, England, with atmospheric gasification. The atmospheric technology has basically the same demands on gas cleaning as in the engine application, but downstream the gas is compressed to the pressure required by the gas turbine. In pressurised gasification, the gasifier pressure is set by the gas turbine. The gas is not cooled below 350-400 deg C and is cleaned in a high-temperature filter. Despite successful demonstration in Vaernamo, no more plants have been built. The ARBRE plant was never put into regular

  5. Inventory of future power and heat production technologies. Partial report Energy storage; Inventering av framtidens el- och vaermeproduktionstekniker. Delrapport Energilagring

    Energy Technology Data Exchange (ETDEWEB)

    Messing, Lars; Lindahl, Sture (Gothia Power AB, Goeteborg (Sweden))

    2008-12-15

    In this report a survey of different techniques for storage of electrical energy. The following alternatives are described regarding method, characteristics, potential and economy. Batteries; Capacitors; Flywheels; Pump storage hydro power plants; Hydrogen gas generation; Air compression. Regarding evaluation of methods for storage of electrical energy. Battery storage: The development of Lithium-ion batteries are of great interest. In the present situation it is however difficult of classify battery storage as a good alternation in applications with frequent re-charging cycles and re-charging of large energy volumes. The batteries have limited life length compared to other alternatives. Also the power is limited at charging and discharging. Energy storage in capacitors: 'Super-capacitors' having large power capacity is considered to be of interest in applications where fast control of power is necessary. The ongoing development of based on carbon-nanotubes will increase the energy storage capacity compared with the today existing super-capacitors. This can in the future be an alternative to battery storage. Of further interest is also the idea to combine battery and capacitor based storage to achieve longer life-time of the batteries and faster power control. Flywheel energy storage: The energy storage capacity is relatively limited but power control can be fast. This system can be an alternative to capacitor based energy storage. Pump-storage hydro power plant: This type of energy storage is well suited and proven for time frame up to some days. In the Swedish power system there is today not any large demand of energy storage in this time frame as there is a large capacity in conventional hydro power plants with storage capacity. Pump-storage can however be of interest in the southern part of Sweden. In some operation stages the grid is loaded up to its limit due to large power transmission from the north. The pump-storage can reduce this power transfer

  6. Inventory of future power and heat production technologies. Partial report Energy storage; Inventering av framtidens el- och vaermeproduktionstekniker. Delrapport Energilagring

    Energy Technology Data Exchange (ETDEWEB)

    Messing, Lars; Lindahl, Sture (Gothia Power AB, Goeteborg (Sweden))

    2008-12-15

    In this report a survey of different techniques for storage of electrical energy. The following alternatives are described regarding method, characteristics, potential and economy. Batteries; Capacitors; Flywheels; Pump storage hydro power plants; Hydrogen gas generation; Air compression. Regarding evaluation of methods for storage of electrical energy. Battery storage: The development of Lithium-ion batteries are of great interest. In the present situation it is however difficult of classify battery storage as a good alternation in applications with frequent re-charging cycles and re-charging of large energy volumes. The batteries have limited life length compared to other alternatives. Also the power is limited at charging and discharging. Energy storage in capacitors: 'Super-capacitors' having large power capacity is considered to be of interest in applications where fast control of power is necessary. The ongoing development of based on carbon-nanotubes will increase the energy storage capacity compared with the today existing super-capacitors. This can in the future be an alternative to battery storage. Of further interest is also the idea to combine battery and capacitor based storage to achieve longer life-time of the batteries and faster power control. Flywheel energy storage: The energy storage capacity is relatively limited but power control can be fast. This system can be an alternative to capacitor based energy storage. Pump-storage hydro power plant: This type of energy storage is well suited and proven for time frame up to some days. In the Swedish power system there is today not any large demand of energy storage in this time frame as there is a large capacity in conventional hydro power plants with storage capacity. Pump-storage can however be of interest in the southern part of Sweden. In some operation stages the grid is loaded up to its limit due to large power transmission from the north. The pump-storage can reduce this power transfer

  7. Inventory of future power and heat production technologies. Partial report Energy combines; Inventering av framtidens el- och vaermeproduktionstekniker. Delrapport Energikombinat

    Energy Technology Data Exchange (ETDEWEB)

    Thunman, Henrik; Lind, Fredrik; Johnsson, Filip (Chalmers Univ. of Technology, Goeteborg (Sweden))

    2008-12-15

    that produce biofuels suitable for the transport sector efficiencies between 45 and 55 % can be reached, independent of product. However, there is one exception, which is methane produced via gasification that can reach efficiencies between 70 and 75 %. What differs more between the biofuel producing processes for the transport sector is the amount of biofuel that is possible to get out from the ingoing biomass, which can be anything between 20 and 70 %. Here, ethanol gives the lowest and methane via gasification the highest values. With respect to the costs to produce the different products the lowest costs are obviously related to the production of biofuels to be used in the stationary energy system. The total production cost of these products is between 40 and 90 % higher than the cost for biomass feedstock (Swedish forest residues). The production cost for the other biofuels is 2.5 to 3.5 times higher than the cost for the feedstock (Swedish forest residues), independent of product. However, some polygeneration schemes show very high cost, up to 9 times the cost for the feedstock. The uncertainty in these figures is, nevertheless, high and the real costs are dependent on if there are any supplier of the technology, which availability that is possible to achieve and the costs for the operation and maintenance. As one or several of the components included in these plants are still at a research or at a demonstration stage, it is not possible to give any more precise estimation on the costs or availability of such plants

  8. Cyclic operation of power plant; Cyklisk drift av kraftvaermeverk

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan

    2007-12-15

    The great majority of power plants are designed for base load operation with a relatively small number of starts and stops per year. Therefore, there has been no need to consider fatigue at design. Over the last few years operation with more frequent starts and stops exists as a consequence of swinging electricity prices that has become common. This involves significantly higher frequency of damages; not least fatigue relates damages, and the number of severe failures in components that never before have had damage problems may increase as well. In the present work the different types of component that may suffer from cyclic operation related damage are gathered by a literature survey and described as follows: - where and how the damages comes up, - constructions that should be avoided, - non-destructive testing (NDT) for damage that may come up under cyclic operation, - calculation and assessment of integrity of critical components - areas where continued research would be valuable. Recommendations have been put together to be used to prevent cyclic operation related damage and to detect it in time. The target group for this study is i) plant owners of plants where cyclic operation is or may be present, ii) researchers in the area, and, iii) inspectors and NDT-operators. There are quite a number of components where cyclic operation has been found to significantly influence the lift time. Some of these components are described in many papers whereas occasional papers have been found for others. The amount of information that is possible to get for a certain component is likely related to its significance for cyclic operation damage. The most frequently reported problem is ligament cracking of high temperature headers. Other components where extensive studies have been done are: wall panels, creep-fatigue loaded welds and turbine components

  9. Inventions on baker's yeast storage and activation at the bakery plant.

    Science.gov (United States)

    Gélinas, Pierre

    2010-01-01

    Baker's yeast is the gas-forming ingredient in bakery products. Methods have been invented to properly handle baker's yeast and optimize its activity at the bakery plant. Over the years, incentives for inventions on yeast storage and activation have greatly changed depending on trends in the baking industry. For example, retailer's devices for cutting bulk pressed yeast and techniques for activating dry yeast have now lost their importance. Review of patents for invention indicates that activation of baker's yeast activity has been a very important issue for bakers, for example, with baking ingredients called yeast foods. In the recent years and especially for highly automated bakeries, interest has moved to equipments and processes for optimized storage of liquid cream yeast to thoroughly control dough fermentation and bread quality.

  10. Silencing of the AV2 gene by antisense RNA protects transgenic plants against a bipartite begomovirus

    Directory of Open Access Journals (Sweden)

    Zafar Yusuf

    2007-01-01

    Full Text Available Abstract Whitefly-transmitted geminiviruses (genus Begomovirus are phytopathogens that cause heavy losses to crops worldwide. Efforts to engineer resistance against these viruses are focused mainly on silencing of complementary-sense virus genes involved in virus replication. Here we have targeted a virion-sense gene (AV2 to develop resistance against Tomato leaf curl New Delhi virus, a bipartite begomovirus prevalent throughout the Indian subcontinent. We show that tobacco plants transformed with an antisense construct targeting this gene are resistant to the virus. Following challenged with the virus, transgenic plants remained symptomless, although viral DNA could be detected in some plants by PCR. This is the first report of transgenic resistance against a bipartite begomovirus obtained by targeting a virion-sense gene. The relatively conserved nature of the gene suggests that the technology may be useful to develop broad-spectrum resistance which is required because of the fact that plants are often infected with multiple begomoviruses in the field.

  11. Patent literature on mosquito repellent inventions which contain plant essential oils--a review.

    Science.gov (United States)

    Pohlit, Adrian Martin; Lopes, Norberto Peporine; Gama, Renata Antonaci; Tadei, Wanderli Pedro; Neto, Valter Ferreira de Andrade

    2011-04-01

    Bites Bites of mosquitoes belonging to the genera Anopheles Meigen, Aedes Meigen, Culex L. and Haemagogus L. are a general nuisance and are responsible for the transmission of important tropical diseases such as malaria, hemorrhagic dengue and yellow fevers and filariasis (elephantiasis). Plants are traditional sources of mosquito repelling essential oils (EOs), glyceridic oils and repellent and synergistic chemicals. A Chemical Abstracts search on mosquito repellent inventions containing plant-derived EOs revealed 144 active patents mostly from Asia. Chinese, Japanese and Korean language patents and those of India (in English) accounted for roughly 3/4 of all patents. Since 1998 patents on EO-containing mosquito repellent inventions have almost doubled about every 4 years. In general, these patents describe repellent compositions for use in topical agents, cosmetic products, incense, fumigants, indoor and outdoor sprays, fibers, textiles among other applications. 67 EOs and 9 glyceridic oils were individually cited in at least 2 patents. Over 1/2 of all patents named just one EO. Citronella [Cymbopogon nardus (L.) Rendle, C.winterianus Jowitt ex Bor] and eucalyptus (Eucalyptus LʼHér. spp.) EOs were each cited in approximately 1/3 of all patents. Camphor [Cinnamomum camphora (L.) J. Presl], cinnamon (Cinnamomum zeylanicum Blume), clove [Syzygium aromaticum (L.) Merr. & L.M. Perry], geranium (Pelargonium graveolens LʼHér.), lavender (Lavandula angustifolia Mill.), lemon [Citrus × limon (L.) Osbeck], lemongrass [Cymbopogon citratus (DC.) Stapf] and peppermint (Mentha × piperita L.) EOs were each cited in > 10% of patents. Repellent chemicals present in EO compositions or added as pure “natural” ingredients such as geraniol, limonene, p-menthane-3,8-diol, nepetalactone and vanillin were described in approximately 40% of all patents. About 25% of EO-containing inventions included or were made to be used with synthetic insect control agents having mosquito

  12. The invention of WUS-like stem cell-promoting functions in plants predates leptosporangiate ferns.

    Science.gov (United States)

    Nardmann, Judith; Werr, Wolfgang

    2012-01-01

    The growth of land plants depends on stem cell-containing meristems which show major differences in their architecture from basal to higher plant species. In Arabidopsis, the stem cell niches in the shoot and root meristems are promoted by WUSCHEL (WUS) and WOX5, respectively. Both genes are members of a non-ancestral clade of the WUS-related homeobox (WOX) gene family, which is absent in extant bryophytes and lycophytes. Our analyses of five fern species suggest that a single WUS orthologue was present in the last common ancestor (LCA) of leptosporangiate ferns and seed plants. In the extant fern Ceratopteris richardii, the WUS pro-orthologue marks the pluripotent cell fate of immediate descendants of the root apical initial, so-called merophytes, which undergo a series of stereotypic cell divisions and give rise to all cell types of the root except the root cap. The invention of a WUS-like function within the WOX gene family in an ancestor of leptosporangiate ferns and seed plants and its amplification and sub-functionalisation to different stem cell niches might relate to the success of seed plants, especially angiosperms.

  13. Invention: Contest

    Science.gov (United States)

    Yoon, Jiyoon

    2008-01-01

    The author presents an invention contest to help students document the development process of inventions. By developing an invention, writing an inventor's log, and drawing an invention poster, students experience the whole process of invention and understand how to take their own ideas to the next level. (Contains 2 tables.)

  14. Invention: Contest

    Science.gov (United States)

    Yoon, Jiyoon

    2008-01-01

    The author presents an invention contest to help students document the development process of inventions. By developing an invention, writing an inventor's log, and drawing an invention poster, students experience the whole process of invention and understand how to take their own ideas to the next level. (Contains 2 tables.)

  15. Inventory of vegetation and benthos in newly laid and natural ponds in Forsmark 2012; Inventering av vegetation och bottenfauna i nyanlagda och naturliga goelar i Forsmark 2012

    Energy Technology Data Exchange (ETDEWEB)

    Qvarfordt, Susanne; Wallin, Anders; Borgiel, Micke [Sveriges Vattenekologer AB, Vingaaker (Sweden)

    2013-01-15

    SKB plans to build a repository for the spent nuclear fuel. The repository is planned to be built in Forsmark and constitutes installations above and below ground. The building and operation of the construction will involve activities that might affect the nature in the area. The impact means, among other things, that a small water body, which today is a reproduction site for the red listed pool frog (Rana lessonae), will disappear. The lost locality for the pool frog has been compensated by creating four new ponds in the Forsmark area. This study is part of the follow-up of these new habitats. The aim is to describe the plant and animal communities in the ponds, and follow the succession, i.e. the development of the habitats. The study also includes two natural ponds that will serve as reference objects. The survey of vegetation and invertebrate fauna in the ponds was conducted in October 2012. The results show that the new ponds had low coverage of submersed vegetation and the species composition in the plant communities differed between the ponds. The reference ponds also had different plant communities, both in terms of species composition and coverage. This indicates that the species composition of the plant communities in the new ponds will likely depend on physical factors specific to the respective pond, but that higher vegetation coverage can be expected over time in all new ponds. The reference ponds had similar animal communities that differed from the animal communities in the new ponds. The similar species composition in the reference ponds, despite the variety of plant communities, suggests that similar animal communities are likely to develop in the new ponds, even if the plant communities continues to be different. Water chemical sampling has also been conducted in the ponds during 2012. A comparison of the inorganic environment (with regard to analysed ions) showed that the reference ponds had relatively similar ion compositions with little

  16. Invention/Re-invention

    OpenAIRE

    Mera, M.

    2009-01-01

    This article examines the relationship between texts that are re-invented for different media and/or contexts including: film remakes, prequels and sequels, video games that become films and vice versa, internet mashups, and television series that move across geographical borders. The article points to significant sources in this emerging field and presents some of the challenges that arise in relation to its study. In particular questions of originality, fidelity, repetition and difference a...

  17. Alternatives for handling of digestate from large biogas plants; Foeraedling av roetrest fraan storskaliga biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Aarsrud, Peter (Kretsloppskontoret Goeteborg (Sweden)); Bisaillon, Mattias (Profu (Sweden)); Hellstroem, Hanna; Henriksson, Gunilla (SP, Boraas (Sweden)); Jakobsson, Emma; Jarlsvik, Tisse; Martinsson, Ulf (Goeteborg Energi (Sweden)); Jensen, Carl (Renova (Sweden)); Johansson, Lars-Gunnar (Biogas Vaest/LRF (Sweden)); Kanerot, Mija (Boraas Energi och Miljoe (Sweden)); Ling, Daniel (Laeckeby Water (Sweden))

    2010-07-01

    Biogas plants located in city environments are becoming increasingly common in Sweden. More and more municipalities are electing to collect food waste for treatment in a biogas plant. The environment target of treating 35 % all organic waste biologically try to obtain from municipalities. Certain demands are placed on biogas plants and their system environments if they are to be able to treat food waste successfully. Firstly, there needs to be a use for the nutrient-rich biofertilizer product, and secondly it must be possible to clean the reject water before it is released to the recipient. The goal of the project is to conduct a system analysis from the economic and environmental perspectives to investigate what is the best alternative for dealing with the digestate and reject water for two biogas plants located in city environments. The plants used as the point of departure for the study are a planned biogas plant in Gothenburg and an existing biogas plant in Boraas. The plant in Boraas is planned to be included in an energy combine with ethanol production. The target group for the project comprises biogas plants built in city environments with the purpose of treating food waste, but also other plants that treat organic waste in a digester, e.g., sludge from sewage treatment works. Table 1 below shows the results for each technology studied. [Table 1 Results from system analysis.] The results of the system analysis show that the best alternative for Gothenburg, both from an economical point of view and when considering the climate impact, is to transport and spread the un-dewatered digestate directly onto arable land. On the basis of acidification and eutrophication potentials, the best alternative is to treat the reject water with the DeAmmon process. From the economic perspective, the best alternative for Boraas is to continue with the treatment method used today at the plant, that is, SBR. From the perspective of climate impact, the best alternative is to

  18. Cisgenesis: an important sub-invention for traditional plant breeding companies

    NARCIS (Netherlands)

    Jacobsen, E.; Schouten, H.J.

    2009-01-01

    Modern plant breeding is highly dependent on new technologies to master future problems. More traits have to be combined, frequently originating from wild species. Traditional breeding is connected with linkage drag problems. The crop plant itself and its crossable species represent the traditional

  19. Increased utilisation of existing biogas plants; Oekat utnyttjande av befintliga biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Lantz, Mikael

    2007-09-15

    The purpose of this study is to analyse how existing biogas plants in Sweden could be utilised more efficiently, by increase the organic loading rate, and to calculate the cost efficiency of such measures. Biogas plants treating sewage sludge are currently operated with low organic loading rates and it is likely that there could be a considerable potential of increased utilisation of existing capacity. However, disposal costs of digested sewage sludge have a great impact on the economic result. Thus, the cost must be low, below 200 - 850 SEK/tonne DS, for co-digestion of sewage sludge and organic household waste to be economic competitive, compared to building of a new reactor. For co-digestion plants, using manure and organic waste as feedstock, it is not possible to say whether it is more economic to increase the utilisation of existing capacity or to increase the reactor volume. Therefore, more specific studies are required for individual plants and cases. Regarding the need for a more sophisticated monitoring and control of the biogas process, it can be established that the utilisation of sewage sludge digestion plants could be increased considerably without exceptionally high organic loading rates, thus probably without any additional monitoring and control. However, indicated prices for such applications are probably acceptable compared to establishing a new reactor. For co-digestion plants, the scope for investments is smaller and more dependent on the alternative cost for new reactors. Also, any process disturbances, which may appear even at low organic loading rates, could be very costly and result in costs in the same range as for monitoring and control equipment. Finally, the reader should observe that the analyses conducted here assume that funding and physical space for additional reactors is available at the existing site. If not, there could be situations where it is economic interesting to increase the organic loading rate although cost estimates

  20. More Electricity. Methodical survey of existing plants; Mer El. Metodisk genomgaang av befintliga anlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Baafaelt, Martin [Carl Bro Energikonsult AB, Malmoe (Sweden); Ifwer, Karin; Svensson, Niclas; Oehrstroem, Anna [AaF-Process AB, Stockholm (Sweden); Johansson, Inge [S.E.P. Scandinavian Energy Project AB, Goeteborg (Sweden)

    2006-11-15

    The interest in production of electricity has increased the last years as a consequence of the increased price. A high production of electricity is of interest for all kinds of CHP-plants. For large biofuel fired CHP-plants typical electrical efficiency is 35 %, for incineration plants the electrical efficiency is about 28 %. A number of reasons why it is not higher, for example corrosion, fouling, erosion, limited and varying need for heat, flue gas condensation etc, exist. A number of these reasons have earlier been studied in different Vaermeforsk reports. The results from these studies give to some extent solutions and understanding for how the production of electricity can be increased. There is however no report that has the overall picture of what actions are realistic, most cost effective, what areas need more research and gives the most benefit of allocated funds. The aim of this report is to identify the technical limitations and propose measures for increased electricity production at CHP-plants using biofuel and waste. A method for identification of the most suitable actions for each plant is also presented. The idea is to take every conceivable factor that affects electricity production into consideration and to be able to make a relevant comparison of the factors. This report doesn't take new solutions/measures and means of control into consideration. The method used is called 'Weighted Sum Method'. Every action is assessed in the means of different criteria as for example how it affects the environment, if it is profitable, if it means more maintenance etc. An extensive checklist for different conceivable measures for increased electricity production has been created. The checklist includes measures from the fuel storage to the chimney and makes a good guidance when making a review of a biofuel or incineration CHP-plant. Some of the measures can be eliminated immediately at review since they not are applicable or have already been done

  1. Availability assessment and risk assessment regarding handling and preparation of biomass in combustion plants; Tillgaenglighets- och riskbedoemning av system foer hantering och beredning av biobraensle i foerbraenningsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Biguen, Helen; Bodlund, Gunnar; Dahlloef, Lars; Pettersson, Lars [SwedPower, Stockholm (Sweden)

    2005-04-01

    In the design of new, or refurbishment of old, bio-fuel fired plants, the design of the fuel-handling systems is often based on experiences from existing plants. The size of the bio-fuel storage is decided from fuel consumption during a long holiday with no transports, and available storage area on the site. Auxiliary capacities and redundancies in the bio-fuel handling systems are often determined by investment costs rather than by life-cycle costs. Risk analyses are realized according to Swedish legislation for Occupation and Health and its regulations for work in environment with risk of explosion. The plant is designed to minimize the risk for explosion and also to minimize the consequences of an explosion. The plant is provided with fire protection functions according to applicable legislations and regulations. Safety functions can either be passive as physical separations or active as different kinds of detecting and consequence reducing systems. The aim of this report is to emphasize the use of quantitative tools for analysis to evaluate alternative system designs from the viewpoint of availability and risk. The availability analysis gives the opportunity to quantitatively analyse suggested alternative solutions of a system and to study the influence of redundant system functions, storage volumes etceteras. The analysis also gives the opportunity to evaluate effects on manning, work on three shifts or daytime with extra duty on call, as well as the optimization of spare parts toward delivery times and agreements for service. The probabilistic risk analysis gives opportunities to place in order of precedence and quantitatively evaluate the effect on total risk from suggested passive protective measures and different types of active protection functions such as fire sprinkling. The methods of analysis are above all an aid and support to optimize system design and life cycle cost during the design phase. During continuous operation the quantitative analyses are

  2. Inventing the History of Invention.

    Science.gov (United States)

    Molella, Arthur P.

    1988-01-01

    Selected are three pioneers who invented the history of technology: Abbott P. Usher, Lewis Mumford, and Sigfried Giedion. Their careers, publications, and contributions to the history of technology are described. (YP)

  3. Follow-up of availability for cogeneration- and heating plants - a joint platform of experiences; Uppfoeljning av tillgaenglighet inom vaerme- och kraftvaermeverk - en branschgemensam plattform av erfarenheter

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Mats; Sfiris, George [Vattenfall Utveckling AB, Stockholm (Sweden); Andersson, Sven-Olof; Pettersson, Lasse [Vattenfall Energisystem AB, Stockholm (Sweden)

    2000-01-01

    The report before is a co-operation between Vattenfall Utveckling AB and Vattenfall Energisystem AB. Together with five biomass fueled heat plants or combined heat and power plants a database of operating experience from the operating seasons 1997-98 was built up. The plants that have contributed to the project are Haesselby Kraftvaermeverk, Naessjoe Kraftvaermeverk, Motala Vaermeverk, Kraftvaermeverket Heden 2 in Karlstad and Flintraennans Fjaerrvaermecentral in Malmoe. Even though all plants are biomass fueled, they still represent different techniques and sizes. With support of the data program TGU (Till Gaenglighets Uppfoeljning = Availability Follow-up) all faults that have an effect on the availability performance are registered by the staff on each plant. The data has been sent to Vattenfall where all fault events have been translated from the locally used terms to a common system standard according to the German KKS (Kraftwerk-Kennenzeichensystem). The data has been entered into a joint Microsoft Access database where all fault events from all plants can be saved and compared. The database also presents various search and report possibilities. The overall goal with this project was to create a platform to be able to structurally analyze unavailability and thereby on the long run increase the profitability for the owners of the plants. Even if the contents of the database still not are sufficient to draw any general conclusions from, the goals have been met. In spite of the fact that there have been problems in the course of the project, a functioning working routine has been prepared. If more plants will join in the second stage of the project, surely more valuable experiences will be brought back to the owners of the plants. The report period include all 1997 and 1998 (for Flintraennan and Motala only 1998). The observation period was 51,312 hours counted as calendar time, excluding revision periods. During that time a total of 201 faults have occurred

  4. Investigation of the responsibility for decommissioning of the Ranstad plant; Utredning av ansvaret foer Ranstadsverkets avveckling

    Energy Technology Data Exchange (ETDEWEB)

    Svensson, Haakan; Grundfelt, Bertil [Kemakta Konsult AB, Stockholm (Sweden); Froeberg, Magnus [Froeberg och Lundholm Advokatbyraa AB, Stockholm (Sweden)

    2010-11-15

    The issue of decommissioning, including demolition, of the nuclear facility at the Ranstad plant was raised gradually during 2006-2008. It was then found that it was unclear which company or companies that could be responsible for this decommissioning, economically as well as for the implementation. During this time and until the end of 2009, the concerned authorities, notably Swedish Nuclear Power Inspectorate and SSM, collected a large amount of facts as a basis for assessing liability. This material now needed to be systematized and compiled in order to effectively be utilized in such an assessment. SSM also thought that it would be helpful if an independent party with experience in similar issues could contribute to the interpretation of the legal situation. These were the given conditions of the mission which Kemakta Konsult AB, with the assistance of lawyer Magnus Froeberg, were given by SSM in the autumn of 2009. The results are presented in this final report.

  5. Availability assessment and risk assessment regarding handling and preparation of biomass in combustion plants; Tillgaenglighets- och riskbedoemning av system foer hantering och beredning av biobraensle i foerbraenningsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Biguen, Helen; Bodlund, Gunnar; Dahlloef, Lars; Pettersson, Lars [SwedPower, Stockholm (Sweden)

    2005-04-01

    In the design of new, or refurbishment of old, bio-fuel fired plants, the design of the fuel-handling systems is often based on experiences from existing plants. The size of the bio-fuel storage is decided from fuel consumption during a long holiday with no transports, and available storage area on the site. Auxiliary capacities and redundancies in the bio-fuel handling systems are often determined by investment costs rather than by life-cycle costs. Risk analyses are realized according to Swedish legislation for Occupation and Health and its regulations for work in environment with risk of explosion. The plant is designed to minimize the risk for explosion and also to minimize the consequences of an explosion. The plant is provided with fire protection functions according to applicable legislations and regulations. Safety functions can either be passive as physical separations or active as different kinds of detecting and consequence reducing systems. The aim of this report is to emphasize the use of quantitative tools for analysis to evaluate alternative system designs from the viewpoint of availability and risk. The availability analysis gives the opportunity to quantitatively analyse suggested alternative solutions of a system and to study the influence of redundant system functions, storage volumes etceteras. The analysis also gives the opportunity to evaluate effects on manning, work on three shifts or daytime with extra duty on call, as well as the optimization of spare parts toward delivery times and agreements for service. The probabilistic risk analysis gives opportunities to place in order of precedence and quantitatively evaluate the effect on total risk from suggested passive protective measures and different types of active protection functions such as fire sprinkling. The methods of analysis are above all an aid and support to optimize system design and life cycle cost during the design phase. During continuous operation the quantitative analyses are

  6. Optimized production of vehicle gas - an environmental and energy system analyses of Soederaasens biogas plant.; Systemoptimerad produktion av fordonsgas - En miljoe- och energisystemanalys av Soederaasens biogasanlaeggning

    Energy Technology Data Exchange (ETDEWEB)

    Lantz, Mikael; Ekman, Anna; Boerjesson, Paal

    2009-06-15

    In this study, an environmental and energy system analysis for a specific biogas plant is presented as well as suggestions and cost calculations for measures that could be implemented in order to optimise the system. The overarching purpose is also to present a model for similar studies of specific biogas plants. The analysis performed includes direct effects such as use of energy and emissions from the production of biogas, upgrading to vehicle gas, transport of substrate and digestate and storage and handling of digestate. Furthermore, indirect effects such as reduced methane leaching from conventional storage of manure, replacement of mineral fertilizers with digestate etc. are included as well. The energy balance for production and distribution of vehicle gas from Soederaasens biogas plant is calculated to 5,5 which could be compared to the energy balance for ethanol from wheat which is normally between 2 and 3. The greenhouse gas emissions are 16 gram CO{sub 2}-ekv./kWh, approximately 95 % lower compared to gasoline. In comparison, ethanol from wheat and RME reduce the emissions with some 80 % and 65 % respectively. The result is mainly affected of the methane leakage from the upgrading plant, reduced emissions of N{sub 2}O when digestate replaces mineral fertilizers and the assumptions made of how the electricity used in the system was produced. Regarding eutrophication, the emissions are calculated to 6 gram NO{sub 3}--ekv./kWh, primarily originating from storage and handling of digestate, which is somewhat lower than the reported emissions from production of ethanol and RME. Covering the digestate storages and produce process heat with wood chips, measures estimated to be cost neutral or even profitable for the biogas producer, is calculated to reduce the emissions of greenhouse gases to -13 gram/kWh. If all measures identified would be implemented, the emissions are reduced with 120 % with an extra cost of some 0.01 SEK/kWh vehicle gas

  7. Evaluation and development of methods for determining methane emissions from biogas plants - Literature Study; Vaerdering och utveckling av maetmetoder foer bestaemning av metanemissioner fraan biogasanlaeggningar - Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Holmgren, Magnus Andreas (SP, Boraas (Sweden)); Willen, Agnes; Rodhe, Lena (JTI, Uppsala (Sweden))

    2011-11-15

    Previous work in areas such as framework of voluntary commitment shows that there is a need for techniques for measurement of methane and other greenhouse gases from various sources in the handling of organic residuals. There are no established methods for determining for instance emissions of methane from open or partially open tanks and cisterns, typically residue storage and the like. This report gives results from Phase 1 of this project, in which literary studies, market research studies, interviews and site visits have been made to identify a number of methods applied for the determination of emissions from open areas, such as liquid surfaces, but also land. Focus is on methods that can be applied to plants for biological treatment, which also includes the water treatment process at the treatment plants, but also the procedures used in measurements on land, landfills and processing plants are studied. First, the report gives a brief overview of a large number of measurement methods, where more detailed descriptions of four methods are given. The four methods are considered to be the most promising to pursue in the following phases of the project: - chamber technology; - sampling hood; - plume measurement with DIAL (Differential Absorption Lidar); - air input in a covered storage.

  8. Cleaning of condensate from flue gas condensing plants at co-combustion of waste fuels. Follow-up of emissions; Rening av kondensat fraan roekgaskondenseringsanlaeggningar vid samfoerbraenning av avfallsbraenslen. Uppfoeljning av utslaepp

    Energy Technology Data Exchange (ETDEWEB)

    Sundquist, Lena; Dejfors, Charlotte; Wrangensten, Lars [AaF Energikonsult AB, Stockholm (Sweden)

    2002-03-01

    Limits of discharges in waste water at flue gas cleaning are one of the fields included in the EC-directive (2000/76/EG) regarding combustion of waste from December 28th, 2000. The pollutants included in the limits are suspended material, Hg, Cd, Tl, As, Pb, Cr, Cu, Ni, Zn as well as dioxins and furans. The limits of the directive applies generally for plants with combustion of waste, regardless of type of waste fraction, the degree of admixture or if it is a so called co-combustion plant or not. For new plants, the limits shall be fulfilled within two years after the date of the directive whereas existing plants have another three years to meet the new demands. In this project, the condensate from the flue gas has been analysed at five different combustion plants. Samples of the fuel have also been analysed as a reference at the evaluation of the results. The results from the analysed condensate have then been compared and evaluated with regards to the limit values in the EC-directive. However, one exception is dioxins and furans that are not included in this study. The analysis of the pure condensate show that at most plants the content of pollutants is below, or in some cases well below, the limits of the EC-directive. At plants with co-combustion of recovered biofuels, even the contents of pollutants in the non-purified raw condensate are below the limits of the directive. This means that plants with co-combustion of recovered wood waste and biofuels most likely will meet the requirements for emissions to waste water in the EC-directive. The water treatment process in these plants normally consists of a pH-adjustment stage followed by adding of chemicals before the condensate enters into a sand filter. The cleaned condensate from the sand filter is normally released to a recipient whereas the dirty condensate goes through a lamell separator in order to separate rest sludge. The most polluted raw condensate was found at a plant with 100 % combustion of municipal

  9. Testing of energy assessment of technical plants, in accordance with the Energy Performance of Buildings Directive, EPBD; Testing av Energivurdering av tekniske anlegg iht Bygningsenergidirektivet, EPBD

    Energy Technology Data Exchange (ETDEWEB)

    Birkeland, Harald

    2008-06-15

    The consulting company Norwegian Energy has previously worked out proposals for inspection systems for technical plants, in accordance with the EU Energy Performance of Buildings Directive, abbreviated EPBD. This project has consisted in practice testing of the proposed inspection systems. In this respect agreements have been made with a number of companies working with heating boiler inspections as well as ventilation and cooling. Testing experiences have been summed up in this report. The most important experiences from this project concern practical matters: The main challenge is to find data and documentation on the plant. Use of time and resources is part of this challenge. The forms must be simplified, with less information to fill in. Some adjustments have been proposed to the previously proposed procedure. The content of the inspection should be clearly defined, without any options for simplifications. Eligibility requirements: There is clearly a need for training and certification procedures for companies/persons which are permitted to carry out inspections according to the EPBD. A proposal for such procedures has been worked out. The inspection should contain both a declaration of impartiality and a guarantee from the inspector that all identified points of improvement have been described. (EW)

  10. Inventing Freud.

    Science.gov (United States)

    Rudnytsky, Peter L

    2008-06-01

    Written to commemorate the 150th anniversary of Freud's birth, this paper construes Nina Coltart's statement that "if Freud did not exist it would be necessary to invent him," with its implicit comparison of Freud to God, to refer to (a) the things that Freud taught that are incontrovertibly true; (b) the unavoidable subjectivity in all judgments of Freud; and (c) the resemblances between psychoanalysis and religion. This last comparison is likewise seen to have both positive and negative aspects. Freud's ideas have inspired many people, yet he unscientifically arrogated sovereign authority over psychoanalysis. Freud's admirers are reminded of his extreme difficulty in admitting he was wrong and changing his mind when he should have known better, while his detractors are encouraged to consider the evidence supporting many of Freud's core tenets and to recognize that his discovery of psychoanalysis is indeed one of the supreme achievements in human history.

  11. Katodisk beskyttelse av umbilicals

    OpenAIRE

    Mjølhus, Bjarte

    2008-01-01

    Ulike sider ved bruk av sinkbånd til korrosjonsbeskyttelse av karbonstål umbilical er evaluert. Det er utført litteraturstudie ved gjennomgang av tidligere rapporter, sammenligning av standarder og artikkelsøk. Langtidsforsøk med egne korrosjonsceller ble utført over 2 måneder for å undersøke korrosjonsbeskyttelse ved 4 ulike temperaturer. Det ble også gjort undersøkelser av korrosjonsbelegg i SEM for å undersøke og sammenligne med publiserte data. Åpen krets potensialet viste seg å ligge ...

  12. Study of flue gas condensing for biofuel fired heat and power plants; Studie av roekgaskondensering foer biobraensleeldade kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Gustafsson, J.O.; Nystroem, Johan; Johansson, Kent

    2000-11-01

    This report considers questions regarding flue gas condensing plants connected to bio-fuelled heat and power plants. The report consists of two parts, one where nine existing plants are described regarding technical issues and regarding the experience from the different plants. Part two is a theoretical study where heat balance calculations are made to show the technical and economical performance in different plant configurations and operating conditions. Initially the different parts in the flue gas condensing plant are described. Tube, plate and scrubber condensers are described briefly. The different types of humidifiers are also described, rotor, cross-stream plate heat exchanger and scrubber. Nine flue gas-condensing plants have been visited. The plants where chosen considering it should be bio-fuel fired plant primarily heat and power plants. Furthermore we tried to get a good dissemination considering plant configuration, supplier, geographical position, operating situation and plant size. The description of the different plants focuses on the flue gas condenser and the belonging components. The fuel, flue gas and condensate composition is described as well as which materials are used in the different parts of the plant. The experience from operating the plants and the reasons of why they decided to chose the actual condenser supplier are reported.

  13. AVS on satellite

    Science.gov (United States)

    Zhao, Haiwu; Wang, Guozhong; Hou, Gang

    2005-07-01

    AVS is a new digital audio-video coding standard established by China. AVS will be used in digital TV broadcasting and next general optical disk. AVS adopted many digital audio-video coding techniques developed by Chinese company and universities in recent years, it has very low complexity compared to H.264, and AVS will charge very low royalty fee through one-step license including all AVS tools. So AVS is a good and competitive candidate for Chinese DTV and next generation optical disk. In addition, Chinese government has published a plan for satellite TV signal directly to home(DTH) and a telecommunication satellite named as SINO 2 will be launched in 2006. AVS will be also one of the best hopeful candidates of audio-video coding standard on satellite signal transmission.

  14. Optimal integration of energy at the Combined Energy Plant in Norrkoeping -Integration of steam, hot water and district heat to biogas plants; Optimal integrering av energianvaendningen vid energikombinatet i Norrkoeping -Integrering av aanga, hetvatten och fjaerrvaerme till biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Benjaminsson, Johan; Goldschmidt, Barbara; Uddgren, Roger

    2010-09-15

    The background of this report is to investigate and highlight the benefits of establishing a biogas plant nearby a combined energy plant where steam and district heat is available. By using heat from the combined energy plant, more biogas can be produced as vehicle fuel instead of being used as fuel to heat the digester, the biogas upgrading plant or the dryer. The project's objective is to analyze where it is interesting with integration of heat to the biogas plant and to compare alternative technologies and possible integration options. The stakeholders of the study are industries with access to organic matter for biogas production and heat producers who can deliver thermal energy into biogas plants. The project was implemented by collection of information from the Haendeloe combined energy plant outside Norrkoeping where there is a cogeneration plant, an ethanol plant and a biogas plant. Case studies for the study have been carried out with proposals regarding how heat flows from the power plant and ethanol plant can be further integrated with the biogas plant. As case studies, both the current design of the biogas plant, as well as a fictional case in which half of all distillery residues was digested, have been evaluated. The case studies show that in today's biogas plant it is not economical to replace the existing biogas upgrading unit with water absorption to chemical absorption. The upgrading cost with water absorption at today's smaller facility is 0.11 kr/kWh and in order to obtain the same total cost of chemical absorption a steam price of 0.15 kr/kWh is required. For large gas flows, chemical absorption is an advantage since the technology is more suitable for upscaling in comparison with water absorption that must be delivered in multiple lines. Nevertheless, a possibility to recover waste heat from chemical absorption is necessary if the technology shall be competitive. If waste heat from both water absorption and chemical absorption

  15. Modelling of a hybrid plant and development of a control system for the Vaesthamn plant based on artificial neural networks; Modellering av hybridanlaeggning samt utveckling av oevervakningssystem foer Vaesthamnsverket baserat paa Artificiella Neurala Naetverk

    Energy Technology Data Exchange (ETDEWEB)

    Assadi, Mohsen; Fast, Magnus [Lund Inst. of Technology (Sweden). Dept. of Energy Sciences

    2006-12-15

    The project aim is to model the hybrid plant at Vaesthamnsverket in Helsingborg using artificial neural networks (ANN). The definition of a hybrid plant is that it uses more than one fuel, in this case a natural gas fuelled gas turbine with heat recovery steam generator (HRSG) and a biomass fuelled steam boiler with steam turbine. The models in the present project are based on operational data from the plant in contrary to previous projects where synthetic (simulated) data has been used in a large extent. The gas turbine represents the subsystem that has received most attention in previous projects, which will also be the case for the present project although models of the HRSG, steam boiler and steam turbine are created since the whole plant is of interest. The completed ANN sub modules are connected in a network, which can be used for e.g. offline simulation and real-time condition monitoring of the plant. A product, including all sub modules, is created in shape of a user-friendly interface in an MS Excel environment. This user interface can be used for continuous monitoring, training personnel and in planning of the operation. The target group is the plant owners and the original equipment manufacturers (OEM). The plant owners interest lies in receiving a product that can assist them when operating the plant, for instance supply them with information about the grade of degradation. The OEMs main interest lies in investigating the possibilities of delivering ANNs, based on synthetic data, along with their new gas turbines. Vaesthamnsverket have contributed with operational data from the plant as well as support in plant related questions. Siemens have contributed with expert knowledge about their gas turbine, the SGT800. The received data has been examined and filtered before used for training ANN models. The models have been evaluated with independent data. The results are very promising with ANN models showing high prediction accuracy. All subsystems can be

  16. DESIGN AV FREMTIDENS KUMLOKK

    OpenAIRE

    Breien, William Topper

    2014-01-01

    Denne oppgavens mål har vært å utvikle et nytt design for kumlokk. Det nye designet skal være lettere enn utgangspunktet. Dette har blitt gjort ved hjelp av en iterativ designprosess, styrkeberegninger i Siemens NX 8, simuleringer av støp i Magmasofts MAGMA5, prøvestøping og testing ved støperiet til Ulefos Jernværk i Ulefoss. Denne rapporten inneholder teoretisk bakgrunn og beskrivelse av metoder tatt i bruk ved utvikling av nytt design, simulerin...

  17. Decommissioning of nuclear power plants in the US - a travel report; Avveckling av kaernkraftverk i USA - en reserapport

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, H.; Lindhe, J.C.; Malmqvist, L.; Lund, I.; Welleman, E

    1999-03-01

    This report summarises information and impressions from a journey in north-east USA. The purpose of the journey was to study the on-going decommissioning of nuclear power plants - mainly how it is regulated by the competent authorities, but also how it is performed in practice. The journey included visits at the US Nuclear Regulatory Commission, the company Duke Engineering and Services, and the two nuclear power plants Haddam Neck and Maine Yankee

  18. On the need for new continues measurement techniques at combustion plants; Anlaeggningars behov av ny kontinuerlig maetteknik

    Energy Technology Data Exchange (ETDEWEB)

    Eskilsson, David; Samuelsson, Jessica [Swedish National Testing and Research Inst., Boraas (Sweden)

    2006-11-15

    The purpose of this study is to make an inventory regarding the need for new continuous measurement techniques at combustion plants in Sweden. In total 15 interviews at 15 different combustion plants were made. The interviewed plants are of different sizes and use different combustion techniques, fuels, and cleaning equipments. They thereby well reflect the combustion plants present in Sweden today. Among many interesting interview results, we chose to highlight: Continuous measurement of the moisture content of the fuel, which can be used to decide the value of a fuel delivery, or for monitoring or to controlling the combustion (e.g. the speed of the grate); Continuous measurement of the heating value of the fuel, which can be used to decide the value of a fuel delivery, or for monitoring or to controlling the combustion. There is a need for temperature sensors which better withstand the environment in the furnace. Moreover, there is also a need for 3-dimensional measurements of the temperature in the furnace, especially for fluidized beds. This information can be used to control the combustion in different ways, e.g. preventing the bed from sintering. At some plants there was a need to measure the rate of corrosion and the growth of deposits. The measurements can be used to control the fuel mix at an early stage and to thereby avoid problems caused by corrosion and deposits. The measurement results can also be used to control the soot cleaning equipment, fuel mixture and adding of additive. At some of the interviewed plants there was a need to continuously measure the amount of unburned fuel in the ash. The continuous measurement results can be used for automatic control or monitoring of the combustion process. Several plants had problems with their dust instruments. Suitable topics for future work include investigating how the measurement techniques mentioned above may be developed/improved and implemented at the plants.

  19. Adjustment of machine equipment in heating plants to facilitate addition of straw fuel; Anpassning av vaermeverksutrustning till halminblandning

    Energy Technology Data Exchange (ETDEWEB)

    Stridsberg, Sven [BIOSYD (Sweden)

    1999-10-01

    The ground of the project is a development work, carried out by BIOSYD according combustion of straw in heating plants. First we have handled combustion experiments with addition of straw in some plants working with wood fuels, mainly with good results. In the next step we have worked with new techniques for handling and delivery of straw to the plants, also including experiments with chopping of the straw on the field, storing it in outdoor uncovered piles and consequently delivered in the shape of 'chips' to the heating plant. The whole cycle from cutting to combustion has been checked. The results indicate a possible price of the straw at the heating plant of approx 85 SEK/MWh, which can easily compete with wood fuels. The present project will describe which adjustments of the machine equipment are needed to allow a 25 % addition of straw in the fuel mix, how much these adjustments will cost and if they should be profitable in competition with wood fuels for 110 SEK/MWh. In total 37 heating plants from Skaane up to Uppland have been visited and the process from fuel reception to combustion analyzed. The costs of adjustments needed have been calculated from similar examples. The main impression from the studies is that the fuel reception has too small volumes to allow more numerous kinds of fuel and specially make it possible to give a good mix. This is often not critical for wood fuels but for straw we must guarantee a good mix to get a good combustion. Other critical points are crossings between conveyors, for example dips and feeding out devices, which often have to be adjusted. In the combustion there is a risk for sintering as well as coatings on tubes and walls. These functions must be avoided by air distribution, feed back of fuel gas and better carbon removing. In our analyses we would have judged on results from practical tests, but as this would have been too extensive, we must trust in former experiences, transferred to respective plants. Our

  20. Increased electrical efficiency in biofueled CHP plants by biomass drying; Oekat elutbyte i biobraensleeldade kraftvaermeanlaeggningar med hjaelp av foertorkning

    Energy Technology Data Exchange (ETDEWEB)

    Berntsson, Mikael; Thorson, Ola; Wennberg, Olle

    2010-09-15

    In this report, integrated biofuel drying has been studied for two cases. One is the existing CHP plant at ENA Energi AB in Enkoeping and the other is a theoretical case. The thought plant is assumed to have a steam generating performance that is probable for a future CHP plant optimised for power production. The CHP plant at ENA Energi with its integrated bed drying system has been used as a model in this study. The plant has a grate fired boiler with the capacity to co-produce 24 MW electricity and 55 MW heat. It is designed to use biofuel with moisture content between 40 and 55 %. However, the boiler is able to manage even dryer fuels with the moisture content of about 35 % without complications. Since the boiler operates on part load during most of the season, there are free capacity which can be used for delivering heat to the drying system. The increased power production is a result of mainly two factors: Increased demand of heat as the dryer uses district heating and thus improved possibility to produce steam; and, The season of operation can be extended, since the point where the minimum load of the boiler occurs can be pushed forward as a result of increased demand of heat. For future CHP plants, an optimised plant has been used as a model. The steam data is assumed to be 170 bar and 540 deg C with reheating. For this plant, both on-site and offsite drying have been studied. The case study comprises a whole season of operation and the fuel is assumed to be dried from 50 to 10 %. The size of the optimised plant is as to fit the dimension of a main production unit in a district heating net equal to the tenth largest in Sweden. Heat delivery is assumed to be 896 GWh/year and the maximum heat delivery of district heating is 250 MW. The sizing of the boiler is made to maximise the production of electricity, and thus dependent of the drying strategy used. Flue gas condensation is assumed to be used as much as possible. It decreases the basis for power production

  1. NDT methods for life-time assessment of high temperature plant; Ofoerstoerande provning foer livslaengdsbedoemning av hoegtemperaturanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, J. [Swedish Inst. for Metals Research, Stockholm (Sweden)

    1996-10-01

    A comprehensive literature study of NDT and analysis methods for residual life-time assessment of high temperature plant has been made. The study has been concentrated on components in boilers, steam piping and turbines in fossil fired power plant. Most types of components are exposed to creep which is also the life-time limiting mechanism in many cases. In addition to creep, other stresses and damages which appear in plant are described for each type of component. Thermal fatigue, corrosion and embrittlement as well as combined damage mechanisms are also life-time limiting in many cases. The literature shows a large number of NDT methods developed and under development in purpose to identify and measure the size and extent of damage in the components. The methods and their limitations are described in relation to the experience and understanding of character, distribution and development of damage in different situations. 83 refs, 12 figs, 1 tab

  2. Evaluation of the first SCR-plants in Sweden; Utvaerdering av de foersta SCR-anlaeggningarna i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Hanell, B. [Vattenfall AB, Stockholm (Sweden)] [and others

    1996-05-01

    This report presents operational experience of SCR systems at five power plants in Sweden; the diesel cogeneration plants in Linkoeping, Oskarshamn, Skultuna and Visby and the coal fired power plant in Vaesteraas. The experience represents the first years of operation of the SCR systems. The SCR-systems involved in this project achieve the following: * Uneven flue gas flow and concentration of ammonia and NO{sub x} through the SCR reactor results in lower efficiency. Hence it is important to achieve a thorough mixing of the ammonia in the flue gas in order to achieve high NO{sub x} reduction efficiencies, * Inferior control systems can cause unnecessary ammonia slip, * The diesel plants with an operating time of a couple of thousand hours have had major problems with deposits on the catalyst surface, * Guarantees regarding the lifetime of the catalyst are important. At commissioning the catalyst has to be over-dimensioned since the system has to reach the guaranteed emissions during the whole guarantee period, * There should be enough space in the reactor to install additional catalyst layers. This project verifies that additional layers need to be installed at later stages, * The mechanical construction of the SCR-reactor is important. The efficiency decreases when there is a leakage of flue gases past the reactor, * No considerable amounts of N{sub 2}O are generated by the catalyst. 21 refs, 27 figs, 47 tabs

  3. Survey results of corroding problems at biological treatment plants; Kartlaeggning av vittrings- och korrosionsskador paa biologiska behandlingsanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Boubitsas, Dimitrios; Aakesson, Urban (CBI, Boraas (Sweden)); Hellstroem, Hanna; Henriksson, Gunilla (SP, Boraas (Sweden))

    2010-03-15

    Problems regarding that leachate from food waste have been corroding vehicles and concrete slabs has been reported by Biogas- and composting plants. This is an issue that has been reported to Swedish Waste Management more often within the same pace as the volume of food waste gathering is increasing all around Sweden. The problem has also been addressed at inspections according to SPCR 120 Biogoedsel and SPCR 152 Kompost, where several plants have requested guidance/support/investigation to help solve their specific issue. Swedish Cement and Concrete Research Inst., has earlier completed some investigations which have been ordered by private plant owners/municipalities and the result from these investigations have often proved that the exposure classification has not been adjusted for its purpose. There is no clear definition regarding construction of concrete that is meant for usage in a receiving hall for food waste. It is likely that concrete for Biogas- and Composting plants are built to meet the demands of agricultural environments. The project will examine the magnitude of the problem regarding corrosion- and weathering damage on concrete slabs and cisterns at biological treatment plants. The project will also culminate to actual solutions for plants that are hit and to give advice to those in the danger zone and those who plan for new constructions. Through a survey handed to Biogas- and composting plants around the country, the width of the problem has been examined and what solutions plants have found and executed to solve this issue. A literature review has been implemented to find specific demands regarding concrete that is meant for a certain environment. Another four treatment plants have been examined. The studies that have been made are chemical analysis of leachate from food waste, analysis of drill cores and analysis of reinforcement corrosion. The results from this project show that concrete doesn't have enough resistance in these

  4. The Great Invention Adventure

    Science.gov (United States)

    Hammontree, Kathleen

    2005-01-01

    Instead of a science fair, the author's intermediate school holds an invention convention. Guided by an Inventor's Log, students must problem solve, think creatively, and budget their time and resources to brainstorm and build an invention. The inventions are built at home, with parental support and supervision. Then, when everyone is ready, the…

  5. The Great Invention Adventure

    Science.gov (United States)

    Hammontree, Kathleen

    2005-01-01

    Instead of a science fair, the author's intermediate school holds an invention convention. Guided by an Inventor's Log, students must problem solve, think creatively, and budget their time and resources to brainstorm and build an invention. The inventions are built at home, with parental support and supervision. Then, when everyone is ready, the…

  6. Verdsetting av brukermedvirkning ved utforming av skoleanlegg

    Directory of Open Access Journals (Sweden)

    Else Margrethe Lefdal

    2015-03-01

    Full Text Available Ved planlegging av offentlige bygninger i Norge forutsettes det at brukerne medvirker i prosessen. Dette er forankret i lov- og avtaleverk og motiveres ved at brukerne innehar en kompetanse som er av betydning for byggenes funksjonalitet. I denne artikkelen vil jeg belyse brukermedvirkningsproblematikk i planleggingen av et skoleanlegg for videregående opplæring. Tilgjengelige plan- og byggesaksdokumenter i den aktuelle fylkeskommunens digitale og fysiske arkiver er blitt analysert. I referater fra brukermøtene fremmes det for eksempel ønsker fra brukerne om begrenset bruk av glass. Det ferdige skole-anlegget har imidlertid utstrakt bruk av innvendige glassvegger, men det er ikke dokumentert diskusjoner knyttet til bestemmelsen av dette. Et profesjons- og maktperspektiv er relevant for å forstå hva som blir verdsatt, og hvilke strukt-urer og mekanismer som har påvirket planleggings­prosessen. De sentrale aktørgruppene er skoleeier og representantene for lærer- og arkitekt-profesjonen. Omfattende bruk av innvendig glass i skoleanlegget tolker jeg som et kompromiss mellom skoleeiers ønske om åpenhet og kontroll, lærernes ønske om mindre støy og arkitektens ønske om å skape romfølelse og visuelle siktlinjer.AbstractWhen planning public buildings in Norway, it is expected that users are involved in the process. This is grounded in legislation and agreements, and motivated by the idea that users have an expertise which is significant for the planning of the building’s functionality. The aim of this article is to investigate user participation in planning the school facilities for a secondary school. I have analyzed planning and building documents available in government records, digital and physical. In the reports from meetings with user groups, it is for example stated that users want to limit the use of glass. However, the completed school building has extensive use of glass dividing walls, but any discussions leading to this

  7. Best possible cycle chemistry control in steam turbine plants; Baesta moejliga oevervakning av vattenkemin i anlaeggningar med aangturbin

    Energy Technology Data Exchange (ETDEWEB)

    Hellman, Mats [Hellman Vatten AB, Stockholm (Sweden)

    2004-11-01

    A project has been conducted of a large number of power and pulp plants in Sweden. Production managers and those responsible for water quality control were visited and interviewed. In addition, a research of cycle chemistry literature has been conducted to determine what has been done in other countries. The review of this literature shows that the Electric Power Research Institute in the USA and ESKOM in South Africa are in the forefront regarding QA/QC and have come a long way in water control management. A key requirement for successful plant cycle chemistry is corporate management support. The project makes it clear that cycle chemistry control was best at plants where production management was aware of the importance of high water quality. There is a real need for feed water technique and water quality education at all company levels. The objective should be that 'everyone should know the importance of right water quality'. Personnel without an education in chemistry often regard cycle chemistry as somewhat complicated. Better understanding and better working cycle chemistry control can be obtained by making the control easier and clearer for persons without training in chemistry. Extensive on-line instrumentation with well-designed systems for presenting the data, by-far, gives the best cycle chemistry control. It is important to have a holistic view when water treatment systems and on-line instrumentation are planned. It is not the amount of instruments or the number of chemistry personnel that is important. The important thing is to ensure that all functions needed fit together in the best way possible. Today, when cycle chemistry monitoring is heavily dependent on on-line instrumentation, the reliability of the instruments is crucial. Therefore, it is important to have well-established routines for maintenance, calibration and service. In order to decrease forced outages of plants due to poor cycle chemistry, the focus of chemistry control should

  8. Effects of slash extraction on plant diversity in forests. Final report; Effekter av grotuttag paa vaexters maangfald. Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Aastroem, Marcus; Nilsson, Christer [Umeaa Univ. (Sweden). Dept. of Ecology and Environmental Science

    2005-09-01

    This project includes three studies designed to investigate the effects of slash extraction on forest plant diversity. The first study explores the previously unknown effects of commercial slash harvest after clear-felling on bryophytes and vascular plants. Differences between conventionally harvested (i.e. slash left) and slash-harvested stands were investigated 5-10 years after clear-cutting through analysis of 28 paired stands. In each stand we studied vegetation patterns in 0.1 ha plots divided into five 0.02 ha subplots. Species composition of mosses and liverworts in 0.1 ha plots was significantly affected by slash harvest, whereas composition of vascular plant species showed no differences between conventional and slash harvested plots. Species richness of liverworts was significantly reduced by slash harvest in plots of both sizes (0.1 ha and 0.02 ha), whereas moss richness was reduced only in the smaller plot size. The loss of liverwort species was largest, with approximately one third of the species disappearing. The species richness of vascular plants was not significantly affected by slash harvest in either plot size. Slash harvest also reduced species richness of forest bryophytes and of bryophytes typically growing on organic substrates in open habitats. Species richness of non-forest bryophytes on inorganic substrates remained unchanged. The second study evaluates the effects of slash-cover on ground living bryophytes in seven different clear-cuts. By transplanting ten different species of bryophytes in manipulated plots located to north-facing forest edges and the centres of the clear-cuts) we evaluated the effects of branch cover and full exposure on bryophyte growth and vitality. In the more sheltered, north-facing plots there was no difference between treatments. In the centre of the clear-cuts, however, both growth and vitality of exposed bryophytes were significantly lowered in exposed compared to covered plots. The third study investigates the

  9. Incomplete invention of drugs.

    Science.gov (United States)

    Hisa, Tomoyuki

    2007-02-01

    Scientists seldom know the differences between "rejected invention", "non-invention", "incomplete invention", "invention yet to be completed" and "defective invention". The Japanese Supreme Court appointed me as a specialist member (Article 92-2, Code of Civil Procedure) of intellectual property division for medical and biological patents. Herein, I present scientists to the differences and which of them are patentable. In order to prevent oneself from being taken for granted for the scientists' noblesse oblige by clever business administrations, the scientists must know the borderline between patentable or non-patentable.

  10. Leisure Time Invention

    DEFF Research Database (Denmark)

    Davis, Lee N.; Davis, Jerome D.; Hoisl, Karin

    2013-01-01

    This paper studies the contextual factors that influence whether invention occurs during work time or leisure time. Leisure time invention, a potentially important but thus far largely unexplored source of employee creativity, refers to invention where the main underlying idea occurs while...... by adding to the discussion of how access to and exploitation of different types of resources—during work hours or during leisure time — may affect creativity. Based on survey data from more than 3,000 inventions from German employee inventors, we find that leisure time inventions are more frequently...... observed for conceptually based problems, in cases where interactions with people outside the organization are important for making the invention, and for smaller research and development projects. Our findings also suggest that employee inventions during work time may become more “embedded...

  11. Recommendations for replica testing of high temperature components in power plant; Rekommendationer foer replikprovning av hoegtemperaturkomponenter i kraftanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan [Det Norske Veritas AB, Stockholm (Sweden)

    2000-08-01

    Replica testing is a non-destructive testing method where the microstructure of the surface of a component is replicated. This involves careful metallographical preparation which in some points also should be adapted to the aims of the investigation. There are published guidelines for replica testing of high temperature components in power plant, for instance by Nordtest, but these may be considered to be insufficient to assure the required quality and reproducibility of the replicas. There are no certification systems for the replica method in Sweden as well as abroad and the experience has shown that differences in the performance that existing praxis can involve may give significant influence on the results when the replicas are evaluated. In the present project recommendations have been compiled for replica testing with regard to creep damage on occurring heat resistant steel types in Swedish power plants. The recommendations consist of guidelines for metallographical replication in the field and cover: - Test positions at weldments and pipe bends; - Equipment; - Rough and fine grinding; - Macro-etching; - Electrolytic and mechanical polishing; - Etching; - Replication; - Documentation and storage; - Personnel. They describe differences in the testing of the different materials and the purpose is to assure replica testing of the highest quality and reproducibility. The recommendations have been compiled by use of guidelines and company standards as a starting point. Some points in the recommendations refer to trials for verification which have been carried out within the frame of the project. The trials have been focused on the appearance of creep damage and microstructure in different established methods for polishing and etching. Comments and closer descriptions for some points of the test procedures are given in an appendix to the recommendations.

  12. Guideline for inspection of plant concerning creep below the limit temperature; Stoed vid besiktning av anlaeggningar avseende krypning under graenstemperaturen

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan; Bjurstroem, Henrik; Weilin Zang; Andersson-Frejd, Ulf

    2007-12-15

    In an earlier report from Vaermeforsk, Inspecta and AaF mapped the extent of the problem of creep damage in several components of steam systems in power plants, which systems operate at temperatures below the lower limit for creep. Recommendations were issued regarding inspection of components where creep damage may occur. The authorities have issued a new regulation, AFS 2005:3 regarding inspection of pressure vessels, extending the requirement for inspection against creep fracture down to 350 deg C. This extensive inspection and testing is though considered as costly by the plants. A simplified inspection routine has been requested so that status regarding creep in exposed components may be determined at a more reasonable cost. In the present follow-up project, the goal was to provide a more comprehensive basis for the recommendations on methods for identifying exposed components. This has included: Collecting information from the replica tests that have been carried out during 2006 and 2007 as a complement to the documentation in the earlier project; Verifying the usability of analyses of elastic stresses; Additional simulations with FEM with the purpose of identifying critical geometries of components and positions. Information has been gathered from 11 replica inspections during the last two years. Creep damage has been observed in every case. In two of them, micro and macro cracks were observed. Eight of the remaining nine had significant occurrences of creep cavities. Damage has occurred also below 450 deg C, which was hitherto unknown. Excessive temperatures may have occurred in one of the two cases; defects and high system stresses are the probable causes of the other case. Positions where the most severe creep damage was observed were not the same as those with the highest stresses in the elastic stresses analysis. Therefore, components which are prone to damage according to experience, e.g. T-joints, should also be tested, even if the utilisation is

  13. Invention, Rewriting, Usurpation

    DEFF Research Database (Denmark)

    2011-01-01

    Conference volume from the conference Invention, Rewriting, Usurpation. Discursive Fights over Religious Traditions in Antiquity, Aarhus / Ebeltoft May 30 - June 4, 2010.......Conference volume from the conference Invention, Rewriting, Usurpation. Discursive Fights over Religious Traditions in Antiquity, Aarhus / Ebeltoft May 30 - June 4, 2010....

  14. Invention, Rewriting, Usurpation

    DEFF Research Database (Denmark)

    2011-01-01

    Conference volume from the conference Invention, Rewriting, Usurpation. Discursive Fights over Religious Traditions in Antiquity, Aarhus / Ebeltoft May 30 - June 4, 2010.......Conference volume from the conference Invention, Rewriting, Usurpation. Discursive Fights over Religious Traditions in Antiquity, Aarhus / Ebeltoft May 30 - June 4, 2010....

  15. Inventors and Inventions.

    Science.gov (United States)

    Dawson, Tom

    An 8-day unit introduces middle school students to American inventors and inventions. In separate lessons, students examine the patenting process, women inventors, minority inventors, Native American inventors, the airplane, Thomas Edison, and the impact of inventions on America's growth. A brief outline of daily lesson plans precedes a section of…

  16. AV dissociation, an inevitable response.

    Science.gov (United States)

    Wang, Kyuhyun; Benditt, David G

    2011-07-01

    The independent activation of the atria and ventricles, AV dissociation, is a common phenomenon that occurs during a wide variety of electrophysiologic circumstances. The clinical significance of AV dissociation is often misunderstood. This article examines the basis and clinical implications of AV dissociation. AV dissociation is often an obligatory, secondary phenomenon, and should not be construed as the primary disorder; it may be due to either the AV conduction system being completely blocked (3° AV block) or the P wave and the QRS complex being generated from separate sources (usually, the AV junction or ventricle) but occurring close together during the physiologic refractory period of each other. The latter may happen in junctional or ventricular arrhythmias including escape or accelerated rhythm, tachycardia, or premature beats. The crucial clinical point is not the AV dissociation itself, but that an underlying triggering primary disorder is present and should be identified. ©2011, Wiley Periodicals, Inc.

  17. Summer Student Report - AV Workflow

    CERN Document Server

    Abramson, Jessie

    2014-01-01

    The AV Workflow is web application which allows cern users to publish, update and delete videos from cds. During my summer internship I implemented the backend of the new version of the AV Worklow in python using the django framework.

  18. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  19. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  20. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  1. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  2. Air supersaturation, release of wooden fibres and upstream migration of Atlantic salmon at Rygene power plant in the River Nidelva, Aust Agder county; Vurdering av luftovermetning, trefiberutslipp og oppvandring av laks ved Rygene kraftverk i Nidelva, Aust-Agder

    Energy Technology Data Exchange (ETDEWEB)

    Thorstad, Eva B.; Kroglund, Frode; Oekland, Finn; Heggberget, Tor G.

    1997-12-31

    Incidents of dead fish have been reported in connection with a power plant at Rygene on the River Nidelva in the Aust-Agder county, Norway. Air supersaturation has been used in a bypass construction of the power plant tunnel system. In addition, wooden fibres from a fabric have been released into the water of the tunnel. Results from relevant studies concerning air saturation, wooden fibres and upstream migration are summarised in this report. 148 refs., 4 figs., 2 tabs.

  3. Many and small or large and few? A comparison of the environmental effects of different strategies for the development of hydropower plants.; Mange og smaa eller store og faa? En sammenligning av miljoevirkningene ved ulike strategier for utvikling av vannkraft.

    Energy Technology Data Exchange (ETDEWEB)

    Bakken, Tor Haakon; Sundt, Haakon; Ruud, Audun

    2012-11-01

    This study compared the cumulative environmental impact of 27 small hydro power plants to the environmental impact of an average of three large hydropower plants, which range from the small farms and the average of the major producing about as much energy. Based on the empirical basis used in this study are the environmental impacts of large hydropower fewer and less severe than the cumulative environmental impacts from the 27 small plants. The results are, however marginal in favor of big hydro power plants and suffers from uncertainties due to lack of precision in the raw data, limitations of the methodic of accumulating environmental effects of many small facilities and extensive use of discretion in the transition between the scientific description of the environmental impacts and impact classes (Statens Vegvesen, 2006). The input data in the study has primarily been published available environmental impact assessment (KU). The results must therefore be said to have limited power statement in order to draw general conclusions. The identified environmental effects are to some extent, different from the type and size, so that an individual valuation and political or administrative priorities will to a large extent determine the preferred strategy for the development of hydropower. From 2012 promoted the production stimulating action as a result of common certificate market with Sweden. Small hydro power plants has so far been a priority in Norway, but when Norway implements EU Water Framework Directive in all areas of precipitation, one should be aware of our findings, especially regarding the potential in expanding of existing hydropower plants. (auth)

  4. The software invention cube: A classification scheme for software inventions

    NARCIS (Netherlands)

    Bergstra, J.A.; Klint, P.

    2008-01-01

    The patent system protects inventions. The requirement that a software invention should make ‘a technical contribution’ turns out to be untenable in practice and this raises the question, what constitutes an invention in the realm of software. The authors developed the Software Invention Cube (SWIC)

  5. The software invention cube: A classification scheme for software inventions

    NARCIS (Netherlands)

    J.A. Bergstra; P. Klint (Paul)

    2008-01-01

    htmlabstractThe patent system protects inventions. The requirement that a software invention should make ‘a technical contribution’ turns out to be untenable in practice and this raises the question, what constitutes an invention in the realm of software. The authors developed the Software Invention

  6. Consequences of emissions of NO{sub x} to air from a power heating plant. Evaluation of three alternatives, Fiborgtangen, Skogn; Konsekvenser av utslipp av NO{sub x} til luft fra kraftvarmeverk. Vurdering for tre alternativer, Fiborgtangen, Skogn

    Energy Technology Data Exchange (ETDEWEB)

    Hagen, Leif Otto; Aarrestad, Per Arild; Guerreiro, Christrina; Reitan, Ole; Skjelkvaale, Brit Lisa

    1999-07-01

    The Norwegian Institute for Air Research (NILU) , the Norwegian Institute for Water Research (NIVA) and the Norwegian Institute for Nature Research (NINA) have considered the consequences for the environment of NO{sub x} emissions from a power heating plant at Fiborgtangen, Skogn. Three alternatives have been considered, each of them with one (2003) and two (2005) units without cleaning of NO{sub x} emissions. Effects on air concentrations, acidification of water and impact on vegetation and fauna have been investigated. (Author)

  7. Introduction to AVS Audio

    Institute of Scientific and Technical Information of China (English)

    Hao-Jun Ai; Shui-Xian Chen; Rui-Min Hu

    2006-01-01

    This paper describes a general audio coding algorithm which has been recently standardized by AVS, China.The algorithm is based on a perceptual coding technique. The codec delivers near CD-quality audio at 128kb/s. This paper describes the coder structure in detail and discusses the reasons for specific design methods. A summary of the subjective test results are presented for the prototype codec. Comparison Mean Opinion Score (CMOS) test indicates that the quality of the AVS audio coder is comparable with MPEG Layer-3 audio coder. A real-time decoder was used for the characterization test,which is based on a 16-bit fixed-point DSP. The performance of the DSP solution was demonstrated, including computational complexity and storage characteristics.

  8. Accidental close-down of the Trollheim hydropower plant in July 2008. Effects on the fish populations in the river Surna; Utfall av Trollheim kraftverk i juli 2008. Effekter av fiskebestandene i Surna

    Energy Technology Data Exchange (ETDEWEB)

    Forseth, T.; Stickler, M.; Ugedal, O.; Sundt, H.; Bremset, G.; Linnansaari, T.; Hvidsten, N.A.; Harby, A.; Bongard, T.; Alfredsen, K.

    2009-01-15

    An accidental stop in the turbine in the Trollheim Hydropower Plant on 27th July 2008 caused a drop in downstream discharge in the River Surna from 21 to 3 m3/s during 100 min. River discharge was reestablished after three hours. The drop caused large dewatered areas (26 % of total wet area before the drop), but HEC-RAS simulations indicated that the ramping rates were relatively low (less than 20 cm per hour for the whole drop period in the modeled transects). Thus, a high proportion of the fish may have avoided stranding. Stranding mortality was estimated at approximately 14.000 0+ salmon and 3.600 older juveniles (70 % 1+), or the equivalent of approximately 3000 smolts. The loss constitutes less than 3% of the future smolt production downstream the power station (estimated by up-scaling from densities at electrofishing station, via mesohabitats to the whole river stretch) during 2009-2012. About one third of the smolts in the River Surna has been estimated to be produced in areas below the power plant. Between 3000 and 15 000 0+, and an unknown number of older brown trout likely also died from stranding, and the effect was probably larger for the juvenile population of brown trout than Atlantic salmon. All the above estimates are uncertain. Additional releases of water from the reservoir during, and one week after the drop, likely had no effects on the fish populations. The diversity of the zoobenthos communities in the river below the outlet of the power plant is low, likely due to large and frequent variation in discharge. The accidental stop in 2008 was probably particularly damaging, due to the large dewatered areas and low minimum discharge (far below the minimum allowed residual flow at 15 m3/s). This may temporarily reduce biomass and diversity of zoobenthos and thus prey availability for fish. Analysis of discharge data during the period from 2000 to 2008, show that despite measures implemented in the power plant (from 2006), there are several events

  9. Monitoring of caesium-137 in food plants and muscle from moose, red deer and wild reindeer in 2010.; Overvaaking av cesium-137 i beitevekster og kjoett av elg, hjort og villrein i 2010.

    Energy Technology Data Exchange (ETDEWEB)

    Veiberg, Vebjoern; Gaare, Eldar; Stokke, Sigbjoern; Solberg, Erling J.; Skuterud, Lavrans

    2011-07-01

    The monitoring of Cs-137 fall-out from the Chernobyl accident in 1986, started the same year. Several plants and wild reindeer in natural ecosystems in Nord-Rondane have been followed annually ever since. Four more wild reindeer ranges were included in 2001: Setesdal-Ryfylkeheiene, Hardangervidda, Nord-Ottadalen, Snoehetta and Nord-Rondane. From 2007 Forollhogna was also included. On fixed plots in Nord-Rondane and Snoehetta some of the reindeer forage plants, including both higher plants and fruticose lichens, have been sampled and analyzed annually since 1986. This was also done in 2010. In addition plants and lichens were sampled at five locations along an altitudinal gradient at Soendre Knutshoe, and at 7-8 locations along an east-west gradient from Kollaflata to Skarhoe in the Jora valley continuing along the Aursjoe to Torbudalen. All these locations were sampled annually between 1987-1990, but they have not been sampled since. In 2010 samples from red deer and moose was also collected from eight different regions located within the following counties: Oppland, Telemark, Vest-Agder, Rogaland, Sogn and Fjordane, Nord-Troendelag, Nordland and Troms. Red deer were sampled in four regions and moose in six. Both species were sampled in Oppland. In 2010 76, 49 and 61 samples were collected from wild reindeer, red deer and moose respectively. All measures of caesium levels were performed on dried samples. For the 596 samples of plants and lichen the results refer to caesium-levels in dried samples. For the meat samples, results refer to caesium-137 levels in raw meat. Due to large variation in measured levels of caesium within species and sampling area, we give median values instead of mean values.The highest caesium levels in wild reindeer were found in Snoehetta (1010 Bq/kg) and Nord-Rondane (2686 Bq/kg). The levels found in the other areas were considerably lower. The highest caesium levels in both red deer (Sel, 677 Bq/kg) and moose (Vaaga, 365 Bq/kg) were found

  10. L’invention instrumentale

    Directory of Open Access Journals (Sweden)

    Jacques Dewitte

    2011-03-01

    Full Text Available L’instrument de musique n’a pas d’identité déterminée avant qu’il ne soit joué par un musicien concret, ou utilisé dans une œuvre singulière. Pour Stravinsky, l’instrument de musique « n’est rien en soi ». C’est l’œuvre, comme invention et création, qui donne à l’instrument son identité, sur la base de propriétés organologiques préexistantes. Les œuvres de Stravinsky pour petite formation illustrent cette idée d’une invention de l’instrument de musique par l’œuvre qu’il joue, ainsi que son amour pour des instruments nouveaux ou « nouveaux pour lui » (le cymbalum. L’invention instrumentale (qui n’est pas ici création d’un nouvel instrument consiste à faire sonner de manière neuve un instrument déjà existant. Cette invention suppose une « érotique » musicale, un amour spécifique pour les instruments et les altérités dont ils sont porteurs. Tout se passe alors comme si un a priori (une possibilité musicale enfouie dans l’instrumentA musical instrument has no specific identity until it is played by a concrete musician or used in a singular work. According to Stravinsky, a musical instrument is « nothing in itself ». Only a work, as a process of invention and creation, gives an instrument its identity on the basis of pre-existing organologic properties. Stravinsky’s works for small ensembles show how musical instruments may be invented by the work which they play, as well as the composer’s love for instruments that are new or “new for him” (such as the cymbalo. Musical invention (which does not mean here the creation of a new instrument consists in giving a new ring to an existing instrument. This kind of invention implies a notion of musical “eroticism”, that is a specific love for instruments and the otherness they may bear. Everything is happening as though an a priori quality (a musical possibility buried in the instrument appeared only a posteriori

  11. Negotiation Mechanism of AVS Standardization

    Institute of Scientific and Technical Information of China (English)

    Su Junbin

    2007-01-01

    @@ 1. Introduction The mission of the Audio Video Coding Standard (AVS) Working Group of China is to develop AVS standards drafts and deliver them to the national standardization administration authorities. Since its establishment in 2002, the AVS Working Group has developed rapidly, growing from 33 members in 2003 to 153 in 2006. By the end of 2006, it had put forward for approval nine standards drafts (Table 1) with Part 2 of the AVS 1.0 draft approved as a national standard in February 2006.

  12. Gone with the wind: An analysis of the competition between suppliers of wind power plants in Sweden; Borta Med Vinden: En analys av konkurrensen melllan leverantoerer av vindkraftverk i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Roennborg, Petter [Goeteborg Univ. (Sweden). School of Economics and Commercial Law

    2003-05-01

    Introduction of wind power into the Swedish energy system started in the 1970s. Several R and D projects in technology development were initiated by the Swedish government. At the beginning the governmental projects were aimed at large-scale projects in the MW-range. However, the commercial breakthrough for wind power did not happen until the 1990s, mostly small-scale private initiatives supported by public subsidies. This led to the establishment of a number of new, foreign firms on the Swedish wind power market. The market is dominated by a few actors, who seem to have built special relations to other important players in the field. It is uncertain whether the competition between the actors in the field is functioning. The report presents the structure and economics of the wind power business in Sweden, and describes the owners, the networks and tendencies in the field. The study shows that the government has left a large part of the responsibility for reshaping the Swedish energy system to market forces, leaving the demand for wind power plants at a very low level. The concentration is high on the market, which can be characterized as an oligopoly, with limited competition. In spite of this fact, the price levels seem to be lower in Sweden than in other countries, mainly due to the (in an international comparison) very low Swedish electricity price. Further explanations to low level of wind power installation are: The stop-go policy in the support for renewable energy, and the difficulties in obtaining all necessary permits. The low demand and low prices has led to economic losses for several actors on the wind power market, and to the absence of new establishments on the market.

  13. Re-inventing Willis

    CERN Document Server

    Simkin, M V

    2006-01-01

    Scientists often re-invent things which were long known. Here we review these activities as related to the mechanism of producing power law distributions, originally proposed in 1922 by Yule to explain experimental data on the sizes of biological genera, collected by Willis. We estimate that scientists are busy re-discovering America about 2/3 of time.

  14. The Soul of Invention

    Science.gov (United States)

    Nelson, Scott Reynolds

    2013-01-01

    Technology shifts gears. The workers who control it need to learn how to shift gears, too. Workers brought up with universal schooling would respect authority, learn enough "geometry and mechanics" to use in their trades, keep invention alive, and finally see through "the interested complaints of faction and sedition." In other…

  15. Not-Invented-Here

    DEFF Research Database (Denmark)

    Burcharth, Ana Luiza Lara de Araújo; Fosfuri, Andrea

    knowledge, the so-called Not-Invented-Here (NIH) syndrome. Drawing on multi-informant survey data of small and medium-sized Danish enterprises, the paper finds that socialization practices are an important driver of the NIH syndrome with such an effect being attenuated in technologically highly specialized...

  16. Invention in the Classroom

    Science.gov (United States)

    Roman, Harry T.

    2004-01-01

    Invention offers many benefits as a unit of study. It teaches valuable process, subject integration, and critical thinking skills. It is especially relevant to American history. Over 60 percent of the annual growth in U.S. gross national product comes from technological advances. Technology is the cardiovascular system of the U.S. economy.…

  17. Not-Invented-Here

    DEFF Research Database (Denmark)

    Burcharth, Ana Luiza Lara de Araújo; Fosfuri, Andrea

    knowledge, the so-called Not-Invented-Here (NIH) syndrome. Drawing on multi-informant survey data of small and medium-sized Danish enterprises, the paper finds that socialization practices are an important driver of the NIH syndrome with such an effect being attenuated in technologically highly specialized...

  18. The Soul of Invention

    Science.gov (United States)

    Nelson, Scott Reynolds

    2013-01-01

    Technology shifts gears. The workers who control it need to learn how to shift gears, too. Workers brought up with universal schooling would respect authority, learn enough "geometry and mechanics" to use in their trades, keep invention alive, and finally see through "the interested complaints of faction and sedition." In other…

  19. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  20. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  1. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  2. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  3. Fuel on the Invention Funnel

    DEFF Research Database (Denmark)

    Leone, Maria Isabella; Reichstein, Toke; Boccardelli, Paolo

    In this paper, we examine the impact of technology licensing-in on firm invention performance. Studying a sample of 266 licensees and matched non-licensees using a two-part model specification, we find that licensees are more likely to introduce inventions than their non-licensee counterparts....... This holds both if we consider invention in general, and invention in the licensed technological class only. We also show that familiarity with the licensed technology and technological specialization drives licensees to pursue a narrow invention strategy primarily focusing on the technological class...

  4. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  5. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  6. Store Stokkavatn. Beskrivelse av forurensningssituasjonen

    OpenAIRE

    Holtan, H.

    1985-01-01

    Rapporten, som er et ledd i arbeidet med en vannbruksplan for Store Stokkavatn ved Stavanger, sammenstiller og diskuterer data som er samlet inn fra innsjøen og dens tilløp av Byveterinæretaten i Stavanger. Store Stokkavatnet er reservevannkilde for Stavanger og dessuten er innsjøen sentral i rekreasjonsmessig sammenheng. På bakgrunn av de foreliggende data, er innsjøens forurensningstilstand på grensen av det akseptable hva algeproduksjon (eutrofiering) og bakteriologiske forhold angår. Fler...

  7. G2 - G3 inventive properties, the first french nuclear plants; Caracteristiques generales et aspects originaux des reacteurs G2 et G3

    Energy Technology Data Exchange (ETDEWEB)

    Pascal; Horowitz; Bussac; Joatton; De Lagge de Meux; Martin [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    This paper points out the inventive properties of the frenchctors G2 and G3. These are dual purpose reactors, i.e. designed for the production of both plutonium and energy (30 electrical MW); in this respect, they can be considered as the start point of the french electrical energy produced from nuclear fuel. The following points are specially discussed in this paper: the choice of the prestressed concrete pressure vessel, the horizontal arrangement of the channels, the interest of neutron flux flattening, the advantages of the charging and discharging device working during pile operation. (author)Fren. [French] Les caracteres originaux des reacteurs fran is G2 et G3 sont decrits dans ce rapport. Ce sont des reacteurs a double fin, plutonigenes et aussi producteurs d'energie (30 MW electriques); ils constituent a ce titre le point de depart de la production fran ise d'electricite d'origine nucleaire. Sont discutes, en particulier, dans ce rapport: le choix du caisson en beton precontraint pour tenir la pression, la disposition horizontale des canaux, l'interet de l'aplatissement du flux neutronique, les avantages de l'appareil permettant le chargement et le dechargement du combustible sans arreter la pile. (auteur)

  8. Experiences from the Swedish programme - heavy water and natural uranium in the Aagesta cogeneration plant; Erfarenheter av den svenska linjen tungt vatten och naturligt uran i Aagesta kraftvaermeverk

    Energy Technology Data Exchange (ETDEWEB)

    Oestman, Alvar

    2002-11-01

    A short review of the Swedish programme for nuclear power in the 50's and the 60's is given, and in particular a description of the operating experiences of the Aagesta nuclear cogeneration plant, producing district heating for the south Stockholm area (12 MW{sub el} and 68 MW{sub heat}). The original Swedish nuclear programme was built on heavy water and natural uranium and had the objective to construct small nuclear plants in the vicinity of some 10 large cities in south and middle Sweden. Aagesta was the only full-scale plant to be built according to this programme, as Sweden adopted the light-water reactor policy and eventually constructed 12 large reactors at four sites. The report is based on the experiences of the author from his work at the Aagesta plant in the sixties. In an appendix, the experiences from Vattenfall (the Swedish electric utility which took over the operating responsibility for the Aagesta plant), of the plant operation is reviewed.

  9. Condition monitoring and thermoeconomic optimization of operation for a hybrid plant using artificial neural networks; Tillstaandsoevervakning och termoekonomisk driftoptimering av en hybridanlaeggning med artificiella neurala naetverk

    Energy Technology Data Exchange (ETDEWEB)

    Fast, Magnus; Assadi, Mohsen

    2007-12-15

    The project aim is to model the hybrid plant at Vaesthamnsverket in Helsingborg using artificial neural networks (ANN) and integrating the ANN models, for online condition monitoring and thermoeconomic optimization, at Vaesthamnsverket. The definition of a hybrid plant is that it uses more than one fuel, in this case a natural gas fuelled gas turbine with heat recovery steam generator (HRSG) and a biomass fuelled steam boiler with steam turbine. The project is a continuation of previous projects where ANN training was done with operational data from the plant. The ANN models have, if required, been updated to better suit the purpose of this project. The thermoeconomic optimization takes into account current electricity prices, taxes, fuel prices etc. and calculates the current production cost along with the 'predicted' production cost. The tool also has a built in feature of predicting when a compressor wash is economically beneficial. The user interface is developed together with co-workers at Vaesthamnsverket to ensure its usefulness. The user interface includes functions for warnings and alarms when possible deviations in operation occur and also includes a feature for plotting parameter trends in optional time intervals, both measured values and predicted. The target group is the plant owners and the original equipment manufacturers (OEM). The power plant owners want to acquire a product for condition monitoring and thermoeconomic optimization of e.g. maintenance. The OEMs main interest lies in investigating the possibilities of delivering ANN models along with their new gas turbines. The project has been carried out at Lund University, Department of Energy Sciences, with support from Vaesthamnsverket and Siemens. Vaesthamnsverket have contributed with operational data from the plant as well as support in plant related questions. They have also been involved in the implementation of the ANN models in their computer system and the development of the

  10. Better and more efficient collaboration for increased use of field fuel in heating plants; Baettre och effektivare samverkan foer oekad anvaendning av aakerbraenslen i vaermeverken

    Energy Technology Data Exchange (ETDEWEB)

    Arkeloev, Olof (Agrovaest, Skara (Sweden)); Hellstroem, Chris; Hollsten, Ronnie (KanEnergi Sweden AB, Skara (Sweden)); Lindh, Carina (LRF Konsult, Skara (Sweden))

    2010-05-15

    Despite that the potential for field fuels in SW Sweden is great and that the combustion characteristics of fuels are known, the interest for field fuels has been low from farmers and heating plants. The purpose of the project is to identify why the introduction of field fuel into heating plants is going so slow and to suggest possible solutions. Field fuel is missing the general structure and tradition that is found in forest fuels in terms of harvesting, processing, logistics and business models. The overall long-term objective is a better and more effective cooperation between heating plants, farmers and logistic companies for the increased use of field fuels in heating plants. The potential for field fuel in the area is great but won't be sufficient to cover the need. The raw materials that exist today and are deemed will be relevant in the future are willow, straw and grain kernel. We have divided the heating plants into two groups; Small plants with a furnace less than 35 MW, and large plants with an effect over 35 MW. Common to both small and large heating plants is that there must be a willingness to receive and combust field fuels for the share of field fuels to increase. For the small heating plants to be able to receive and combust field fuels the knowledge of the combustion properties of these fuels must increase. Larger heating plants have better opportunities to use field fuels in their boilers when it comes to the technology and the know how. They have a more controlled handling and receiving of fuels. It is not uncommon that storing and blending of fuels will take place at their own facility. They also have more experience of handling a larger number of suppliers at the same time. The heating plants would like to see standardization in terms of fuel characteristics, and they prefer to obtain approximately the same burning performance regardless of delivery date. Today, the small heating plants do not have the routines to manage multiple small

  11. Ceramic materials in hydroelectric power plants - testing and working out method descriptions. Prestudy; Keramiska material i vattenkraftanlaeggningar - test och utarbetande av metodbeskrivning. Foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Forssander, Maerit (TerraCorrosion AB (SE)); Persson, Charlotte (EnergoRetea, Stockholm (SE)); Carlsson, Roger (Vattenfall Power Consultant, Stockholm (SE)); Edwardson, Wille (Jaemtkontroll, Hammerdal (SE)); Johansson, Martin (Skellefteaa Kraft (SE)); Westerlund, Erik (Fortum Power and Heat OY (FI))

    2008-01-15

    Using ceramic materials for anti-corrosion painting in Swedish hydro power plants has been done with different results. In some cases it has performed well but in other it has failed. In only some cases the tests has been followed up rigorously to learn more about the process. The result from the interviews with the user and manufacturers is that there are cases where the use of ceramics in the hydro power plants will be economically favourable. The materials are there but they have to be tested in every single application before general recommendations can be done. A literature survey has been performed. Experiences from tests with ceramics in hydro power plants in Sweden have been summarised. Manufacturers on the Swedish market have been interviewed. The results from the literature survey showed that no published result was to be found of using ceramics in hydro electric power plants in the world. It is mentioned somewhere that Three Gorges in China have been using ceramics but no results was found. The conclusion is that even though the use of ceramics in hydro power plants can be economically favourable more tests has to be done. Those tests can be done together with the manufacturers in Sweden

  12. An evaluation of a farm scale biogas plant with a micro turbine for combined heat and power production; Utvaerdering av gaardsbiogasanlaeggning med mikroturbin foer kraftvaermeproduktion

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Nils; Edstroem, Mats; Hansson, Mikael (Swedish Inst. of Agricultural and Environmental Engineering, Uppsala (Sweden)); Algerbo, Per-Anders (HIR Malmoehus, Bjaerred (Sweden))

    2010-03-15

    The purpose of this study was to: To evaluate a farm scale biogas plant digesting energy and nutrient rich substrates at a high organic loading rate and biogas production using the biogas for combined heat and power production with a micro turbine. Put together technical, biological and economical documentation which can help farmers to investigate presumption to invest in a farm scale biogas plant for heat and power production. The farm scale biogas plant has an active digester volume of 450 m3 and the process temperature is ca 37 deg C. A micro turbine with 105 kW electrical and 160 kW thermal power is used for heat and power production. The produced electricity is sold to the grid and the heat is used on the farm for drying grain and heating two houses. The plant is digesting poultry manure and 2 substrates from the agriculture industry. All together the plant is digesting 3140 metric tons of substrates/yr and the substrates costs 160 k SEK/yr. Total investment for the plant is 4.7 M SEK. Produced head reduces the oil consumption at the farm with 15 m3 (value 100 k SEK/yr). There is a surplus of heat production of 600 MWh/yr. The production cost for the electricity is close to 0,66 SEK/kWh based on a value of the digestate of 100 SEK/ton together with an investment subsidy of 30 %. The production cost for the electricity is strongly depending on the value of the digestate. Hagavik is a crop production farm based on organic farming. If the valuation of the digestate is reduced to 50 SEK/ton, the production cost for the electricity increases to approx. 0.84 SEK/kWh (1 SEK is about 0.14 USD)

  13. Ice Forces on Offshore Wind Power Plants. Descriptions of mechanisms and recommendations for dimensioning; Islaster paa vindkraftverk till havs. Beskrivning av mekanismer och rekommendationer foer dimensionering

    Energy Technology Data Exchange (ETDEWEB)

    Bergdahl, Lars [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept of Water Environment Transport

    2002-02-01

    Mechanisms for ice-loads on off-shore wind power plants are described, The ice-loads are due to thermal expansion, water level variations, drifting ice and ice-reefing. Ice accretion is briefly treated. Ice instance, ice thickness, ice retention time, water level variations and stream velocities in Swedish waters are compiled. The main text deals with recommendations for dimensioning wind power plants at sea. In the appendices, a thorough review of the physical and mechanical properties of ice is presented.

  14. Expansion of Hitra wind-power plant - consequences related to wildlife except birds; Etterundersoekingar og konsekvens-utgreiingar for Hitra vindpark (Hitra 2). Naturmiljoe med unntak av fugleliv

    Energy Technology Data Exchange (ETDEWEB)

    Veiberg, V.; Pedersen, H.C.

    2010-02-15

    Hitra wind-power plant today consists of 24 wind turbines located at Eldsfjellet. The power plant was officially opened in October 2004 after approximately one year of construction work. As part of the establishment of the park, 20 km of roads with solid rock foundation was built. In addition, 25 km of earth cable was dug down, and a 10 km power line to Fillan was constructed. A second building step including between 15 and 25 new turbines and belonging infrastructure, is now being planned. In addition, about 10 km of new power line need to be built between the power plant and a new sub-sea power cable to Tjeldbergodden. One of the alternatives for the enlargement also includes construction of a new service road from the south. This report evaluates to what extent the present wind-power plant has had detectable consequences for the terrestrial fauna (except avifauna) at Eldsfjellet or in its surroundings. We also look into whether the establishment has had an impact on the hunting activity. Likely consequences of the next building step are evaluated for the same matters as the post-construction investigation. There are no indications that the construction of Hitra wind-power plant has caused lasting effects on the terrestrial fauna within the area of influence. For red deer, temporary avoidance of influence areas was registered during the construction period. This was not found to cause reduction neither in the harvest numbers, nor in the hunting related income for the various hunting areas. The construction of roads in relation to the power plant has been beneficial for the red deer hunt in the areas east, north and west of Eldsfjellet. The two suggested alternatives for enlargement of Hitra wind-power plant will to a varying degree affect attractive red deer habitats. These areas are also popular hunting grounds. The expected negative impacts from a power plant enlargement are mainly related to habitat loss due to technical installations and construction of roads

  15. EDITORIAL: INVENTING NEW PERSPECTIVES

    Directory of Open Access Journals (Sweden)

    Editor Al-Jami'ah: Journal of Islamic Studies

    2007-03-01

    Full Text Available One impact of globalization is that contemporary issues will rapidly come to fore. In fact, they frequently do not derive from Islamic knowledge or Islamic ethics. They even often do not go with Islamic identities. In sum, such issues will become a challenge for Islamic studies. Due to the challenges, it is notable to pose a question: whether viewpoints having been exercised by scholars in Islamic studies are workable for strong globalization stream or vice versa? Seemingly, if the perspectives do not stand for new global phenomenon, Islamic studies will be marginalized or put aside by both muslims and others. Accordingly, this is because of worldly affairs demand. Given this, efforts leading to the invention of new perspectives are urgent.

  16. Planning of biogas plants. A question of co-operation and negotiation; Planering av biogasanlaeggningar. En fraaga om samverkan och foerhandling

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Jamil

    2003-04-01

    During the last years there has been an increased interest in Sweden to build biogas reactors. The planning of a biogas plant brings about the need for co-operation between a variety of actors. Furthermore, there are a number of different issues that need to be dealt with. To build a biogas plant is thus a rather complicated thing to do. The aim of this report is to increase the knowledge about the processes that precede a decision to build a biogas plant, in order to try to facilitate the planning of future projects. The report is based on case studies of the planning of two biogas plants in Sweden and the empirical material consists of interviews with key persons as well as written documents. In the study, three parallel processes are identified and analysed, which are all crucial to carry through a project. These are the project planning process, the political process and the application process. The most important result of the study is that there is not only one way to carry through a project and that the choice of strategy depends on the character of the project and the different questions that need to be handled. Examples of other results are: the importance of an early and continuous dialogue with the political leadership, the necessity to build an organisation for the co-operation between key actors and that the project leaders should be flexible and open to changes in the project throughout the planning process.

  17. Ozone and climate - Effects of the excess of critical loads on birches and mountain plants; Ozon og klima - effekter av taalegrenseoverskridelser paa bjoerk og fjellplanter

    Energy Technology Data Exchange (ETDEWEB)

    Mortensen, L.M.

    1996-01-01

    The conference paper relates to the environmental effects of high concentrated ozone on the biomass production in Norway. The effects on birches and mountain plants from ozone together with the interaction between ozone and carbon dioxide and their influence on vegetation are discussed

  18. The SSI project on decommissioning of nuclear plants - a preliminary study; SSI:s projekt avseende avveckling av kaerntekniska anlaeggningar - en foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, Henrik; Ehdwall, H.; Godaas, T.; Hofvander, P.; Lindhe, J.C.; Lumpus, J.; Lund, I.; Malmqvist, L.; Welleman, E

    1999-01-01

    SSI will amend and complete regulations and stipulations for nuclear plants in order to take into account issues which arise in connection with decommissioning. The objective of a pilot study, performed during 1998, was to identify the questions at issue, what the authority should control and how SSI should proceed with the work. The recommendations and the result of the pilot study are presented in this report 29 refs.

  19. An Experiment in Teaching Invention

    Science.gov (United States)

    Clark, Andre

    2009-01-01

    Purpose: The purpose of this paper is to demonstrate that invention can be taught to business students who do not have the prior technical knowledge that is assumed to be a requirement for this kind of activity. Design/methodology/approach: This paper contains reflections on the results of introducing a specific course in inventing based on the…

  20. An Experiment in Teaching Invention

    Science.gov (United States)

    Clark, Andre

    2009-01-01

    Purpose: The purpose of this paper is to demonstrate that invention can be taught to business students who do not have the prior technical knowledge that is assumed to be a requirement for this kind of activity. Design/methodology/approach: This paper contains reflections on the results of introducing a specific course in inventing based on the…

  1. Fuel on the Invention Funnel

    DEFF Research Database (Denmark)

    Leone, Maria Isabella; Reichstein, Toke; Boccardelli, Paolo

    In this paper, we examine the impact of technology licensing-in on firm invention performance. Studying a sample of 266 licensees and matched non-licensees using a two-part model specification, we find that licensees are more likely to introduce inventions than their non-licensee counterparts. Th...

  2. Stages for Children Inventing Games

    Science.gov (United States)

    Butler, Joy

    2013-01-01

    This article offers practical advice for teachers interested in using Inventing Games (IG) as a way to facilitate learning about game structures, rules, and the principles of fair play that they can apply not only to game play, but to everyday life as members of a democratically organized society. Inventing Games gives students the opportunity to…

  3. Optimering av bergtransporter i underjordsgruva

    OpenAIRE

    Abrahamsson, Magnus

    2015-01-01

    Detta examensarbete utfördes på LKAB, en mineralkoncern som tillverkar och levererar järnmalmsprodukter. Arbetet utfördes för företagets underjordsgruva i Malmberget och behandlar tillredningens bergtransporter. Tillredningen är den process som förbereder nya delar av gruvan för järnmalmsbrytning. Målsättningen med arbetet har varit att kartlägga hur transporterna av tillredningsberg styrs samt att kvantifiera en besparingspotential för dessa transporter. Om möjligt skulle även förbättringsfö...

  4. Invention-driven marketing

    Science.gov (United States)

    Carlson, William E.

    1994-01-01

    Suppose you have just created a revolutionary bicycle suspension which allows a bike to be ridden over rough terrain at 60 miles per hour. In addition, suppose that you are deeply concerned about the plight of hungry children. Which should you do: be sure all hungry children have bicycles; transfer the technology for your new suspension to bicycle manufacturers worldwide; or start a company to supply premium sports bicycle based on your patented technology, and donate the profits to a charity which feeds hungry children? Woven through this somewhat trivial example is the paradox of technology transfer - the supplier (owner) may want to transfer technology; but to succeed, he or she must reformulate the problem as a user need for which there is a new and better solution. Successful technology transfer is little more than good marketing applied to an existing invention, process, or capability. You must identify who needs the technology, why they need it, why the new technology is better than alternatives, how much the customers are willing and able to pay for these benefits, and how to distribute products based on the technology tc the target customers. In market-driven development, the term 'technology transfer' is rarely used. The developers focus on studying user needs and designing solution They may have technology needs, but they don't have technology in search of a use.

  5. Energy savings in dust collector plants of bag house filter type. Phase 1 - Literature study; Energieffektivisering av anlaeggningar foer stoftrening med slangfilter. Etapp 1-Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Lars; Wikman, Karin; Berg, Magnus [AaF-Energi and Miljoe AB, Stockholm (Sweden)

    2004-01-01

    The largest energy demands in connection with the operation of bag house filters are the electric energy consumption for the fans, securing the flow of flue gas through the filter, and the electric energy consumption when producing the pressurized air (compressors or high pressure fans). Considering the significantly increased fan work when having a non-optimised cleaning of the filters, it seems justified to investigate the possibilities to minimise the unnecessary pressure drop. There is also a saving potential in the filter cleaning process, which otherwise may cost an unacceptable amount of pressurized air or other energy. The main purpose of this work is to develop methods to optimize the operation of bag house filters, which is started up with this report containing a follow-up of what has been done in Denmark and a confirmation of the technology status. In the next step, a case study where two-three plants are examined more in detail is suggested followed by a potential study to estimate the total energy saving potential in Sweden. Dust precipitation with bag house filters is basically a rather simple technique, which has existed in flue gas cleaning for about 50 years. From the literature study it can be established that there has been no revolutionary development in the field, but there are some work being done mainly to introduce new filter material but also to optimise the use of bag house filters with new computer based control systems. The largest potential of energy saving prevails if the filter from the beginning is overloaded, which usually is the case. The reason for overload may be a too large volume flow in relation to the filter area, that the dust has penetrated and blocked the filter, a defective filter cleaning process or that wrong filter material has been chosen. In Denmark a study has been made with the purpose to investigate the possibilities to optimise the energy consumption for bag house filters. For the three plants studied, an

  6. Environmental effects of large discharges of cooling water. Experiences from Swedish nuclear power plants; Miljoeeffekter av stora kylvattenutslaepp. Erfarenheter fraan de svenska kaernkraftverken

    Energy Technology Data Exchange (ETDEWEB)

    Ehlin, Ulf; Lindahl, Sture; Neuman, Erik; Sandstroem, Olof; Svensson, Jonny

    2009-07-15

    Monitoring the environmental effects of cooling water intake and discharge from Swedish nuclear power stations started at the beginning of the 1960s and continues to this day. In parallel with long-term monitoring, research has provided new knowledge and methods to optimise possible discharge locations and design, and given the ability to forecast their environmental effects. Investigations into the environmental effects of cooling-water are a prerequisite for the issuing of power station operating permits by the environmental authorities. Research projects have been carried out by scientists at universities, while the Swedish Environmental Protection Agency, the Swedish Board of Fisheries, and the Swedish Meteorological and Hydrological Institute, SMHI, are responsible for the greater part of the investigations as well as of the research work. The four nuclear power plants dealt with in this report are Oskarshamn, Ringhals, Barsebaeck and Forsmark. They were taken into operation in 1972, 1975, 1975 and 1980 resp. - a total of 12 reactors. After the closure of the Barsebaeck plants in 2005, ten reactors remain in service. The maximum cooling water discharge from the respective stations was 115, 165, 50 and 135 m3/s, which is comparable to the mean flow of an average Swedish river - c:a 150 m3/s. The report summarizes studies into the consequences of cooling water intake and discharge. Radiological investigations made at the plants are not covered by this review. The strategy for the investigations was elaborated already at the beginning of the 1960s. The investigations were divided into pre-studies, baseline investigations and monitoring of effects. Pre-studies were partly to gather information for the technical planning and design of cooling water intake and outlet constructions, and partly to survey the hydrographic and ecological situation in the area. Baseline investigations were to carefully map the hydrography and ecology in the area and their natural

  7. Institusjonelle felt og forståelser av evaluering – en analyse av evalueringen av NAV-reformen

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Hansen, Morten Balle

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av...... interessene som var involvert i evalueringen. I EVANAV ble dette blant annet ivaretatt i formuleringen av fire mål som tilgodeser ulike behov. Basert på evalueringsteori og teori om institusjonelle felt bidrar analysen til en bedre forståelse av hva evaluering er, og hvordan ulike utfordringer knyttet til...

  8. IVO`s CHP know-how: experience, inventions, patents

    Energy Technology Data Exchange (ETDEWEB)

    Aeijaelae, M.; Ohtonen, V. [ed.

    1997-11-01

    IVO can justly claim mastery in the co-generation of district heat and electricity - CHP. As well as looking at the issue from the viewpoint of planners, builders and operators, IVO`s engineers also view power plants through the eyes of the product developer and inventor. This approach has resulted in successful power plant configurations, inventions and patents and visions

  9. PAH i forurenset sediment: Utredning av egnethet av PAHkomponenter/ grupperinger for vurdering av tiltaksbehov

    OpenAIRE

    Ruus, Anders; Arp, Hans Petter Heinrich; Oen, Amy M.P.; Grung, Merete; Breedveld, Gijs D.

    2015-01-01

    I Norge er det utarbeidet klassegrenser for til sammen 16 PAH-forbindelser i sediment og vann. Grenseverdiene baserer seg på kunnskap om toksisitet av de ulike stoffene og hva som er akseptabel eksponering for miljøet. I tillegg til grenseverdiene for enkeltkomponentene av PAH opererer norske miljømyndigheter med klassegrenser for PAH-grupperingen SUM PAH-16 i sediment. Disse klassegrensene bygger på overkonsentrasjoner i forhold til bakgrunnsnivå, og ikke økotoksikologiske dat...

  10. Bruk av kartleggingsresultater i forbedringsarbeid

    DEFF Research Database (Denmark)

    Nordahl, Thomas; Hansen, Line Skov

    . Barnehagen har gjerne tilgang på informasjon fra kartlegginger, men det er ikke alltid denne informasjonen blir systematisk analysert og aktivt brukt i forbedringsarbeid. Forfatterne viser hvordan slike analyser kan gjennomføres på forskjellige nivåer i den enkelte barnehage, og vektlegger viktigheten av...

  11. The effect of vehicle exhausts on crops and other utility plants close to roads; Trafikavgasers effekter paa groedor och andra nyttovaexter i naerheten av vaegar

    Energy Technology Data Exchange (ETDEWEB)

    Pleijel, H.; Ahlfors, A.; Skaerby, L.; Pihl Karlsson, G.; Sjoedin, Aa.

    1993-11-01

    This report summarizes the present knowledge concerning the impact of automobile exhausts on plants and the research carried out at IVL in this field during the period 1988-1991. The investigations carried out at motorway E6 south of Gothenburg show: * that the concentrations of ethylene are high enough to cause pronounced effects on the bio indicator petunia, * that the ozone concentrations in the vicinity of the motorway are lower than the regional background concentrations, which was reflected in significantly less visible ozone injury on the ozone bio indicator, subterranean clover, close to the motorway after an ozone episode, * that the less ozone sensitive red clover, in contrast to subterranean clover, showed stimulated growth with increasing distance from the motorway, * that there was a tendency towards higher yields for cereals in the vicinity of the motorway, but the extent of and cause for this growth stimulation is not known at present. The effects of metals from catalytic converters is as yet uncertain, as is the understanding of effects of nitrogen oxides. 45 refs, 16 figs, 7 tabs

  12. Effects of small hydropower plants on low-and moss flora. A feasibility study; Virkninger av smaa vannkraftverk paa lav- og mosefloraen: en forundersoekelse

    Energy Technology Data Exchange (ETDEWEB)

    Ihlen, Per G.; Bjelland, Torbjoerg; Vaskinn, Kjetil; Johnsen, Geir Helge

    2012-07-01

    We have established a list of lichen- and moss flora of a waterway to be developed for hydropower production (Vangjolo) and in a control water system (Roesgrovi), both in Voss in Hordaland. The waterways have similar bedrock, exposure, vegetation and elevation. To monitor any change in the flora, it was laid out 20 fixed routes from each river systems where low-and moss flora were recorded. To relate this to the monitoring of potential impacts, l flow, humidity, air temperature, water temperature and dew point temperature were logged. It was recorded 66 species total for Roesgrovi and Vangjolo, and 32 mosses, 29 lichens and 5 vascular plants. The results show that the rivers are so similar to the low-and moss flora that they can form the basis for further investigations. This is also shown by the DCA-analyses. The waterways comprises a combination of species with the same requirements as to moisture, and contains species of high and low Ellenberg indicator values for moisture. There is no statistically significant difference between Roesgrovi and Vangjolo in the fixed routes average values. The hydrological and local climatic measurements also show that the river systems are comparable for further study of possible changes after development. (eb)

  13. INVENTIVENESS AND SCIENTIFIC RESEARCH WORK

    Directory of Open Access Journals (Sweden)

    Kostadin S. Tričković

    2003-04-01

    Full Text Available The concept of invention and of its components is explained as a form of creativity and creation of something new. Likewise, the essence of the scientific work is also viewed as an activity aiming at discovering new knowledge and its use for new changes. The importance of invention and scientific research work is stressed for economy and development of the country. The personality of the inventor and of the scientific research worker is described as the subject of inventiveness and creativity. Of special consideration are scientific research workers of universities and scientific institutions as possible inventors; the accompanying recommendation refers to the need for transforming a scientific result into a contrivance. A critical view of our society and economy is given regarding results and application of the inventions and science in practice as well as suggestions for correcting the present attitudes.

  14. Production Planning with Respect to Uncertainties. Simulator Based Production Planning of Average Sized Combined Heat and Power Production Plants; Produktionsplanering under osaekerhet. Simulatorbaserad produktionsplanering av medelstora kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Haeggstaahl, Daniel [Maelardalen Univ., Vaesteraas (Sweden); Dotzauer, Erik [AB Fortum, Stockholm (Sweden)

    2004-12-01

    Production planning in Combined Heat and Power (CHP) systems is considered. The focus is on development and use of mathematical models and methods. Different aspects on production planning are discussed, including weather and load predictions. Questions relevant on the different planning horizons are illuminated. The main purpose with short-term (one week) planning is to decide when to start and stop the production units, and to decide how to use the heat storage. The main conclusion from the outline of pros and cons of commercial planning software are that several are using Mixed Integer Programming (MIP). In that sense they are similar. Building a production planning model means that the planning problem is formulated as a mathematical optimization problem. The accuracy of the input data determines the practical detail level of the model. Two alternatives to the methods used in today's commercial programs are proposed: stochastic optimization and simulator-based optimization. The basic concepts of mathematical optimization are outlined. A simulator-based model for short-term planning is developed. The purpose is to minimize the production costs, depending on the heat demand in the district heating system, prices of electricity and fuels, emission taxes and fees, etc. The problem is simplified by not including any time-linking conditions. The process model is developed in IPSEpro, a heat and mass-balance software from SimTech Simulation Technology. TOMLAB, an optimization toolbox in MATLAB, is used as optimizer. Three different solvers are applied: glcFast, glcCluster and SNOPT. The link between TOMLAB and IPSEpro is accomplished using the Microsoft COM technology. MATLAB is the automation client and contains the control of IPSEpro and TOMLAB. The simulator-based model is applied to the CHP plant in Eskilstuna. Two days are chosen and analyzed. The optimized production is compared to the measured. A sensitivity analysis on how variations in outdoor

  15. Analyse av klimatilpasningstiltak : en casestudie av overvannsnettet på Bogafjell i Sandnes kommune

    OpenAIRE

    Bekkum, Ina

    2012-01-01

    For å simulere klimaendringenes effekt på avløpssystemet og klimatilpasningstiltakenes avbøtende virkning kan man benyttes seg av urbanhydrologiske avløpsmodeller. I denne oppgaven er det gjennomført et casestudie av overvannsnettet på Bogafjell i Sandnes kommune. Det er gjort simuleringer av enkeltregn i form av symmetriske nedbørshyetogram, med og uten klimatillegg – i Rosie/ArcGIS med MOUSE beregningsmotor – for å teste tiltaksprinsipper som frakopling av overvann, fordrøyning av ...

  16. Transmembrane potentials of canine AV junctional tissues.

    Science.gov (United States)

    Tse, W W

    1986-06-01

    The atrioventricular (AV) junction comprises the AV node, His bundle (HB), and specialized tissues proximal to the node called paranodal fibers (PNF). In the present study, an in vitro, dissection-exposed canine right atrial (RA), transitional fiber (TF), AV junctional preparation was used. The TF and PNF formed a pathway running along the base of the septal cusp of the tricuspid valve (SCTV). In the first experiment, impulses elicited at the RA were monitored to propagate sequentially through the TF, PNF, AV node, and then the HB. This functional evidence supports the concept that a conduction pathway connecting the RA and the AV node exists along the base of the SCTV. This internodal pathway is referred to as the septal cusp pathway. In another experiment, transmembrane potentials and Vmax were determined on each of the AV junctional tissues. Results showed that PNF had the lowest Vmax (2.5 V/sec), followed by AV node (7.0 V/sec) and HB (33 V/sec). This finding showed that PNF, and not the AV node, has the lowest Vmax, suggesting that the PNF has the lowest conductivity among the AV junctional tissues, and this study advances our understanding on the mechanism of AV conduction delay in dog hearts.

  17. Evaluering av ABW-filter

    OpenAIRE

    Ohren, J.A.

    1986-01-01

    Det er foretatt en evaluering av ABW-filteret basert på forskningsresultater og driftserfaringer fra USA. ABW-filteret er godt egnet med sand eller sand-antrasitt i konvensjonelle fullrenseanlegg med flokkulering, sedimentering og filtrering. Etter disse prosessene er filteret også egnet med aktivt kull. ABW-filteret er også interessant for etterbehandling i kommunale og industrielle avløpsrenseanlegg.

  18. 43 CFR 6.53 - Unpatented inventions.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Unpatented inventions. 6.53 Section 6.53... Unpatented inventions. The Secretary of the Interior may also have transferable interests in inventions which... benefit of the public, a license may be granted with respect to such an invention only if (a) a patent...

  19. Invention through Form and Function Analogy

    Science.gov (United States)

    Rule, Audrey C.

    2015-01-01

    "Invention through Form and Function Analogy" is an invention book for teachers and other leaders working with youth who are involving students in the invention process. The book consists of an introduction and set of nine learning cycle formatted lessons for teaching the principles of invention through the science and engineering design…

  20. Environmental monitoring program for the Ormen Lange Onshore Processing Plant and the Reserve Power Plant at Nyhamna, Gossa. Monitoring of vegetation and soil: re-analyses and establishment of new monitoring plots in 2010.; Miljoeovervaakingsprogram for Ormen Lange landanlegg og Reservegasskraftverk paa Nyhamna, Gossa. Overvaaking av vegetasjon og jord: gjenanalyser og nyetablering av overvaakingsfelter i 2010

    Energy Technology Data Exchange (ETDEWEB)

    Aarrestad, P.A.; Bakkestuen, V.; Stabbetorp, O.E.; Myklebost, Heidi

    2011-07-01

    The Ormen Lange Onshore Processing Plant in Aukra municipality (Moere og Romsdal county) receives unprocessed gas and condensate from the Ormen Lange field in the Norwegian Sea. During processing of sales gas and condensate, the plant emits CO, Co2, Nox, CH4, NMVOC (including BTEX), SO2 and small amounts of heavy metals, as specified in the discharge permit issued by the Climate and Pollution Directorate. The plant started production in 2007, with A/S Norske Shell as operator. In general, emissions of nitrogen and sulphur-containing gasses may affect terrestrial ecosystems through acidification and fertilization of soil and vegetation. The emissions from the onshore plant are calculated to be below the current critical loads for the terrestrial nature types. However, the nitrogen background level in the area of influence is close to the critical loads for oligotrophic habitats. To be able to document any effects of emissions to air on terrestrial ecosystems, a monitoring program for vegetation and soil was established in 2008 in the area of influence from the Ormen Lange Onshore Plant. The monitoring is planned at regular intervals according to the same methods employed in 2008, with the first reanalysis in 2010. The benefits of the monitoring parameters will be continuously evaluated. Statnett has established a Reserve Power Plant with discharge permits of similar substances in the same area as the Ormen Lange Onshore Processing plant, and participates in an extended monitor program from 2010. In 2008 two monitoring sites were established, one with rather high deposition of nitrogen north of the plant within Gule-Stavmyran nature reserve in Fraena municipality (site Gulmyran) and one south of the plant on the island Gossa (site Aukra). Deposition values have been estimated by the Norwegian Institute for Air Research (NILU). Within each site integrated monitoring of the species composition of the vegetation, plant growth, and chemical content of plants and soil is

  1. Multimedia for læring av tallsystemer : utvikling av programvare for læring av og om tallsystemer

    OpenAIRE

    Idland, Terje

    2006-01-01

    Oppgaven har en teoretisk forankring innenfor Piagets konstruktivisme, Vygotskys sosialkonstruktivisme, Dienes teori for læring av posisjonssystemet og Mayer & Morenos teori for læring med multimedia. Primært har jeg brukt eksisterende teori som grunnlag for utvikling av pedagogisk programvare for læring av tallsystemer. Denne programvaren er todelt. En del er en interaktiv applett som er et utforskingsmiljø for posisjonssystemet. Den andre delen er en interaktiv multimediep...

  2. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  3. Effekten av karbohydrat- og proteininntak på restitusjon av utholdenhetskapasiteten etter et utmattende arbeid

    OpenAIRE

    Rustad, Per Inge

    2011-01-01

    Innledning: Dietten i etterkant av trening og konkurranser er av stor betydning for restitusjonsprosessen. Få studier har imidlertid undersøkt restitusjonseffekten av karbohydratog proteininntak etter et utmattende arbeid på utholdenhetskapasiteten dagen etter. I vår studie ble det gjennomført totalt tre diettintervensjoner for å undersøke følgende problemstillinger; 1) undersøke utholdenhetskapasiteten dagen etter et utmattende utholdenhetsarbeid etter inntak av en høy karbohy...

  4. How easy the invention is

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yeon Jung

    2002-05-15

    This book deals with the inventions invented by kids such as a utility helmet, a useful drawing board, automatic safe device, telephone for the blind, a peaceful washboard, roly poly milk bottle, seat belt with height control, gas hose to prevent thief, portable magic soap, useful bus handle, convent desk, a paper cup attached a spoon, a useful washboard, dressing room using moveable small cymbals, fluorescent light which is easy to put in a new one, rods for night, curtain for cars, spray shampoo, and a good calendar.

  5. AVS-M: From Standards to Applications

    Institute of Scientific and Technical Information of China (English)

    Ye-Kui Wang

    2006-01-01

    AVS stands for the Audio Video coding Standard Workgroup of China, who develops audio/video coding standards as well as system and digital right management standards. AVS-M is the AVS video coding standard targeting for mobile multimedia applications. Besides the coding specification, AVS also developed the file format and Real-time Transport Protocol (RTP) payload format specifications to enable the application of AVS-M video in various services. This paper reviews the high-level coding tools and features of the AVS-M coding standard as well as the file format and payload format standards.In particular, sixteen AVS-M high-level coding tools and features, which cover most of the high-level topics during AVS-M standardization, are discussed in some detail. After that, the error resilience tools are briefly reviewed before the file format and RTP payload format discussions. The coding efficiency and error resiliency performances of AVS-M are provided finally.H.264/AVC has been extensively used as a comparison in many of the discussions and the simulation results.

  6. Neither invented nor shared here

    DEFF Research Database (Denmark)

    Burcharth, Ana Luiza de Araújo; Knudsen, M. P.; Søndergaard, Helle Alsted

    2014-01-01

    against the sourcing of external knowledge (the Not-invented-here (NIH) syndrome) and against the external exploitation of knowledge assets (the Not-shared-here (NSH) syndrome). Using survey data collected from 331 firms, this article empirically assesses the theoretical assertion that the NIH and NSH...

  7. The AV-8B Decision

    Science.gov (United States)

    1982-06-01

    isa csestudy of the debate overthdeionfte United States Gover mn to prc--u the McDonnell Douglas AV-8B Advanced Hrrier V/STOL jet aircraft for the U.S...Sciences 3 ABSTRACT This thesis is a case study of the debate over the decision of the United States Government to procure the McDonnell Douglas IT-8...a egrate4 dur nq the 1ive To r perIoo by the introduction of the moderNtely prcod F1-18 aircraft. The F/1 8 proqrts will, 0euce to*n uber and tpes of

  8. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  9. The Invention of "The Invention of Hugo Cabret"

    Science.gov (United States)

    Selznick, Brian

    2008-01-01

    "The Invention of Hugo Cabret" is a story about Georges Melies that the author began thinking about over 15 years ago and took about two-and-a-half years to complete. The book is about a boy named Hugo Cabret, an orphan living secretly in the walls of a train station in Paris who becomes involved in a mystery that ties him together with a mean old…

  10. The Invention of "The Invention of Hugo Cabret"

    Science.gov (United States)

    Selznick, Brian

    2008-01-01

    "The Invention of Hugo Cabret" is a story about Georges Melies that the author began thinking about over 15 years ago and took about two-and-a-half years to complete. The book is about a boy named Hugo Cabret, an orphan living secretly in the walls of a train station in Paris who becomes involved in a mystery that ties him together with a mean old…

  11. Syncope and Idiopathic (Paroxysmal) AV Block.

    Science.gov (United States)

    Brignole, Michele; Deharo, Jean-Claude; Guieu, Regis

    2015-08-01

    Syncope due to idiopathic AV block is characterized by: 1) ECG documentation (usually by means of prolonged ECG monitoring) of paroxysmal complete AV block with one or multiple consecutive pauses, without P-P cycle lengthening or PR interval prolongation, not triggered by atrial or ventricular premature beats nor by rate variations; 2) long history of recurrent syncope without prodromes; 3) absence of cardiac and ECG abnormalities; 4) absence of progression to persistent forms of AV block; 5) efficacy of cardiac pacing therapy. The patients affected by idiopathic AV block have low baseline adenosine plasma level values and show an increased susceptibility to exogenous adenosine. The APL value of the patients with idiopathic AV block is much lower than patients affected by vasovagal syncope who have high adenosine values. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Review of AVS Audio Coding Standard

    Institute of Scientific and Technical Information of China (English)

    ZHANG Tao; ZHANG Caixia; ZHAO Xin

    2016-01-01

    Audio Video Coding Standard (AVS) is a second⁃generation source coding standard and the first standard for audio and video coding in China with independent intellectual property rights. Its performance has reached the international standard. Its coding efficiency is 2 to 3 times greater than that of MPEG⁃2. This technical solution is more simple, and it can greatly save channel resource. After more than ten years ’develop⁃ment, AVS has achieved great success. The latest version of the AVS audio coding standard is ongoing and mainly aims at the increasing demand for low bitrate and high quality audio services. The paper reviews the history and recent develop⁃ment of AVS audio coding standard in terms of basic fea⁃tures, key techniques and performance. Finally, the future de⁃velopment of AVS audio coding standard is discussed.

  13. Tolkning av det verbala och det visuella

    Directory of Open Access Journals (Sweden)

    Barbro Sjöberg

    2011-12-01

    Full Text Available I en tidigare publicerad artikel i Techne serien (Sjöberg, 2005 gjordes en genre-beskrivning av fenomenet skissbok. Genrebeskrivningen baserade sig på en analys av sex formgivarstuderandes skissböcker. I den nu aktuella artikeln redogörs för hur genren tillämpats i en slöjdpedagogisk kontext inom två kurser i Konsthand-arbete under åren 2002 respektive 2004 inom de didaktikbaserade ämnesteknolo-giska studierna i slöjdpedagogik vid Åbo Akademi, Vasa. En av målsättningarna för kurserna var att testa skissboken i en slöjdpedagogisk kontext. Under kursens gång hade de studerande som uppgift att utforska och dokumentera ett givet tema i sina skissböcker. Efter avslutad kurs skannades skissböckerna in för att utgöra empiriskt material för tolkning och analys av hur de studerande utformat dokumen-tationen i sina skissböcker på basen av de instruktioner de fått under kursens gång. I föreliggande studie redogörs för bearbetning, tolkning och analys av det empiris-ka materialet med hjälp av NVivo 9, en version av NVivo som underlättar bearbet-ning och den vetenskapliga tolkningen av visuellt material. Resultaten visar att uppmuntran till horisontell mediering i samband med dokumentation i skissbok kan leda till en mångsidig och personlig utforskning av givet tema.Sökord: metod, slöjd, NVivo, skissbok, lärarutbildningURN:NBN:no-29968

  14. Accelerating Science TRIZ inventive methodology in illustrations

    CERN Document Server

    Seraia, Elena

    2016-01-01

    Theory of Inventive Problem Solving (TRIZ) is a powerful tool widely used in engineering community. It is based on identification of a physical contradiction in a problem, and based on the corresponding pair of contradicting parameters selecting a few of suitable inventive principles, narrowing down the choice and leading to a much faster solution of a problem. It is remarkable that TRIZ methodology can also be applied to scientific disciplines. Many of TRIZ inventive principles can be post factum identified in various in scientific inventions and discoveries. However, additional inventive principles, more suitable for scientific disciplines, should be introduced and added to standard TRIZ, and some of the standard inventive principles need to be reformulated to be better applicable to science - we call this extension Accelerating Science TRIZ. In this short note we describe and illustrate the AS-TRIZ inventive principles via scientific examples, identifying AS-TRIZ inventive principles in discoveries and inv...

  15. Påvising av aminoglykosidresistens ved hjelp av massespektrometri. Utvikling av metode for deteksjon, stabilitet av aminoglykosid og molekylær karakterisering av teststammer

    OpenAIRE

    Kvarekvål, Torunn

    2014-01-01

    Aminoglykosid er potente antibiotika som vert brukt til behandling av alvorlege infeksjonar med aerobe bakteriar. Dei er baktericide og verkar ved å binda til ribosoma i bakteriane og på denne måten forstyrra den normale peptidsyntesen. Aminoglykosida er verdifulle medikament, men som for mange andre antibiotika er resistens mot desse midla eit aukande problem. Den viktigaste resistensmekanismen er aminoglykosidmodifiserande enzym (AME). Desse enzyma inaktiverer ...

  16. Inventory of contaminants in waste wood; Inventering av foeroreningar i returtrae

    Energy Technology Data Exchange (ETDEWEB)

    Jermer, Joeran; Ekvall, Annika; Tullin, Claes [Swedish National Testing and Research Inst., Boraas (Sweden)

    2001-03-01

    Waste wood is increasingly used as fuel in Sweden. It is of Swedish origin as well as imported, mainly from Germany and the Netherlands. The waste wood is contaminated by e.g. paint and wood preservatives and objects of metal, glass, plastics etc. The contaminants may cause technical problems such as deposits and corrosion as well as plugging of air openings. The present study has focussed on potential contaminants in waste wood that could cause problems of technical as well as environmental nature. The major chemical contaminants are surface treatments (paints etc) and wood preservatives. The surface treatments contribute in particular to contaminants of zinc and lead. In some cases zinc has been found to cause severe deposits in the furnaces. Surface treatments also contribute to increased levels of sodium, chlorine, sulphur and nitrogen. Preservative-treated wood is the most important source of increased levels of copper, chromium and arsenic in the waste wood. Waste wood imported from Germany contains less arsenic but the same amount of copper and chromium as Swedish waste wood. The contents of mercury in German waste wood can be expected to be higher than in waste wood of Swedish origin. The fraction consisting of wood-based panels is comparably free from contaminants but as a result of the high contents of adhesives wood-based panels contribute to a higher proportion of nitrogen in waste wood than in forest residues. A great number of non-wood compounds (such as plastics and metals) do also contaminate waste wood. By careful and selective demolition and various sorting procedures most non-wood compounds will be separated from the waste wood. Waste sorting analyses carried out indicate that the waste wood contains approximately 1% non-wood compounds, mainly plastic and metal compounds, glass, dirt, concrete, bricks and gypsum. This may seem to be a small proportion, but if large amounts of waste wood are incinerated the non-wood compounds will inevitably cause problems. Metal objects of zinc, brass and aluminium are considered to be particularly troublesome as they may plug primary air openings. PVC residues may cause considerably higher levels of chlorine in waste wood. Chemical analyses indicate that the distribution in levels of impurities varies a lot between deliveries of waste wood. Difficulties to take representative samples probably contribute to this. The knowledge of the contents of different types of waste wood (surface treated wood, preservative-treated, panels, furniture etc) in the waste wood flow is only fragmentary. Most certainly, surface treated (painted, stained etc) wood constitute the highest proportion. Preservative-treated wood, with the exception of railway sleepers and poles, is estimated to constitute approximately 5% of the waste wood flow in Sweden today and the next 25-30 years. The study has confirmed previous studies that waste wood contains a substantial proportion of fine fraction. 25-40% of the waste wood passed a sieve with a mesh size of 4 mm at screening trials. Chemical analyses indicated that the fine fraction will be the main contributor to contaminants of potassium, chlorine, sodium, zinc and lead. Further studies are suggested to focus on sorting, preparation, classification and quality assurance of waste wood.

  17. Inventory of mammals at Forsmark and Haallnaes; Inventering av daeggdjur i Forsmark och Haallnaes

    Energy Technology Data Exchange (ETDEWEB)

    Truve, Johan [Svensk Naturfoervaltning AB, Goeteborg (Sweden)

    2012-08-15

    A selection of terrestrial mammals was surveyed in the SKB site investigation areas near Forsmark and Haallnaes between January and April 2012. The methods that were used include snow tracking along line transects, snow tracking along water, aerial survey and fecal pellet counts. The same species were found in 2012 as in previous surveys performed in 2002, 2003 and 2007. Some species show a large variation in density between years and it is difficult to draw any conclusions about their long term development. Several carnivores, i.e. lynx, fox and otter show a positive growth rate in both areas. The wild boar population is also growing whilst moose density remains fairly stable and roe deer are becoming less numerous.

  18. Humanisme : inventer l'avenir

    Science.gov (United States)

    Mayor, Federico

    2014-06-01

    Humanism: inventing the future - Humanity is still confronted by the scourges of poverty, hunger, violence and inequality. If we are to invent a better future, we must first understand the past, recalling the missed opportunities of 1918, 1945 and 1989, at the end of two world wars and a cold war. This article summarises the proposals put forward by the author on several occasions during his career. He expresses a forceful confidence in humankind's ability to take control of its destiny and shake off government that puts economic interest before universal human values. The twenty-first century should be the era of rebellion in cyberspace, one in which more women and young people are involved in decision making, heralding a future of freedom and happiness for all.

  19. Inventions and developments of democracy

    DEFF Research Database (Denmark)

    Jakobsen, Uffe

    2010-01-01

    In traditional approaches to the history of political ideas, the history of democracy is uniformly studied concerning the point of departure, selection of canonical texts, etc. The paper introduces the Koselleckian conceptual history approach (Begriffsgeschichte) and the principle of a broader se...... selection of texts than in the traditional history of ideas to provide a fuller account of usages of the concept, thereby opening up for alternative conceptions of the inventions and development of democracy....

  20. Inventions and developments of democracy

    DEFF Research Database (Denmark)

    Jakobsen, Uffe

    2010-01-01

    In traditional approaches to the history of political ideas, the history of democracy is uniformly studied concerning the point of departure, selection of canonical texts, etc. The paper introduces the Koselleckian conceptual history approach (Begriffsgeschichte) and the principle of a broader se...... selection of texts than in the traditional history of ideas to provide a fuller account of usages of the concept, thereby opening up for alternative conceptions of the inventions and development of democracy....

  1. 76 FR 42684 - Statutory Invention Registration

    Science.gov (United States)

    2011-07-19

    ... Patent and Trademark Office Statutory Invention Registration ACTION: Proposed collection; comment request... drawings be published as a statutory invention registration (SIR). A published SIR is not a patent. It has... obtaining patents on the inventions claimed in the applications. However, given that 37 CFR 1.211 requires...

  2. Stress tolerant plants

    OpenAIRE

    2014-01-01

    [EN] The invention relates to transgenic plants and methods for modulating abscisic acid (ABA) perception and signal transduction in plants. The plants find use in increasing yield in plants, particularly under abiotic stress.

  3. Stress tolerant plants

    OpenAIRE

    Rubio, Vicente; Iniesto Sánchez, Elisa; Irigoyen Miguel, María Luisa

    2014-01-01

    [EN] The invention relates to transgenic plants and methods for modulating abscisic acid (ABA) perception and signal transduction in plants. The plants find use in increasing yield in plants, particularly under abiotic stress.

  4. Non-Intentional Invention: The Promethean, Trickster, and Improvisational Invention Heuristics of Academic Writers and Poets

    Science.gov (United States)

    Wirtz, Jason

    2013-01-01

    This essay introduces a novel way to conceptualize writerly invention -- invention as adopting a non-intentional intellectual stance wherein heuristics are experienced as acting upon the writer as opposed to being enacted by the writer. This view of invention complicates and extends the traditional, Aristotelian view of invention as discreet…

  5. Non-Intentional Invention: The Promethean, Trickster, and Improvisational Invention Heuristics of Academic Writers and Poets

    Science.gov (United States)

    Wirtz, Jason

    2013-01-01

    This essay introduces a novel way to conceptualize writerly invention -- invention as adopting a non-intentional intellectual stance wherein heuristics are experienced as acting upon the writer as opposed to being enacted by the writer. This view of invention complicates and extends the traditional, Aristotelian view of invention as discreet…

  6. Uptake of AV-1451 in meningiomas.

    Science.gov (United States)

    Bruinsma, Tyler J; Johnson, Derek R; Fang, Ping; Senjem, Matthew; Josephs, Keith A; Whitwell, Jennifer L; Boeve, Bradley F; Pandey, Mukesh K; Kantarci, Kejal; Jones, David T; Vemuri, Prashanthi; Murray, Melissa; Graff-Radford, Jonathan; Schwarz, Christopher G; Knopman, David S; Petersen, Ronald C; Jack, Clifford R; Lowe, Val J

    2017-09-08

    AV-1451 is an imaging agent labeled with the positron-emitting radiolabel Fluorine-18. 18F-AV-1451 binds paired helical filament tau (PHF-tau), a pathology related to Alzheimer's disease. In our study of AV-1451 uptake in the brains of cognitively normal subjects, we noted a case of a meningioma with visually significant uptake of AV-1451. We initiated the present retrospective study to further examine cases of meningioma that underwent AV-1451 imaging. We searched the patient records of 650 patients who had undergone AV-1451 at our institution for the keyword "meningioma" to identify potential cases. PET/CT and MRI results were visually reviewed and semi-quantitative analysis of PET was performed. A paired student's t test was run between background and tumor standard uptake values. Fisher's exact test was used to examine the association between AV-1451 uptake and presence of calcifications on CT. We identified 12 cases of meningioma, 58% (7/12) of which demonstrated uptake greater than background using both visual analysis and tumor-to-normal cortex ratios (T/N + 1.90 ± 0.83). The paired student's t test revealed no statistically significant difference between background and tumor standard uptake values (p = 0.09); however, cases with a T/N ratio greater than one showed statistically higher uptake in tumor tissue (p = 0.01). A significant association was noted between AV-1451 uptake and presence of calcifications (p = 0.01). AV-1451 PET imaging should be reviewed concurrently with anatomic imaging to prevent misleading interpretations of PHF-tau distribution due to meningiomas.

  7. Invention Zaman Barok dan Pengembangan Permainan Piano

    Directory of Open Access Journals (Sweden)

    RIANTI MARDALENA PASARIBU

    2013-11-01

    Full Text Available Invention in Barok Era and The Development of Piano Lesson. In piano lesson, one material of parts towhich had been given is polyphony, which is an Invention from J.S. Invention is a basic fi nger-skill for pianist.Invention develops in the Baroque period. The baroque ideology is not only called as the reaction of Renaissance,but also as the continuing development from Renaissance. Invention is known in two forms. First is as a pianocomposition and second is as a piano play which can push a pianist to understand more about an arrangement thathe played and expressed.

  8. Portering av programvara – metodik och fallstudie

    OpenAIRE

    Ståhl, Nils

    2012-01-01

    Carasoft AB är ett företag som specialiserat sig på utveckling av dokumenthanteringssystem. Man erbjuder bland annat ett Windowsbaserat dokumenthanteringssystem vid namn Caradoc. Systemet består av flertalet DLL:er skrivna i Delphi och har inte ändrats eller kompilerats sedan 2004. Det här examensarbetet har i syfte att utreda om det finns möjlighet att inom rimlig tid portera Caradoc till Windows 7, med hjälp av den nya Delphi-versionen XE2. Efter en förstudie i ämnet portering, programspråk...

  9. Basic Considerations on AVS DRM Architecture

    Institute of Scientific and Technical Information of China (English)

    Tie-Jun Huang; Yong-Liang Liu

    2006-01-01

    Digital Rights Management (DRM) is an important infrastructure for the digital media age. It is a part of the AVS (Audio and Video coding Standard) of China. AVS Trusted Decoder (ATD) that plays back digital media program according to rights conditions is the core of AVS DRM architecture. Adaptation layers are responsible for translating or negotiating between ATD and peripheral systems. The Packaging Adaptation Layer (PAL), Licensing Adaptation Layer (LAL) and Rendering Adaptation Layer (RAL) will help ATD to gain the interoperability in various DRM environments.

  10. 7 CFR 1210.367 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications....367 Patents, copyrights, inventions, and publications. Any patents, copyrights, inventions, product... such patents, copyrights, inventions, product formulations, or publications shall be considered...

  11. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients.

    Science.gov (United States)

    Schmelter, Christopher; Raab, Udo; Lazarus, Friedrich; Ruppert, Volker; Vorwerk, Dierk

    2015-08-01

    The study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients. 63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5%), followed by complications of angioplasty with vessel rupture or dissection (31.8%). A high rate of procedural success was achieved (98.5%). The most frequent location of the deployed stent-graft was the draining vein (66.7%). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5% at 6 month, 31.3% at 12 month and 19.2% at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1%), followed by stenosis at the AV access (29.5%) and the deployed stent-graft (23.5%). Re-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  12. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  13. Integrasjon av vindkraft i energisystemet : effekten av variabilitet på markedsverdien

    OpenAIRE

    Brekken, Tormod Ween

    2014-01-01

    Klimapolitikken bidrar til å fase ut termisk kraftproduksjon basert på fossile kilder. Dette kan føre til at en mindre andel av kraftproduksjonen kan respondere på prissignaler. Det er planlagt å øke andelen vindkraft i flere kraftmarkeder. Vindkraft er avhengig av været, og er karakterisert av varierende produksjon. Dette påvirker inntekten til hva produsenter av vindkraft vil tjene i kraftmarkedet. Studier har funnet at markedsverdien til vindkraft reduseres ved økte andeler vindkraft i ma...

  14. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  15. En norsk pilotstudie av helsesøstres oppfatninger av pasienters health literacy: helsefremmende allmenndannelse

    OpenAIRE

    Hanne Søberg Finbråten; Kjell Sverre Pettersen

    2012-01-01

    Bakgrunn Uttrykket “ansvar for egen helse” innebærer også evnen til kritisk evaluering av helseinformasjon. Slike kunnskaper og ferdigheter reflekterer health literacy (HL) – på norsk; helsefremmende allmenndannelse, som handler om å forstå, kunne skaffe seg tilgang på, kritisk vurdere og adekvat anvende helseinformasjon for ervervelse av god helse. Hensikt Formålet var å kartlegge helsesøstres oppfatninger av brukeres tre hierarkiske nivåer av HL (Nutbeam 2000): functional HL (FHL), inte...

  16. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  17. Developing Invention Strategies in Collaborative Writing

    Institute of Scientific and Technical Information of China (English)

    董小莉

    2009-01-01

    "Invention" refers to the process writers use to search for, discover, create, or "invent"material for a piece of writing. For many students, one of the most frustrating obstacles to effective and productive writing is to get ideas before turning them into a paper. They often complain that it takes them a long time to think of something to say and find that they run out of things to say very quickly. Therefore developing effective invention strategies should be an important part of writing class. In this article, some effective invention strategies are proposed in the framework of collaborative learning. Meanwhile, someimportant factors that need to be considered are explained.

  18. Analysis reports on the ecotoxicological evaluation of discharges of spent water at the cogeneration/central heating plants Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes and Aelmhult; Analysrapporter avseende ekotoxikologisk bedoemning av utslaepp av utgaaende vatten vid Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes och Aelmhult

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jonas; Axby, Fredrik; Persson, Maarten; Rossander, Annelie; Schultz, Emma; Svaerd, Sara [Carl Bro AB, Kristianstad (Sweden)

    2007-04-15

    The discharges to water at six biofuelled Swedish cogeneration/district heating plants are evaluated in light of the EU Water Framework Directive concerning ecotoxicological impacts. Ecotoxicological data for the 33 prioritized substances are also reviewed.

  19. Kartlegging av PCB i sedimenter fra Indre Sørfjord

    OpenAIRE

    Skei, J.; Klungsøyr, J

    1990-01-01

    Som følge av forhøyede nivåer av PCB i fiskelever innerst i Sørfjorden er det gjennomført en sedimentundersøkelse for om mulig å finne kilden til PCB. Det ble ikke registrert høye nivåer av PCB i sedimentene. Høyeste konsentrasjoner ble målt i munningen av Eitrheimsvågen. Analyser av trafooljer brukt i Tyssedalsområdet viste spor av PCB.

  20. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  1. Effects of Using Invention Learning Approach on Inventive Abilities: A Mixed Method Study

    Science.gov (United States)

    Wongkraso, Paisan; Sitti, Somsong; Piyakun, Araya

    2015-01-01

    This study aims to enhance inventive abilities for secondary students by using the Invention Learning Approach. Its activities focus on creating new inventions based on the students' interests by using constructional tools. The participants were twenty secondary students who took an elective science course that provided instructional units…

  2. Effects of Using Invention Learning Approach on Inventive Abilities: A Mixed Method Study

    Science.gov (United States)

    Wongkraso, Paisan; Sitti, Somsong; Piyakun, Araya

    2015-01-01

    This study aims to enhance inventive abilities for secondary students by using the Invention Learning Approach. Its activities focus on creating new inventions based on the students' interests by using constructional tools. The participants were twenty secondary students who took an elective science course that provided instructional units…

  3. Evaluating Metacognitive Scaffolding in Guided Invention Activities

    Science.gov (United States)

    Roll, Ido; Holmes, Natasha G.; Day, James; Bonn, Doug

    2012-01-01

    Invention and Productive Failure activities ask students to generate methods that capture the important properties of some given data (e.g., uncertainty) before being taught the expert solution. Invention and Productive Failure activities are a class of scientific inquiry activities in that students create, implement, and evaluate mathematical…

  4. Licensing-In Fosters Rapid Invention!

    DEFF Research Database (Denmark)

    Leone, Maria Isabella; Reichstein, Toke

    2012-01-01

    Drawing on contractual economics and innovation management, licensing-in is hypothesized to accelerate licensees' invention process. Studying a matched dataset of licensees and non-licensees, licensees are shown to be faster at inventing, but the effect is negated if the license includes a grant-...

  5. Evaluating Metacognitive Scaffolding in Guided Invention Activities

    Science.gov (United States)

    Roll, Ido; Holmes, Natasha G.; Day, James; Bonn, Doug

    2012-01-01

    Invention and Productive Failure activities ask students to generate methods that capture the important properties of some given data (e.g., uncertainty) before being taught the expert solution. Invention and Productive Failure activities are a class of scientific inquiry activities in that students create, implement, and evaluate mathematical…

  6. Inventors and Inventions, Grades 4-8.

    Science.gov (United States)

    Egan, Lorraine Hopping

    This activity book encourages students to think like inventors by employing ready-to-use materials, a timeline game, and topics from social studies, mathematics, science, language arts, and art. The first section explains the definition of invention and explores accidental inventions. It is followed by a section that examines the effects of…

  7. Can Universities Profit from General Purpose Inventions?

    DEFF Research Database (Denmark)

    Barirani, Ahmad; Beaudry, Catherine; Agard, Bruno

    2017-01-01

    The lack of control over downstream assets can hinder universities’ ability to extract rents from their inventive activities. We explore this possibility by assessing the relationship between invention generality and renewal decisions for a sample of Canadian nanotechnology patents. Our results s...

  8. Inventions for future sustainable development in agriculture

    NARCIS (Netherlands)

    Jacobsen, E.; Beers, P.J.; Fischer, A.R.H.

    2011-01-01

    This chapter is directed to the importance of different inventions as driver for sustainable development of agriculture. Inventions are defined as radical new ideas, perspectives and technologies that hold the potential to trigger a change in sustainable agriculture. Innovation is based on one or mo

  9. Inventions for future sustainable development in agriculture

    NARCIS (Netherlands)

    Jacobsen, E.; Beers, P.J.; Fischer, A.R.H.

    2011-01-01

    This chapter is directed to the importance of different inventions as driver for sustainable development of agriculture. Inventions are defined as radical new ideas, perspectives and technologies that hold the potential to trigger a change in sustainable agriculture. Innovation is based on one or

  10. Inventions for future sustainable development in agriculture

    NARCIS (Netherlands)

    Jacobsen, E.; Beers, P.J.; Fischer, A.R.H.

    2011-01-01

    This chapter is directed to the importance of different inventions as driver for sustainable development of agriculture. Inventions are defined as radical new ideas, perspectives and technologies that hold the potential to trigger a change in sustainable agriculture. Innovation is based on one or mo

  11. Utvärdering av event marketing

    OpenAIRE

    Fransson, Erik; Törnqvist, Johan

    2001-01-01

    Event marketing är en marknadsföringsform som har växt ordentligt under senare delen av 90-talet och det börjar bli ett naturligt inslag i företagens marknadskommunikation. Trots denna tillväxt har event marketing under en längre tid sammankopplats med brist på utvärderingsmetoder. En avsaknad av utvärderingsmetoder leder till svårigheter att avgöra vilka effekter en event marketing-satsning resulterar i, hur genomförandet kan förbättras samt huruvida event marketing är en lämplig form av mar...

  12. What's in a Name? Young Adolescents' Implicit Conceptions of Invention.

    Science.gov (United States)

    Plucker, Jonathan A.

    2002-01-01

    Investigates 55 6th grade students' conceptions of "invention and patent processes". Suggests that students have few or simplistic conceptions of invention and patent processes and prior exposure to invention instruction, or previous experiences with inventing did not appear to have an impact on students' conceptions of invention. (Contains 70…

  13. What's in a Name? Young Adolescents' Implicit Conceptions of Invention.

    Science.gov (United States)

    Plucker, Jonathan A.

    2002-01-01

    Investigates 55 6th grade students' conceptions of "invention and patent processes". Suggests that students have few or simplistic conceptions of invention and patent processes and prior exposure to invention instruction, or previous experiences with inventing did not appear to have an impact on students' conceptions of invention. (Contains 70…

  14. Eksakte metodar for analyse av tovegstabellar

    OpenAIRE

    Aaberge, Rolf

    1980-01-01

    Dei fleste matematisk-statistiske metodane som er utvikla til analyse av tabellar, byggjer på føresetnader om at talet på observasjonar i tabellcellene er "stort. Haldorsen (1977a) og (1977b) omtalar metodar som kviler på dette kravet. I denne rapporten skal vi presentere eksakte metodar for analyse av to-vegstabel lar, dvs. metodar som er gyldige sjølv om vi har småe observasjonstal i tabellcellene. I mange undersøkingar vil observasjonane ofte gi uttrykk for kva slags ...

  15. Grafisk presentasjon av GPenSim-simulering

    OpenAIRE

    2009-01-01

    GPenSim er et verktøy for modellering og simulering av diskret hendelsesystemer (DES). GPenSim er integrert i Matlab-plattformen, og har dermed tilgang til innebygde Matlabfunksjoner som plot etc. I GPenSim blir Petri net-grafen definert i Petri netdefinisjonsfiler. Resultatet av en simulering blir vist i tekst. Oppgaven gikk ut på å utvikle et verktøy som skulle presentere både Petri net-grafen og simuleringsresultatet grafisk. En grafisk presentasjon viser tydeligere sammenhe...

  16. AVS Intellectual Property Rights (IPR) Policy

    Institute of Scientific and Technical Information of China (English)

    Cliff Reader

    2006-01-01

    The AVS Workgroup has developed an IPR Policy to facilitate the adoption of standards in the marketplace.The policy is based on consideration of IPR issues in parallel with the technical work for drafting the standard. The paper describes the relationship between IPR and the standard, and how the goals for the standard must be complemented by goals for the IPR. The existing IPR policies of the ITU and ISO are outlined, and then the AVS IPR policy is described,organized by its three main components: commitment to license on declared basic terms, disclosure of intellectual property,and protection of IPR.

  17. Bruk av landstrøm for reduksjon av NOX og CO2 i norske havner

    OpenAIRE

    Frengstad, Åsmund Møll

    2014-01-01

    Bruk av Smart Grid og landstrøm for reduksjon av NOX- og CO2- utslipp i norske havner. I dag slippes det ut mye avgasser fra marine næringer i havner. Disse gassene bidrar både til internasjonale miljøutslipp i form av CO2, men også til lokal luftforurensing. Dette kan føre til redusert livskvalitet for befolkningen og besøkende til havnebyene. For å belyse problemet er Hurtigruten ASA benyttet som eksempel med de havnene den besøker på sin rute opp langs norskekysten. Rapporten gir en...

  18. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  19. Ishockeykjelke - Innfesting av spilleren: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  20. Instrumentering av Bergsøysundbrua og Gjemnesundbrua

    OpenAIRE

    Dahlen, Adrian; Lystad, Tor Martin

    2013-01-01

    Gjemnessundbrua og Bergsøysundbrua på Europavei E39 i Møre og Romsdal, skal instrumenteres for identifikasjon av strukturelle og dynamiske egenskaper. Denne rapporten omhandler dokumentasjon og beskrivelse av det utførte arbeidet ved monteringen av måleutstyret. Det er også gjort analyser av de ulike konstruksjonsdelene akselerometersensorer og anemometre er montert på. Til slutt er de initielle responssignalene fra systemet behandlet, der egenfrekvenser og ...

  1. Featured Invention: Laser Scaling Device

    Science.gov (United States)

    Dunn, Carol Anne

    2008-01-01

    In September 2003, NASA signed a nonexclusive license agreement with Armor Forensics, a subsidiary of Armor Holdings, Inc., for the laser scaling device under the Innovative Partnerships Program. Coupled with a measuring program, also developed by NASA, the unit provides crime scene investigators with the ability to shoot photographs at scale without having to physically enter the scene, analyzing details such as bloodspatter patterns and graffiti. This ability keeps the scene's components intact and pristine for the collection of information and evidence. The laser scaling device elegantly solved a pressing problem for NASA's shuttle operations team and also provided industry with a useful tool. For NASA, the laser scaling device is still used to measure divots or damage to the shuttle's external tank and other structures around the launchpad. When the invention also met similar needs within industry, the Innovative Partnerships Program provided information to Armor Forensics for licensing and marketing the laser scaling device. Jeff Kohler, technology transfer agent at Kennedy, added, "We also invited a representative from the FBI's special photography unit to Kennedy to meet with Armor Forensics and the innovator. Eventually the FBI ended up purchasing some units. Armor Forensics is also beginning to receive interest from DoD [Department of Defense] for use in military crime scene investigations overseas."

  2. Another of CERN's many inventions!

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    CERN has often been the incubator for the development of innovative technologies but very few people know about the capacitive touch screens invented for the consoles of the SPS Control Room in 1973. The Bulletin interviewed their inventor, Bent Stumpe, who also developed the CERN tracker ball and the computer-programmable knob.   Bent Stumpe, inventor of the CERN touch screens, tracker ball and programmable knob. Here we see him with one the first touch screens developed in 1973.   A specific goal, a lot of motivation and the technical skills to do it: that’s all you need to create something nobody else has ever done before. Back in the 1970s, the SPS was being built and its control room required the installation of thousands of buttons, knobs, switches and oscilloscopes to operate the machine. Frank Beck, newly recruited from the DD Division to be in charge of the central control hub in the SPS control room, asked Bent Stumpe for solutions to the following problem: how to bui...

  3. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  4. Sensational inventions by girls and boys

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yeon Jung

    1999-05-15

    This book introduces the interesting and original inventions invented by girls and boys. These are the titles of the inventions : an antenna ruler, muscular strength machine with spring, items to remove sticky matter for advertisement, chair ladder for the disabled, useful control box for feeding bees, a portable carriage for dogs, a lid of ashtray, hot-air balloon using solar power, toy cannon for reports, hard badminton racket, tv cable and a distributor which are easy to install, device for car automatic parking, a cleanser for vegetables.

  5. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  6. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  7. Acid volatile sulfide (AVS)- a comment

    NARCIS (Netherlands)

    Meysman, F.J.R.; Middelburg, J.J.

    2005-01-01

    The review by Rickard and Morse (this volume) adequately summarizes our current understanding with respect to acid-volatile sulfides (AVS). At the same time, this review addresses some of the misunderstandings with regard to measurements and dynamics of this important sedimentary sulfur pool. In

  8. Risikostyring av jetfuelprisen med futureskontrakter : en studie av hedgingstrategier for flyselskaper

    OpenAIRE

    Marker, Sebastian

    2013-01-01

    Denne oppgaven undersøker risikostyring av jetfuelprisen gjennom hedgingstrategier med WTI- og fyringsoljefutures som sikringsinstrument. Analysen tar sikte på å estimere minimum varians hedgingrater for ulike hedgingstrategier. Formålet er å finne hedgingstrategier som gir høyest hedgingeffektivitet, og dermed gir størst reduksjon i jetfuelprisrisiko. Første del av analysen vil estimere hedgingrater med utgangspunkt i flere analysemetoder under en klassisk lineær regresjonsmodell (CLRM). Hed...

  9. Aktivitetsbasert pedagogikk; en studie av bachelorstudenters utvikling av handlingskompetanse gjennom aktivitetsbasert pedagogikk

    Directory of Open Access Journals (Sweden)

    Kari Margrete Hjelle

    2012-06-01

    Full Text Available Målet med artikkelen er å synliggjøre hvordan bachelorstudenter i ergoterapi kan utvikle profesjonell handlingskompetanse gjennom aktivitetsbasert pedagogikk. På bakgrunn av dette gjennomførte vi kvalitative fokusgruppeintervju med 12 ergoterapeutstudenter som hadde deltatt i undervisningsopplegget “Aktivitetsgrupper-lede og delta”. Datamaterialet ble analysert etter retningslinjer for fenomenologisk basert meningskondensering. Studentene diskuterte sine erfaringer og det kom tydelig fram at undervisningsopplegget ga dem muligheter til å bruke sitt engasjement og sin kreativitet i valg av aktiviteter for sin simulerte aktivitetsgruppe. Videre fikk de muligheter til å oppdage sider ved anvendelse av aktiviteter for ulike pasienter, som de ikke kunne forstå uten integrering av teori i praktisk ferdighetstrening. Ved planlegging, gjennomføring og refleksjon over å lede og delta i aktivitetsgrupper, oppøvet de evnen til handlingsrefleksjon. Aktivitetsbasert pedagogikk kan bidra til utvikling av profesjonell handlingskompetanse og det er behov for både teoretiske og praktiske læringsformer. Funnene ble diskutert i lys av pedagogisk handlingsteori.

  10. Low-Complexity Tools in AVS Part 7

    Institute of Scientific and Technical Information of China (English)

    Feng Yi; Qi-Chao Sun; Jie Dong; Lu Yu

    2006-01-01

    Audio Video coding Standard (AVS) is established by the AVS Working Group of China. The main goal of AVS part 7 is to provide high compression performance with relatively low complexity for mobility applications. There are 3 main low-complexity tools: deblocking filter, context-based adaptive 2D-VLC and direct intra prediction. These tools are presented and analyzed respectively. Finally, we compare the performance and the decoding speed of AVS part 7 and H.264 baseline profile. The analysis and results indicate that AVS part 7 achieves similar performance with lower cost.

  11. Overview of AVS-video: tools, performance and complexity

    Science.gov (United States)

    Yu, Lu; Yi, Feng; Dong, Jie; Zhang, Cixun

    2005-07-01

    Audio Video coding Standard (AVS) is established by the Working Group of China in the same name. AVS-video is an application driven coding standard. AVS Part 2 targets to high-definition digital video broadcasting and high-density storage media and AVS Part 7 targets to low complexity, low picture resolution mobility applications. Integer transform, intra and inter-picture prediction, in-loop deblocking filter and context-based two dimensional variable length coding are the major compression tools in AVS-video, which are well-tuned for target applications. It achieves similar performance to H.264/AVC with lower cost.

  12. Ancient engineers' inventions precursors of the present

    CERN Document Server

    Rossi, Cesare

    2017-01-01

    This book describes the inventions and designs of ancient engineers who are the precursors of the present. The period ranges mainly from 300 B.C. to 1600 A.D. with several exceptions. Many of the oldest inventions are documented by archaeological finds, often very little known, mainly from Pompeii, Herculaneum and Stabiae and reveal a surprising modernity in their conception. Most of the inventions presented in the first four parts of the book were conceived up to the late Roman Empire and may be considered as milestones, each in their respective field. The fifth part concentrates on more recent centuries. The sixth part deals with some building construction techniques. Generally, for each of the presented inventions, three elements of research and reference are provided: written documents (the classics), iconic references (coins, bas-reliefs, etc.) and archaeological findings. The authors did not write this book for engineers only; hence they describe all the devices without assuming wide technical knowledge...

  13. The Transformation of Science Into Patented Inventions

    DEFF Research Database (Denmark)

    Beukel, Karin

    This paper presents the results of a grounded theory study of the transformation of scientific discoveries into patented inventions. Using an algebraic interpretive approach, the narratives collected during interviews are analyzed as Bayesian inferences and the developed theory is tested. The fin......This paper presents the results of a grounded theory study of the transformation of scientific discoveries into patented inventions. Using an algebraic interpretive approach, the narratives collected during interviews are analyzed as Bayesian inferences and the developed theory is tested....... The findings recast the relationship between science and patents as a process in which the way the transformation of the scientific invention is handled has an effect on the breadth of the patent scope. Unleashing patent scope surplus is dependent on processes related to abstraction and cognitive variety...... for searching in new directions for solutions if challenges of exploitation with regard to the scientific invention arise....

  14. Technological novelty profile and invention's future impact

    CERN Document Server

    Kim, Daniel; Jeong, Hawoong; Youn, Hyejin

    2015-01-01

    We consider inventions as novel combinations of existing technological capabilities. Patent data allow us to explicitly identify such combinatorial processes in invention activities. Unconsidered in the previous research, not every new combination is novel to the same extent. Some combinations are naturally anticipated based on patent activities in the past or mere random choices, and some appear to deviate exceptionally from existing invention pathways. We calculate a likelihood that each pair of classification codes is put together at random, and a deviation from the empirical observation so as to assess its overall novelty (or conventionality) the patent brings forth at each year. An invention is considered as unconventional if a pair of codes therein is unlikely to be used together given the statistics in the past. Temporal evolution of the distribution indicates the patenting activities become more being established with occasional cross-over combinations. Our analyses show that patents introducing novel...

  15. Inventions and patents: a practical tutorial.

    Science.gov (United States)

    Tidwell, J Lille; Liotta, Lance A

    2012-01-01

    Patents are designed to protect and encourage creativity and innovation. Patenting a biomedical discovery can be a requirement before a pharmaceutical company or biotech entity will invest in the lengthy and costly clinical testing necessary to achieve patient benefit. Although scientists and clinicians are well versed in research publication requirements, patent descriptions and claims are formatted in a manner quite different from a research paper. Patents require (a) a series of logical statements clearly delineating the boundaries of the novel aspects of the invention and (b) sufficient disclosure of the invention so that it can be reproduced by others. Patents are granted only for inventions that meet three conditions: novelty, nonobviousness, and usefulness. This chapter provides basic guidelines and definitions of technology transfer: inventions, inventorship, and patent filing, which are summarized using a question and answer format.

  16. How James Watt invented the copier forgotten inventions of our great scientists

    CERN Document Server

    Schils, René

    2012-01-01

    Features 25 different scientists and the ideas which may not have made them famous, but made history… Typically, we remember our greatest scientists from one single invention, one new formula or one incredible breakthrough. This narrow perspective does not give justice to the versatility of many scientists who also earned a reputation in other areas of science. James Watt, for instance, is known for inventing the steam engine, yet most people do not know that he also invented the copier. Alexander Graham Bell of course invented the telephone, but only few know that he invented artificial breathing equipment, a prototype of the ‘iron lung’. Edmond Halley, whose name is associated with the comet that visits Earth every 75 years, produced the first mortality tables, used for life insurances. This entertaining book is aimed at anyone who enjoys reading about inventions and discoveries by the most creative minds. Detailed illustrations of the forgotten designs and ideas enrich the work throughout.

  17. Varmepumper i hushald. Analyse av endringar i effektforbruket hos hushald med panelomnar og vedfyring ved installasjon av ulike typar varmepumper

    OpenAIRE

    Øvrebotten, Kristian

    2015-01-01

    Sidan oljekrisa på 1970-talet som førte til ein gradvis overgang frå bruk av oljekjelar og parafinkaminar til panelomnar og varmepumper, har andelen elektrisitet stadig auka mens andelen av olje har vore redusert. Andelen av elektrisitet hos hushalda utgjer i dag om lag 79 % av den samla energibruken hos hushalda i Noreg. Dette høge forbruket av elektrisitet hos hushalda bidreg til å skape problem med høge effekttoppar i kraftnettet som igjen skapar problem for kraftdistributørar og er med...

  18. Environmental analysis of the system for the households' wastewater and organic waste. Synthesis of handling systems studied in the research program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall. Syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E. [Chalmers Inst. of Technology, Goeteborg (Sweden). Sanitary Engineering; Joensson, Haakan; Sonesson, Ulf [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Agricultural Engineering; Gruvberger, C.; Dalemo, M. [Swedish Inst. of Agricultural Engineering, Uppsala (Sweden); Stenstroem, T.A. [Swedish Inst. for Infections Disease Control, Stockholm (Sweden)

    2001-11-01

    Knowledge derived within the RandD programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20,000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised in

  19. Environmental system analysis of the waste water and organic wastes from households - synthesis of handling systems studied in the program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall - syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E.; Joensson, Haakan; Gruvberger, C.; Dalemo, M.; Sonesson, Ulf; Stenstroem, T.A. [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden)

    2001-03-01

    Knowledge derived within the R and D programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20 000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised

  20. Optimizing reed canary grass cropping to increase profitability. Field studies of plant varieties, intercropping with legumes and barley, fertilization and soil compaction; Optimering av odlingsaatgaerder i roerflen foer oekad loensamhet. Faeltstudier av sorter, samodling med baljvaexter och korn, goedsling samt markpackning

    Energy Technology Data Exchange (ETDEWEB)

    Palmborg, Cecilia; Lindvall, Eva (Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Agricultural Research for Northern Sweden)

    2010-05-15

    Reed Canary Grass is a promising crop for biofuel production. For reed canary grass the first year is an establishment year when the small biomass is not harvested. The second year the biomass is usually cut in late autumn but the harvest (removal of the biomass from the field) is delayed until spring. This technique has resulted in lower costs and increases in fuel quality through lower ash contents, including lower contents of chlorine, sodium and potassium. However costs for production are still high, especially establishment costs, fertilization costs and harvesting costs. The aim of this project was to test ways to cut costs per MWh by increased yields, and decreased establishment costs. The methods used have been variety trials to develop more productive plant material, intercropping with nitrogen fixing legumes to reduce the nitrogen demand of the crop, fertilization with waste material (sewage sludge, reed canary grass ash or poultry manure) and harvest at frozen ground as a strategy to reduce soil compaction and harvest damages on the crop. Reed canary grass grown as a fuel has so far been grown as a mono culture. However, when it is been grown for forage, or as a biogas crop, intercropping with legumes has been successful in some studies. In addition to NPK-fertilizers sewage sludge, ash from combustion of reed canary grass and poultry manure was used. An economic calculation showed that the establishment costs (the first two growing seasons) can be lowered by intercropping with red clover. However it is also involves more risks, related to weeds, and cannot be recommended on fallow soil with a large seed bank of weeds. A ten year old reed canary grass ley was used for the experiment. Two 25 m wide strips were harvested with a mower on November 19 2008 when the top soil was frozen. The harvested material was chopped and removed from the field the following day. The following spring, May 19 2009, the remaining reed canary grass on the field was cut with a

  1. 43 CFR 6.2 - Report of invention.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Report of invention. 6.2 Section 6.2 Public Lands: Interior Office of the Secretary of the Interior PATENT REGULATIONS Inventions by Employees § 6.2 Report of invention. (a) Every invention made by an employee of the Department shall be reported...

  2. 10 CFR 784.5 - Waiver of identified inventions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Waiver of identified inventions. 784.5 Section 784.5 Energy DEPARTMENT OF ENERGY PATENT WAIVER REGULATION § 784.5 Waiver of identified inventions. This... particular identified subject invention. In determining whether such a waiver of an identified invention will...

  3. 77 FR 47820 - Invention Promoters/Promotion Firms Complaints

    Science.gov (United States)

    2012-08-10

    ... United States Patent and Trademark Office Invention Promoters/Promotion Firms Complaints ACTION: Proposed... concerning invention promoters and responses from the invention promoters to these complaints. An individual may submit a complaint concerning an invention promoter to the USPTO, which will forward the complaint...

  4. 37 CFR 4.4 - Invention promoter reply.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Invention promoter reply. 4.4... COMMERCE GENERAL COMPLAINTS REGARDING INVENTION PROMOTERS § 4.4 Invention promoter reply. (a) If a submission appears to meet the requirements of a complaint, the invention promoter named in the complaint...

  5. 38 CFR 1.654 - Patenting of inventions.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Patenting of inventions... PROVISIONS Inventions by Employees of Department of Veterans Affairs § 1.654 Patenting of inventions. Any invention owned by the Government under the criteria as set forth in 37 CFR 501.6 should be protected by an...

  6. 45 CFR 650.19 - Electronic invention handling.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Electronic invention handling. 650.19 Section 650... PATENTS § 650.19 Electronic invention handling. (a) Grantees must use the iEdison Invention Information Management System maintained by the National Institutes of Health to disclose NSF subject inventions...

  7. 37 CFR 1.297 - Publication of statutory invention registration.

    Science.gov (United States)

    2010-07-01

    ... invention registration. 1.297 Section 1.297 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND... Provisions Protests and Public Use Proceedings § 1.297 Publication of statutory invention registration. (a) If the request for a statutory invention registration is approved the statutory invention...

  8. 37 CFR 1.73 - Summary of the invention.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Summary of the invention. 1... § 1.73 Summary of the invention. A brief summary of the invention indicating its nature and substance, which may include a statement of the object of the invention, should precede the detailed description...

  9. 76 FR 51376 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2011-08-18

    ... sensitivity. The invention provides a method to measure syndesmophytes using data from computed tomography... invention offers improved method to measure vertebral and disk heights. The invention provides computer... HUMAN SERVICES National Institutes of Health Government-Owned Inventions; Availability for Licensing...

  10. A Novel MBAFF Scheme of AVS

    Institute of Scientific and Technical Information of China (English)

    Jian-Wen Chen; Guo-Ping Li; Yun He

    2006-01-01

    Adaptive frame/field coding techniques have been adopted in many international video standards for interlaced sequence coding. When the frame/field adaptation is applied on the picture level, the coding efficiency is improved greatly,compared with the pure frame coding or the pure field coding. The picture-level adaptive frame/field coding (PAFF) selects frame coding or field coding once for one picture. If this frame/field adaptation is extended to Macro Block (MB) level, the coding efficiency will be further increased. In this paper, a novel MB-level adaptive frame/field (MBAFF) coding scheme is proposed. In the proposed MBAFF scheme, the top field of the current picture is used as a reference. The experiments are implemented on the platforms of Audio Video coding Standard (AVS) base profile and H.264/AVC, respectively. On the AVS platform, 0.35dB gain can be achieved averagely, compared with AVS1.0 anchor. On the H.264/AVC platform, 0.16dB gain can be achieved averagely, compared with MBAFF scheme of H.264/AVC. Additionally, an extensive subjective quality enhancement can be achieved by the proposed scheme.

  11. On the Late Invention of the Gyroscope

    Science.gov (United States)

    Brecher, Kenneth

    2012-03-01

    The invention of the gyroscope is usually attributed to the French physicist Jean-Bernard-Leon Foucault in 1852. He certainly invented the word and also used his gyroscope to demonstrate the rotation of the Earth. However, the gyroscope was actually invented around 1812 by German physicist Johann Bohnenberger who called his device simply the ``machine''. Several others, including American physicist Walter R. Johnson (who called his apparatus the ``rotascope''), independently invented the gyroscope in the 1830's. Each of these devices employed a central object (sphere or disc) that could spin freely on a shaft. This was placed between three independent gimbals, which could also move freely. Bohnenberger's ``machine'' has much the same appearance as an armillary sphere. Such devices had been produced for at least the preceding three centuries. They were used to display the movements of various celestial bodies. However, armillary spheres are only simulations of celestial appearances, not actual demonstrations of physical phenomena. Gimbal systems similar to those found in gyroscopes were used on ships to level oil lamps from at least the sixteenth century and the ideas behind armillary spheres date back at least a millennium before that. So why was the gyroscope invented so late? Some possible reasons will be presented for the long delay between the development of the individual underlying components and the eventual appearance of the gyroscope in its modern form.

  12. Energy-related inventions program invention 637. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-31

    The final technical report for the Pegasus plow, a stalk and root embedding apparatus, describes progress from the development stage to the product support stage. The US Department of Agriculture - Agriculture Research Service (ARS) is now in the second year of a three year study comparing the Pegasus to conventional tillage. So far, no downside has been with the Pegasus and the following benefits have been documented: (1) Energy savings of 65.0 kilowatt hours per hectare over conventional tillage. This is when the Pegasus plow is used to bury whole stalks, and represents a 70% savings over conventional tillage (92.5 kilowatt hours per hectare). (2) Four to seven fewer passes of tillage, depending on the particular situation. This represents a substantial time savings to farmers. (3) So far, no differences in cotton yields. Recent cotton boll counts in one study indicate a higher yield potential with the Pegasus. (4) No disease problems. (5) Significantly higher levels of organic matter in the soil. A hypothesis of the study is that whole stalk burial may reduce plant disease problems. This hypothesis has not yet been proven. (6) Significantly higher levels of nitrate nitrogen. Total nitrogen and ammonia nitrogen trended higher but were not significantly different. This shows that whole stalk burial does not adversely affect the nitrogen cycle in the soil and may actually improve it. The marketing support stage of the project is also described in the report.

  13. Practical consequences of the Water Framework Directive implementation for combustion plants. New water cleaning technologies and methods for improvement of effluent discharges; Praktiska konsekvenser foer foerbraenningsanlaeggningar vid infoerandet av Vattendirektivet. Nya reningstekniker och foerbaettringsaatgaerder vid utslaepp till vatten

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Hansson, Christina [Carl Bro Energikonsult AB, Malmoe (Sweden)

    2004-11-01

    As a consequence of the growing impact on water resources the Water Framework Directive was legislated in 2000. The directive should ensure that a 'good water status' and entail a coordinated legislation striving for a long-term protection of all water resources. Stakeholders should be able to participate in the preparations of river basin management plans and programs of measures. District based water authorities will administrate the implementation and are mandated to decide upon regional environmental quality standards and promulgate fees for water use and discharges. The Directive contains a list of 33 prioritized substances that should be reduced or phased out. Discharges from combustion plants contain twelve, polyaromatic hydrocarbons (PAH) and heavy metals. PAH and heavy metals impacts growth and vital functions as respiration and photosynthesis of water living organisms and induces cancer in humans. NOEC-values (NO Effect Concentration) state manageable substance concentrations for an organism. Flue gas condensate contains concentrations of some of the substances which impact exceeds the critical state level. Extended sewage treatment could thus be needed. Sludge, wash and soot water contains elevated levels of heavy metals. This water is normally treated by municipal sewage treatment. Further treatment at plant site could be relevant. Presence of PAH and heavy metals in leach water depends on the precipitation. Additional flowing-independent water treatment could be relevant. It is very uncertain how plant owners will be affected. Licenses could be reviewed and standards could be raised for sensitive recipients; new limits for prioritized substances and standards for other types of discharges and water fees could be added. Respites could be given if costs exceed the benefits. Location, ecotoxicological risk assessments and precautionary measures could become more relevant in an EIA. Pricing of water could take place by using a system of emissions

  14. Nanotechnological Inventions and Nanomaterials Produce A Profound Effect

    Directory of Open Access Journals (Sweden)

    VLASOV Vladimir Alexeevich

    2015-02-01

    Full Text Available The inventions in the area of nanotechnologies and nanomaterials produce a profound effect in construction, housing and communal services and adjacent economic fields as they allow us: to increase mechanical strength, coefficient of elasticity, alkali resistance and temperature of products vitrification; to obtain nanostructured coatings with the property of shape memory on the steel; to raise the dynamics of coal burning and its full burnout in the boilers of thermoelectric power station; to produce metal nanopowders with increased stored energy 10–15% etc. For example, the invention «Epoxy composition for high strength, alkali resistant structures» refers to epoxy composition used as a binder for production of high strength, thermal- and alkali-resistant glass-fiber material which can be applied in the manufacture process of construction reinforcement to strengthen concrete structures. The invention «The method to produce nanostructured reaction foil» can be used to join different materials including metal alloys, ceramics, amorphous materials and elements of microelectronic devices that are sensible to the heating. This process provides decreased labour-output ratio and energy consumption as well as the condition to manufacture foil with specified stored energy and high mechanical properties. The invention «The method of intensification of burning lowreactionary coal in the boilers of thermoelectric power station» refers to the thermal energy and can be implemented at the thermal plants. The increased dynamics of inflaming and burning leads to full burnout of powdered-coal low-reactionary fuel and decreased mechanical underfiring. The specialists may be also interested in the following inventions: fine dispersed organic suspension of carbon metal-containing nanostructures and the method to produce it; the dispersion of carbon nanotubes; the composition for reinforcement of building structures; the reinforced plate element made of

  15. Risk assessment and zone classification of solid fuel plants in accordance with AFS 2003:3. ATEX; Riskbedoemning och zonklassning av fastbraensleanlaeggningar i enlighet med AFS 2003:3. ATEX

    Energy Technology Data Exchange (ETDEWEB)

    Haglund, Annika; Oeberg, AnnCharlott; Lindhe, Magnus [Inspecta AB, Stockholm (Sweden)

    2007-04-15

    Inspecta AB has composed a handbook in risk assessment and zone classification of solid fuel plants in accordance with the demands in AFS 2003:3 (regulations issued by Swedish Work Environment Authority). Several more or less severe accidents with dust explosions as the underlying cause occurs each year in Sweden. Many of these accidents occurs totally unexpected and perhaps even without understandings. 'It is only dust' AFS 2003:3 was made imperative 2006-07-01 and several plant owners are still uncertain of what procedures to make in order to fulfil the demands. The target group for the handbook is primarily plant owners but also people active in thermo-technical research and development. The prospect is to be an easy understandable handbook and for operators in the energy branch, on their own, independently of background knowledge, to be able to apply the method on a cost efficient way, and in that way fulfil the demands according to the so called explosion protection document. The number of unforeseen accidents with regard to explosive dust atmosphere will be decreased as a natural result of the implementation of the explosion protection documents. The handbook has a theory part with five complementary appendices. More than the other appendices, appendix B consist of a practical example which will take the reader step by step through how a risk assessment and zone classification of a solid fuel plant is made. Appendix B can be used separately, but the theory part should be read in order to understand the background for the dusts characteristics and other important factors.

  16. Aerobic effluent treatment with lower electric power consumption. Survey of results from questionnaire sent out to Swedish pulp and paper mills with biological effluent treatment plants; Aerob rening med laegre elfoerbrukning. Sammanstaellning av enkaetsvar fraan svenska skogsindustrier med biologisk rening

    Energy Technology Data Exchange (ETDEWEB)

    Sivard, Aasa; Simon, Olle

    2010-12-15

    A survey of the energy situation at 23 Swedish pulp and paper mills with aerobic effluent treatment plants has been performed. The electricity consumption for aeration equipment is about 80 % of the total electricity consumption. Proposed measures to increase energy efficiency are regular measurements of energy consumption, better control of the oxygen level in some mills and evaluation of measures to use the heat in process effluent before and after biological treatment

  17. Utveckling av ett webbforum med innehållshanteringssystemet Drupal

    OpenAIRE

    Lindqvist, Christoffer

    2010-01-01

    Detta examensarbete består av två huvuddelar. Den första delen är en teoretisk analys av innehållshanteringssystem i allmänhet och en forskning i hur det populära innehållshanteringsverktyget Drupal är uppbyggt. Den andra delen av arbetet är en praktisk genomgång av hur funktionalitet för ett webbforum kan byggas upp med hjälp av Drupals ramverk. Den teoretiska analysen undersöker vad ett innehållshanteringsverktyg är, vad det används till och vilka huvuddrag det i allmänhet består av. Sed...

  18. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  19. Kvinnors upplevelser av komplicerad förlossning

    OpenAIRE

    Samuelsson, Magdalena; Wahlberg, Christina

    2006-01-01

    Att vänta och föda barn beskrivs som en av de viktiga övergångsperioderna i livet och innebär ofta en personlig utveckling för den födande kvinnan. Då graviditeten och förlossningen av någon anledning kompliceras, kan denna process störas, och kvinnan kan istället få både fysiska och psykiska men i efterförloppet. Syftet med denna studie var att belysa kvinnors upplevelser av en komplicerad förlossning. Metoden var en granskning i form av en innehållsanalys av sju artiklar som utgjordes av fy...

  20. AVS 3D Video Coding Technology and System

    Institute of Scientific and Technical Information of China (English)

    Siwei Ma; Shiqi Wang; Wen Gao

    2012-01-01

    Following the success of the audio video standard (AVS) for 2D video coding, in 2008, the China AVS workgroup started developing 3D video (3DV) coding techniques. In this paper, we discuss the background, technical features, and applications of AVS 3DV coding technology. We introduce two core techniques used in AVS 3DV coding: inter-view prediction and enhanced stereo packing coding. We elaborate on these techniques, which are used in the AVS real-time 3DV encoder. An application of the AVS 3DV coding system is presented to show the great practical value of this system. Simulation results show that the advanced techniques used in AVS 3DV coding provide remarkable coding gain compared with techniques used in a simulcast scheme.

  1. Developing Mathematization with Physics Invention Tasks

    CERN Document Server

    Brahmia, Suzanne; Kanim, Stephen E

    2016-01-01

    Experts in physics develop and communicate ideas through mathematization, the mental practice of translating between the physical world and the symbolic world. Research in mathematics education and physics education has shown that introductory college physics students often struggle with the idiosyncratic ways that familiar mathematics is used in physics. Additional work has shown that invention tasks have promise as an instructional approach for helping students use math flexibly and generatively in science and in statistics. In this paper we describe our physics invention tasks,* classroom activities designed to support construction of quantitative physics concepts and relationships and to prepare students to better understand the reasoning introduced in subsequent formal instruction. We share results from a preliminary study of the impact of physics invention tasks in a reformed introductory calculus-based physics course. The reformed course, taught by one of the authors and designed specifically for mathe...

  2. Invented rule with English language learners.

    Science.gov (United States)

    Boyer, Valerie E; Martin, Kathryn Y

    2012-07-01

    The purpose of this study was to utilize an invented rule with English language learners (ELLs) in a clinical setting to determine differences based on language and age of the children. The performance was correlated with teacher reports of strong and weak language learning. Using a within-participants design, ELLs of age three to five were taught to apply a nonsense morpheme to signal a semantic difference. The invented rule was taught and responses were elicited in both English and English with Spanish interpretation. No significant difference for language was identified. Effect sizes for age were large (English, eta = 0.389, and English + Spanish, eta = 0.430) with five-year-old participants more likely to apply the rule to novel stimuli regardless of language. The performance of the majority of the participants correlated with teacher reports. The invented rule may provide a mechanism for assessing processing independent of prior language knowledge.

  3. Analyse av klimatilpassningstiltak : en casestudie av avløpsnettet i Veumdalen, Fredrikstad kommune

    OpenAIRE

    Myking, Jakob Severin Eide

    2012-01-01

    Økt forståelse av fortidens klimaendringer og klimasystemet i sin helhet, har gitt forskerne mulighet til å anta fremtidens klimaendringer. Denne økte forståelsen har gitt sikre tegn på at klimaendringene er knyttet til en stor grad av usikkerhet. Det eneste som er sikkert, er at klimaendringer kommer til å skje, og at det er umulig å si med sikkerhet når eller med hvilken kraft de vil inntreffe. Det som derimot kan sies med sikkerhet, er at befolkningen kommer til å øke. Dette vil føre til ø...

  4. Optimering av FISH- teknik för detektion av Laktobaciller

    OpenAIRE

    Hamidi, Helaleh

    2008-01-01

    Sammanfattning Syftet med den här studien var att utveckla och optimera FISH (Fluorescense In Situ Hybridisation) tekniken som en snabb och ganska billig metod för detektion av laktobaciller. Det vill säga att kunna på objektsglas använda FISH tekniken för att identifiera laktobaciller på artnivå med fluorescensmärkta prober mot 16S och 23S RNA. FISH är en allmän och användbar metod för att detektera och lokalisera mikroorganismer eller en specifik grupp av mikroorganismer i provet (1). Metod...

  5. Kunnskapsutvikling i et profesjonsperspektiv - En kvantitativ studie av sosialarbeideres bruk av kunnskapsressurser i arbeidslivet

    OpenAIRE

    2014-01-01

    Problemområde Profesjoner betraktes gjerne som grupper som rår over store deler av samfunnets ressurser. Som velferdsstatens portvakter anses de gjerne som grupper med definisjonsmakt og forvaltere av kunnskap (Molander og Smeby, 2013). Det moderne kunnskapssamfunnet byr imidlertid på nye utfordringer for profesjonsfeltet. Det stilles i økende grad krav til at profesjonsutøvere skal være faglig oppdaterte, utøve en kunnskapsbasert praksis og til en hver tid inneha nødvendig kompetanse. Sosial...

  6. Functional mathematical model of dual pathway AV nodal conduction.

    Science.gov (United States)

    Climent, A M; Guillem, M S; Zhang, Y; Millet, J; Mazgalev, T N

    2011-04-01

    Dual atrioventricular (AV) nodal pathway physiology is described as two different wave fronts that propagate from the atria to the His bundle: one with a longer effective refractory period [fast pathway (FP)] and a second with a shorter effective refractory period [slow pathway (SP)]. By using His electrogram alternance, we have developed a mathematical model of AV conduction that incorporates dual AV nodal pathway physiology. Experiments were performed on five rabbit atrial-AV nodal preparations to develop and test the presented model. His electrogram alternances from the inferior margin of the His bundle were used to identify fast and slow wave front propagations. The ability to predict AV conduction time and the interaction between FP and SP wave fronts have been analyzed during regular and irregular atrial rhythms (e.g., atrial fibrillation). In addition, the role of dual AV nodal pathway wave fronts in the generation of Wenckebach periodicities has been illustrated. Finally, AV node ablative modifications have been evaluated. The model accurately reproduced interactions between FP and SP during regular and irregular atrial pacing protocols. In all experiments, specificity and sensitivity higher than 85% were obtained in the prediction of the pathway responsible for conduction. It has been shown that, during atrial fibrillation, the SP ablation significantly increased the mean HH interval (204 ± 39 vs. 274 ± 50 ms, P AV node mechanisms and should be considered as a step forward in the studies of AV nodal conduction.

  7. AV nodal dual pathway electrophysiology and Wenckebach periodicity.

    Science.gov (United States)

    Zhang, Youhua; Mazgalev, Todor N

    2011-11-01

    The precise mechanism(s) governing the phenomenon of AV nodal Wenckebach periodicity is not fully elucidated. Currently 2 hypotheses, the decremental conduction and the Rosenbluethian step-delay, are most frequently used. We have provided new evidence that, in addition, dual pathway (DPW) electrophysiology is directly involved in the manifestation of AV nodal Wenckebach phenomenon. AV nodal cellular action potentials (APs) were recorded from 6 rabbit AV node preparations during standard A1A2 and incremental pacing protocols. His electrogram alternans, a validated index of DPW electrophysiology, was used to monitor fast (FP) and slow (SP) pathway conduction. The data were collected in intact AV nodes, as well as after SP ablation. In all studied hearts the Wenckebach cycle started with FP propagation, followed by transition to SP until its ultimate block. During this process complex cellular APs were observed, with decremental foot formations reflecting the fading FP and second depolarizations produced by the SP. In addition, the AV node cells exhibited a progressive loss in maximal diastolic membrane potential (MDP) due to incomplete repolarization. The pause created with the blocked Wenckebach beat was associated with restoration of MDP and reinitiation of the conduction cycle via the FP wavefront. DPW electrophysiology is dynamically involved in the development of AV nodal Wenckebach periodicity. In the intact AV node, the cycle starts with FP that is progressively weakened and then replaced by SP propagation, until block occurs. AV nodal SP modification did not eliminate Wenckebach periodicity but strongly affected its paradigm. © 2011 Wiley Periodicals, Inc.

  8. Legemiddelbivirkninger – forekomst og vurdering av årsakssammenhenger.

    Directory of Open Access Journals (Sweden)

    Tone Westergren

    2009-09-01

    Full Text Available En gjennomgang av spontanrapportene fra den norske bivirkningsdatabasen viser en betydelig geografisk variasjon når det gjelder innrapportering av bivirkninger. I Norge blir disse meldingene evaluert ved RELIS (Regionale legemiddelinformasjonssentre av tverrfaglige team bestående av leger og farmasøyter. Bivirkningsarbeidet ved RELIS gjøres på oppdrag fra Statens legemiddelverk, som har det overordnede ansvar for legemiddelovervåkningen i Norge. Vurderingene baseres på kjent risikoprofil for mistenkte legemidler, indikasjon, dosering, tidsmessig sammenheng mellom reaksjon og medikamentinntak, effekt av seponering og eventuelle andre risikofaktorer. 3345 legemiddel/bivirkningskombinasjoner ble vurdert på bakgrunn av 1408 rapporter i 2006. De fleste mistenkte bivirkningene ble klassifisert som mulige, ettersom andre faktorer også kunne ha spilt en rolle. Få bivirkninger ble klassifisert som sikre. Informasjon om bivirkninger i litteratur og databaser er i flere tilfeller preget av manglende homogenitet, tilfeldige sammentreff i tid, manglende data og lite vurdering av sammenhengen mellom reaksjonen og medisinbruken. Kliniske studier har begrenset mulighet til å påvise annet enn de vanligste bivirkningene. Det kan ta år etter markedsføring å fastslå sammenhengen med mer sjeldne bivirkninger. Frekvenstabeller for bivirkninger er anslag basert på et begrenset antall pasienter, spesielt for nye legemidler. Evaluering av bivirkningsrapporter fra helsepersonell kan avdekke mangel på lett tilgjengelig informasjon og bidra til ny kunnskap om et legemiddels bivirkningsprofil

  9. Russisk oljetransport gjennom Barentshavet : En tilfellestudie av den norske responsen

    OpenAIRE

    Aasen, Kari

    2010-01-01

    Oppgaven er en tilfellestudie av den norske responsen på økningen av russisk oljetransport gjennom Barentshavet. Oljetransporten fra Nordvest-Russland tok seg plutselig dramatisk opp i 2002, noe som kom svært overraskende på norske myndigheter. Hensikten med oppgaven har derfor vært å kartlegge den norske responsen, for å finne ut hva som har preget den. På bakgrunn av kjennetegnene ved responsen har jeg deretter forsøkt å sannsynliggjøre hvilke oppfatninger av Russland som vært dominerende. ...

  10. Possibilities of increased power output from existing generator plants. Feasible changes of existing generators. New technology, ASD (Adjustable Speed Drives); Muligheter for oekt effekt fra eksisterende generatoranlegg. Mulige endringer av bestaaende generatorer. Ny teknologi, ASD (Adustable Speed Drives)

    Energy Technology Data Exchange (ETDEWEB)

    Elstroem, A.

    1996-12-31

    The present paper relates to the increase of power output from existing generator plants in Norway by new operation profiles. The paper focuses on the consequences of increasing the power turnover and production with a particular attention to the generator itself. In addition, some of the possibilities on the use of an ASD (Adjustable Speed Drives) installation are elucidated, which is a concept on regulating the number of revolutions within small limits by synchronous rotation. According to the author, the power output of generator increases between 10 to 30%

  11. Factors affecting the conversion of Zn, Cu, Pb, and Cd in soils - the system of plants in forest; Faktorer som paavirker omsetning av Zn, Cu, Pb og Cd i jord - plantesystemet i skog

    Energy Technology Data Exchange (ETDEWEB)

    Berthelsen, B.O.

    1996-01-01

    The conference paper relates the factors affecting the conversion of long-range transported heavy metals in soils with the focus on the system of forest plants. The paper discusses themes like the mobility of metals in forest soils under the influence of artificial acidification, contribution from metal accumulation in ectomycorrhiza to metal levels in organic surface soils, importance of cutting areas for accumulation and transport of metals in surface soils, concentration of metals in forest vegetation in relation to temporal and geographic differences in the atmospheric precipitation of metals. 6 refs., 5 figs.

  12. Chemometric formulation of bacterial consortium-AVS for improved decolorization of resonance-stabilized and heteropolyaromatic dyes.

    Science.gov (United States)

    Kumar, Madhava Anil; Kumar, Vaidyanathan Vinoth; Premkumar, Manickam Periyaraman; Baskaralingam, Palanichamy; Thiruvengadaravi, Kadathur Varathachary; Dhanasekaran, Anuradha; Sivanesan, Subramanian

    2012-11-01

    A bacterial consortium-AVS, consisting of Pseudomonas desmolyticum NCIM 2112, Kocuria rosea MTCC 1532 and Micrococcus glutamicus NCIM 2168 was formulated chemometrically, using the mixture design matrix based on the design of experiments methodology. The formulated consortium-AVS decolorized acid blue 15 and methylene blue with a higher average decolorization rate, which is more rapid than that of the pure cultures. The UV-vis spectrophotometric, Fourier transform infra red spectrophotometric and high performance liquid chromatographic analysis confirm that the decolorization was due to biodegradation by oxido-reductive enzymes, produced by the consortium-AVS. The toxicological assessment of plant growth parameters and the chlorophyll pigment concentrations of Phaseolus mungo and Triticum aestivum seedlings revealed the reduced toxic nature of the biodegraded products.

  13. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  14. Avian post-construction studies and EIA for planned extension of the Hitra wind-power plant; EIA = environmental impact assessment; Ornitologisk etterundersoekelse og konsekvensutredning i tilknytning til planer for utvidelse av Hitra vindkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Bevanger, K.; Dahl, E.L.; Gjershaug, J.O.; Halley, D.J.; Hanssen, F.O.; Nygaard, T.; Pearson, M.; Pedersen, H.C.; Reitan, O.

    2010-03-15

    The results indicate that the annual number of dead birds recorded varies, and that an annual average probably is slightly less than two dead white-tailed eagles and four willow ptarmigans as long as 24 turbines are operating in the wind-power plant. The number of dead birds recorded is minimum figures. The total collision rate has not been estimated, however, the terrain where the power plant is located is difficult to search, and thus the habitat bias will be significant. Taking into account removal rate (scavenging bias) and search efficiency of the dog (search bias) it is assumed that the real number of casualties is somewhat higher. Dead birds are particularly found near turbines located at the edge of the power plant. There is insufficient evidence to conclude whether the recorded mortality for the white- tailed eagle is or is not acceptable with regard to short- or long-term population development. As regards the willow ptarmigan population, the data, while not conclusive, in combination with population censuses suggests that the power-plant extension will not be unacceptable for population development. Both for the white-tailed eagle and the willow ptarmigan an increased mortality must be expected when the power plant turbine number is increased.It is important to clarify whether there are established breeding pairs within the planning area, particularly in connection to the planned road access from the south. By building this road a general disturbance increase will take place. Whether the routing of the road will conflict with nest sites of red-listed species like the eagle owl and grey-headed wood- pecker is unknown as the routing not was known when the fieldwork took place during spring/summer 2009. There is, however, more reason to believe that the road might threaten an eagle owl territory than the contrary. The existing data are insufficient to conclude whether the encroachments connected to the road building from the south into the power-plant area

  15. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  16. The conditions for use of reed canary grass briquettes and chopped reed canary grass in small heating plants; Foerutsaettningar foer anvaendning av roerflensbriketter och hackad roerflen i mindre vaermecentraler

    Energy Technology Data Exchange (ETDEWEB)

    Paulrud, Susanne; Davidsson, Kent; Holmgren, Magnus A. (Swedish National Testing and Research Inst., Boraas (Sweden)); Hedman, Henry; Oehman, Rikard; Leffler, Joel (ETC, Piteaa (Sweden))

    2010-09-15

    The aim of this study was to test fuel blends of briquettes and chopped reed canary grass in three existing heating plants (50 kW - 500 kW) and elucidate the requirements for good performance and low emissions. In addition, the study investigated production of reed canary grass briquettes using a Polish screw press developed for straw. Some tests with a bale shredder were also undertaken. The screw press technique is of interest for reed canary grass because it is a simple technique, easy to handle, developed for small scale production, and for straw. The test with reed canary grass in this study showed that the technique worked well but that further adjustments and a longer test period are needed in order to achieve higher bulk density and mechanical strength. The test with chopped reed canary grass shows that a system with a forage harvester is slightly more effective than baling and cutting in a bale shredder. The study concluded that few existing heating plants of size 50 kW-1 MW that currently use wood fuels will be able to use reed canary grass without adjustment, conversion or replacement of the combustion equipment. Reed canary grass has 15-20 times higher ash content than wood briquettes and 2-3 times higher ash content than forest residue; the combustion equipment must be able to handle these properties. The boiler must be equipped with a continuously operating ashing system and it must be possible to move the ash bed mechanically. There is a risk of high content of unburned matter if the residence time in the boiler is too short, due to the structure and low bulk density of the reed canary grass ash. Using a blend of wood briquettes and reed canary briquettes results in lower ash content, but also affects the ash chemistry and tends to lower the initial ash fusion temperature compared to using 100 % reed canary grass. Blending chopped reed canary grass and wood chips in an existing small scale heating plant also requires measures to achieve an even fuel

  17. Does Group Composition Affect Learning by Invention?

    Science.gov (United States)

    Wiedmann, Michael; Leach, Ryan C.; Rummel, Nikol; Wiley, Jennifer

    2012-01-01

    Schwartz and Martin ("Cogn Instr" 22:129-184, 2004) as well as Kapur ("Instr Sci", this issue, 2012) have found that students can be better prepared to learn about mathematical formulas when they try to invent them in small groups before receiving the canonical formula from a lesson. The purpose of the present research was to investigate how the…

  18. Patent Work: The Other Side of Invention

    Science.gov (United States)

    Dillon, Tamara

    2009-01-01

    In popular culture, the inventor is often portrayed as a lone tinkerer who emerges from a workshop with some magnificent new device. In reality, most inventions are the collaborative effort of scientists and engineers--usually researchers affiliated with a college or corporation--that result in the discovery, creation, or improvement of either…

  19. Physical tools for textile creativity and invention

    DEFF Research Database (Denmark)

    Heimdal, Elisabeth Jacobsen; Lenau, Torben Anker

    2010-01-01

    Two textile research projects (one completed and one ongoing) are described, where physical inspirational tools are developed and tested with the aim of stimulating textile creativity and invention, i.e. the use of textile materials in new kinds of products, thus bringing textiles into new contexts...

  20. Inventions and Patents: A Practical Tutorial.

    Science.gov (United States)

    Mehta, Hina; Tidwell, Lille; Liotta, Lance A

    2017-01-01

    Patents are designed to protect and encourage creativity and innovation. Patenting a biomedical discovery can be a requirement before a pharmaceutical company or biotech entity will invest in the lengthy and capital-intensive drug development and clinical trials necessary to achieve patient benefit. Although scientists and clinicians are well versed in research publication requirements, patent descriptions and claims are formatted in a manner quite different from a research paper. Patents require (a) a series of logical statements clearly delineating the boundaries of the novel aspects of the invention and (b) sufficient disclosure of the invention so that it can be reproduced by others. Patents are granted only for inventions that meet three conditions: novelty, non-obviousness, and usefulness. Recent changes to US patent law limit the scope of patentable material. Products of nature such as nucleic acids and proteins, or steps used to observe natural events, are no longer patent eligible. This chapter provides basic guidelines and definitions for inventions, inventorship, and patent filing which are summarized using a question and answer format.

  1. Invented Rule with English Language Learners

    Science.gov (United States)

    Boyer, Valerie E.; Martin, Kathryn Y.

    2012-01-01

    The purpose of this study was to utilize an invented rule with English language learners (ELLs) in a clinical setting to determine differences based on language and age of the children. The performance was correlated with teacher reports of strong and weak language learning. Using a within-participants design, ELLs of age three to five were taught…

  2. Does Group Composition Affect Learning by Invention?

    Science.gov (United States)

    Wiedmann, Michael; Leach, Ryan C.; Rummel, Nikol; Wiley, Jennifer

    2012-01-01

    Schwartz and Martin ("Cogn Instr" 22:129-184, 2004) as well as Kapur ("Instr Sci", this issue, 2012) have found that students can be better prepared to learn about mathematical formulas when they try to invent them in small groups before receiving the canonical formula from a lesson. The purpose of the present research was to investigate how the…

  3. Invented Rule with English Language Learners

    Science.gov (United States)

    Boyer, Valerie E.; Martin, Kathryn Y.

    2012-01-01

    The purpose of this study was to utilize an invented rule with English language learners (ELLs) in a clinical setting to determine differences based on language and age of the children. The performance was correlated with teacher reports of strong and weak language learning. Using a within-participants design, ELLs of age three to five were taught…

  4. The Invention of the Electric Light

    NARCIS (Netherlands)

    Van der Kooij, B.J.G.

    2015-01-01

    This case study is a historic analysis of the developments that resulted in the electric light. The range of inventions that started with the demonstrations of a sparkling bright light by the Englishman Humphry Davy and the Russian Vasilii Petrov in the early nineteenth century, over the next centur

  5. The Invention of the Steam Engine

    NARCIS (Netherlands)

    Van der Kooij, B.J.G.

    2015-01-01

    This casestudy is a historic analysis of the developments that resulted in the steam engine. The range of inventions that started with Savery's 'Miner's Friend' (a water pump to solve the dramatic water problem in the British eighteenth century mines) over a century culminated in the steam engine us

  6. The Invention of the Steam Engine

    NARCIS (Netherlands)

    Van der Kooij, B.J.G.

    2015-01-01

    This casestudy is a historic analysis of the developments that resulted in the steam engine. The range of inventions that started with Savery's 'Miner's Friend' (a water pump to solve the dramatic water problem in the British eighteenth century mines) over a century culminated in the steam engine us

  7. The Invention of the Electric Light

    NARCIS (Netherlands)

    Van der Kooij, B.J.G.

    2015-01-01

    This case study is a historic analysis of the developments that resulted in the electric light. The range of inventions that started with the demonstrations of a sparkling bright light by the Englishman Humphry Davy and the Russian Vasilii Petrov in the early nineteenth century, over the next

  8. 45 CFR 650.9 - Unwanted inventions.

    Science.gov (United States)

    2010-10-01

    ... inventor to be dedicated to the public through publication in scientific and engineering journals or as a... encouraging the awardee and inventor to promptly make all research results available to the scientific and... ascertaining that the inventor also does not want to patent, send a copy of the invention disclosure to...

  9. Simulation and cost analysis of systems for handling of fuel straw - applied to a heating plant in Skaane; Simulering och kostnadsanalys av hanteringssystem foer braenslehalm - tillaempning foer en vaermeanlaeggning i Skaane

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Daniel

    2010-05-15

    The following conclusions were drawn from this study: - The total costs for delivery of fuel straw to heating plants ranged from about 130 SEK/MWh to 180 SEK/MWh (1 SEK approx 0.14 USD), depending on the payment to farmers for the straw, the storage method used, the profit margins of the contractors, etc. - The area investigated, which covered parts of the municipalities of Svaloev, Esloev and Kaevlinge, has very good conditions for harvest of straw compared with other parts of Sweden. The yield of winter wheat (and straw) is high, the road network is well developed, the fields are concentrated and large, the straw crops ripen early, and security of supply between years is high. - For a harvest and handling system with an average capacity of about 8 000 tonnes of straw per year, the simulations showed that a machine system with six balers, two loaders in the field, four transporters (tractor), one loader at the stores and lorry transport to the heating plant was cost-effective with regard to system performance (for example, expressed as the average amount of straw baled per year with a moisture content below 18%, the average quantity of straw per year put into storage prior to 1 October, the average lying time for the straw between threshing and baling, etc.). - Harvesting straw from various crops (in this case winter rape, rye and winter wheat) instead of only winter wheat had no major impact on costs, but increased the chance to harvest 'greyer' straw with lower contents of alkali metals, chlorine, etc. Only including fields of at least 5 ha had a minor impact on costs. Noticeable cost savings occurred when the field size limit was set to 10 ha or more. Increasing the moisture content limit at baling to 20% made it possible to harvest more straw, especially in years with difficult weather conditions. - The storage method used had a decisive impact on costs. Outdoor storage decreased the total costs to 133 SEK/MWh (7% storage losses), compared with 154

  10. Noise and noise disturbances from wind power plants - Tests with interactive control of sound parameters for more comfortable and less perceptible sounds; Buller och bullerstoerningar fraan vindkraftverk - Foersoek med interaktiv styrning av ljudparametrar foer behagligare och mindre maerkbara ljud

    Energy Technology Data Exchange (ETDEWEB)

    Persson-Waye, K.; Oehrstroem, E.; Bjoerkman, M.; Agge, A. [Goeteborg Univ. (Sweden). Dept. of Environmental Medicine

    2001-12-01

    In experimental pilot studies, a methodology has been worked out for interactively varying sound parameters in wind power plants. In the tests, 24 persons varied the center frequency of different band-widths, the frequency of a sinus-tone and the amplitude-modulation of a sinus-tone in order to create as comfortable a sound as possible. The variations build on the noise from the two wind turbines Bonus and Wind World. The variations were performed with a constant dba level. The results showed that the majority preferred a low-frequency tone (94 Hz and 115 Hz for Wind World and Bonus, respectively). The mean of the most comfortable amplitude-modulation varied between 18 and 22 Hz, depending on the ground frequency. The mean of the center-frequency for the different band-widths varied from 785 to 1104 Hz. In order to study the influence of the wind velocity on the acoustic character of the noise, a long-time measurement program has been performed. A remotely controlled system has been developed, where wind velocity, wind direction, temperature and humidity are registered simultaneously with the noise. Long-time registrations have been performed for four different wing turbines.

  11. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  12. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  13. Bochdalek Hernia As A Cause Of Intermittent AV Block

    OpenAIRE

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-01-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  14. Introduction to AVS2 Scene Video Coding Techniques

    Institute of Scientific and Technical Information of China (English)

    Jiaying Yan; Siwei Dong; Yonghong Tian; Tiejun Huang

    2016-01-01

    The second generation Audio Video Coding Standard (AVS2) is the most recent video coding standard. By introducing several new coding techniques, AVS2 can provide more efficient compression for scene videos such as surveillance videos, conference videos, etc. Due to the limited scenes, scene videos have great redundancy especially in background region. The new scene video coding techniques applied in AVS2 mainly focus on reducing redundancy in order to achieve higher compression. This paper introduces several important AVS2 scene video coding techniques. Experimental results show that with scene video coding tools, AVS2 can save nearly 40%BD⁃rate (Bjøntegaard⁃Delta bit⁃rate) on scene videos.

  15. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  16. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  17. Inventory of future power and heat production technologies. Partial report Wind Power; Inventering av framtidens el- och vaermeproduktionstekniker. Delrapport Vindkraft

    Energy Technology Data Exchange (ETDEWEB)

    Clausen, Niels-Erik; Lawaetz, Henrik; Lemming, Joergen; Morthorst, Poul Erik (Risoe National Laboratory, Roskilde (Denmark))

    2008-12-15

    The development of the wind energy technology has been very successful from the 1970s and up till now. Initially there was a battle between wind turbine concepts, but the commercial winner today is the three-bladed horizontal axis, upwind, electricity producing and grid connected wind turbine with availability on mature markets somewhere around 99%. An important contributor to the growth of the European market for wind energy technology has been EU framework legislation combined with legislation at the national level. The binding target for renewable energy in Sweden is proposed to be 49% of the final energy consumption in 2020 compared to 39.8% in 2005. To stimulate the development of wind energy and to promote a specific national goals Sweden is mainly using an electricity certificate system. The target is to increase the production of electricity from renewable sources by 17 TWh in 2016, relative to corresponding production in 2002. There is not at specific target for the use of wind energy. A future energy system that includes a high proportion of wind energy will be expected to meet the same requirements for security of supply and economic efficiency as the energy systems of today. The variability of wind power create a specific challenges for the future energy systems compared to those of today. The economics of wind power depends mainly of investment cost, operation and maintenance costs, electricity production and turbine lifetime. An average turbine installed in Europe has a total investment cost of 1.230 Euro/kW with a typically variation from approximately 1000 Euro/kW to approximately 1400 Euro/kW. The calculated costs per kWh wind generated power range from approximately 0.07-0.10 Euro/kWh at sites with low average wind speeds to approximately 0.05-0.065 Euro/kWh at good coastal positions, with an average of approximately 0.07 Euro/kWh at a medium wind site. Offshore costs are largely dependent on weather and wave conditions, water depth, and distance to the coast. The cost of wind generated power is higher for offshore wind farms that for on land ones ranging from approximately 0.06 Euro/kWh to more than 0.09 Euro/kWh. Assuming a learning rate at 10% and a doubling time of total installed capacity of four years the cost interval would in 2015 be approximately 0.048 to 0.055 Euro/kWh for a coastal and inland site, respectively

  18. Technical inventions that enabled artificial infant feeding.

    Science.gov (United States)

    Obladen, Michael

    2014-01-01

    Artificial feeding of infants, called hand-feeding, was unsafe well into the 19th century. This paper aims to identify technical innovations which made artificial feeding less dangerous. In rapid succession from 1844 to 1886, the vulcanization of rubber, production of rubber teats, cooling machines for large-scale ice production, techniques for milk pasteurization, evaporation and condensation, and packing in closed tins were invented or initiated. Remarkably, most of these inventions preceded the discovery of pathogenic bacteria. The producers of proprietary infant formula made immediate use of these innovations, whereas in the private household artificial feeding remained highly dangerous - mostly because of ignorance about bacteria and hygiene, and partly because the equipment for safe storage, transport, preparation and application of baby food was lacking.

  19. Invented genealogies as political mythologies: definitionand examples

    Directory of Open Access Journals (Sweden)

    Filip-Lucian Iorga

    2012-10-01

    Full Text Available The genealogical imaginary is a subcategory of the imaginary referring to the origin and it comprises a wide range of genealogical myths: fictitious ancestors, whether divine or human, fabulous kinships, invented genealogies, descendancies which are impossible to certify with documents, erroneous interpretations of certain degrees of kinship, real genealogies that have received unexpected interpretations and historiographic clichés grown on more or less attestable genealogies. The case of the Balş family is one of the most interesting: trying to integrate in the political structures of the Austrian and Russian Empire, some members of this old Moldavian family invent a fictitious genealogy that links the French counts of Baux, the Balsa family, a Serbian medieval dynasty and the Balş family, Moldavian boyars.

  20. The Telephone: An Invention with Many Fathers

    Energy Technology Data Exchange (ETDEWEB)

    Brenni, Paolo (CNR-FST-IMSS, Florence, Italy)

    2008-10-01

    The names of A.G. Bell, A. Meucci, P.Reis, E. Gray, just to mention the most important ones, are all connected with the invention of the telephone. Today, the Italian inventor A. Meucci is recognized as being the first to propose a working prototype of the electric telephone. However, for a series of reasons his strenuous efforts were not rewarded. I will not repeat here the endless and complex disputes about the 'real father' of the telephone. From an historical point of view it is more interesting to understand why so many individuals from different backgrounds conceived of a similar apparatus and why most of these devices were simply forgotten or just remained laboratory curiosities. The case of the development of the telephone is an emblematic and useful example for better understanding the intricate factors which are involved in the birth of an invention and reasons for its success and failure.

  1. Nanotechnological inventions considerably improve performance characteristics

    Directory of Open Access Journals (Sweden)

    VLASOV Vladimir Alexeevich

    2014-06-01

    Full Text Available The invention «The method of production of carbon nanomaterial (RU 2509053» can be used as an additive for concretes and polymers which significantly improves their performance characteristics. The method of production of carbon nanomaterial consists of the following stages: preliminary preparation of sphagnous moss when it is refined from foreign admixtures, dried up to 10% humidity and ground, then ground material is exposed to pyrolysis under the temperature 850–950оC for 1–2 hours and cooled up to the environment temperature. After that amorphous carbon obtained in pyrolysis is treated with mechanical activation in the variable planetary mill for 7–10 hours. The invention makes it possible to provide increased outcome of nanotubes with high cleanliness. The invention «The method of production of nanodispersed metal powders and alloys of them (RU 2509626» relates to the powder metallurgy. Powder metal chloride or powder mixture at least of two metal chlorides is treated in the environment of the water steam which is supplied in reaction space at the rate of 50–100 ml/min at the temperature 400–800оC at the presence of absorbent carbon or introducing carbon oxide (II obtained during dissolution of formic acid HCOOH. The invention provides reliable production of nanodispersed metal powders and alloys of them from 3-d metal range: Ni, Co, Cu, Fe, Zn which can be used in powder metallurgy to improve baking process, in chemical industry as the fillers of polymers and reaction catalysts; as additives to anticorrosive covers, etc.

  2. Review of The Invention of Enterprise

    Directory of Open Access Journals (Sweden)

    Michael E. Marotta

    2011-05-01

    Full Text Available The Invention of Enterprise: Entrepreneurship from Ancient Mesopotamia to Modern Times, David S. Landes, Joel Mokyr, and William J. Baumol, eds., Princeton University Press, 2010, is a dense anthology that provides an “orbital view” of the history of trade and commerce. The essays encompass several theoretic frameworks while following three themes: the creation of enterprises; the distinctions between creative and corrosive capitalism; and the societies that engender those different modes.

  3. Research use of patented inventions: opening remarks

    OpenAIRE

    Fernández de Labastida, José M.

    2006-01-01

    Opening remarks for the 2006 conference in Madrid on the research use of patented inventions. The conference, which was held at CSIC on 18-19 May 2006, was jointly organised by the Spanish National Research Council (CSIC), the Spanish Patent and Trademark Office (OEPM) and the OECD, with support from the European Patent Office (EPO) through its European Patent Academy. The conference brochure is also included as an attachment to the Opening remarks file.

  4. Deepening Learning through Learning-by-Inventing

    OpenAIRE

    Mikko Apiola; Matti Tedre

    2013-01-01

    It has been shown that deep approaches to learning, intrinsic motivation, and self-regulated learning have strong positive effects on learning. How those pedagogical theories can be integrated in computing curricula is, however, still lacking empirically grounded analyses. This study integrated, in a robotics-based programming class, a method of learning-by-inventing, and studied its qualitative effects on students’ learning through 144 interviews. Five findings were related with learning the...

  5. 14 CFR 1245.105 - Waiver after reporting inventions.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Waiver after reporting inventions. 1245.105... INTELLECTUAL PROPERTY RIGHTS Patent Waiver Regulations § 1245.105 Waiver after reporting inventions. (a) The provisions of this section apply to petitions for waiver of domestic rights to identified inventions which...

  6. 43 CFR 6.5 - Rights in inventions.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Rights in inventions. 6.5 Section 6.5 Public Lands: Interior Office of the Secretary of the Interior PATENT REGULATIONS Inventions by Employees § 6.5 Rights in inventions. (a) The rules prescribed in this section shall be applied in determining...

  7. 37 CFR 4.1 - Complaints regarding invention promoters.

    Science.gov (United States)

    2010-07-01

    ... invention promoters. 4.1 Section 4.1 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL COMPLAINTS REGARDING INVENTION PROMOTERS § 4.1 Complaints regarding invention promoters. These regulations govern the Patent and Trademark Office's (Office...

  8. 34 CFR 6.1 - Publication or patenting of inventions.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Publication or patenting of inventions. 6.1 Section 6.1 Education Office of the Secretary, Department of Education INVENTIONS AND PATENTS (GENERAL) § 6.1 Publication or patenting of inventions. It is the general policy of the Department that the results of...

  9. 7 CFR 550.54 - Invention disclosure and utilization reporting.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Invention disclosure and utilization reporting. 550.54... Management of Agreements Reports and Records § 550.54 Invention disclosure and utilization reporting. (a) The Cooperator shall report Invention Disclosures and Utilization information electronically via i-Edison Web...

  10. 10 CFR 603.860 - Rights to inventions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Rights to inventions. 603.860 Section 603.860 Energy... to Other Administrative Matters Intellectual Property § 603.860 Rights to inventions. (a) The contracting officer should negotiate rights in inventions that represent an appropriate balance between the...

  11. 48 CFR 27.305-4 - Protection of invention disclosures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Protection of invention....305-4 Protection of invention disclosures. (a) The Government will, to the extent authorized by 35 U.S.C. 205, withhold from disclosure to the public any invention disclosures reported under the patent...

  12. 37 CFR 1.293 - Statutory invention registration.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Statutory invention... Public Use Proceedings § 1.293 Statutory invention registration. (a) An applicant for an original patent... specification and drawings be published as a statutory invention registration. Any such request must be signed...

  13. 40 CFR 40.160-3 - Reporting of inventions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Reporting of inventions. 40.160-3... ASSISTANCE RESEARCH AND DEMONSTRATION GRANTS § 40.160-3 Reporting of inventions. As provided in appendix B of 40 CFR part 30, immediate and full reporting of all inventions to the Environmental Protection Agency...

  14. 14 CFR 1260.59A - Invention reporting and rights.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Invention reporting and rights. 1260.59A... COOPERATIVE AGREEMENTS General Special Conditions § 1260.59A Invention reporting and rights. Invention Reporting and Rights October 2000 (a) As used in this provision: (1) The term “invention” means any...

  15. 76 FR 55069 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2011-09-06

    ... invention relates to an improved system for measuring bone mineral density (BMD). BMD measurement is an... HUMAN SERVICES National Institutes of Health Government-Owned Inventions; Availability for Licensing... inventions listed below are owned by an agency of the U.S. Government and are available for licensing in the...

  16. 76 FR 13193 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2011-03-10

    ... generated also increases. The system of the present invention measures the induced RF signal and changes a... HUMAN SERVICES National Institutes of Health Government-Owned Inventions; Availability for Licensing... inventions listed below are owned by an agency of the U.S. Government and are available for licensing in the...

  17. 75 FR 23272 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-05-03

    ... Method of Measuring Ultraviolet A (UVA) Protection in Sunscreen Products Description of Invention: There... HUMAN SERVICES National Institutes of Health Government-Owned Inventions; Availability for Licensing... inventions listed below are owned by an agency of the U.S. Government and are available for licensing in the...

  18. 7 CFR 1160.505 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Patents, copyrights, inventions and publications. 1160... PROGRAM Fluid Milk Promotion Order Miscellaneous § 1160.505 Patents, copyrights, inventions and publications. (a) Any patents, copyrights, trademarks, inventions or publications developed through the use...

  19. 50 CFR 82.19 - Patents and inventions.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Patents and inventions. 82.19 Section 82...-IN-AID (MARINE MAMMAL PROTECTION ACT OF 1972) Administration § 82.19 Patents and inventions. Determination of the patent rights in any inventions or discoveries resulting from work under...

  20. 7 CFR 1150.184 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Patents, copyrights, inventions and publications. 1150... Dairy Promotion and Research Order Miscellaneous § 1150.184 Patents, copyrights, inventions and publications. Any patents, copyrights, trademarks, inventions or publications developed through the use...

  1. 7 CFR 1260.215 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions and publications... AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Miscellaneous § 1260.215 Patents, copyrights, inventions and publications. (a) Any patents, copyrights, inventions or publications...

  2. 77 FR 71004 - Patents and Inventions; Delegation of Authority

    Science.gov (United States)

    2012-11-28

    ... HUMAN SERVICES Centers for Disease Control and Prevention Patents and Inventions; Delegation of... administer and make decisions regarding the invention and patent program of CDC and the authority to make determinations of rights in inventions and patents in which CDC and the Department have an interest....

  3. 7 CFR 1220.254 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications... Miscellaneous § 1220.254 Patents, copyrights, inventions, and publications. (a) Any patents, copyrights..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit...

  4. 7 CFR 1230.88 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications... Information Order Miscellaneous § 1230.88 Patents, copyrights, inventions, and publications. Any patents..., leasing, franchising, or other uses of such patents, copyrights, inventions, or publications inure to...

  5. 75 FR 39545 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-07-09

    ... . Substituted IL-15 Description of Invention: Interleukin-15 (IL-15) is an immune system modulating protein... federally-funded research and development. Foreign patent applications are filed on selected inventions to... applications. Diagnostic H5N1 Avian Influenza Virus Peptides Description of Invention: The recent spread...

  6. Drug Delivery Research: The Invention Cycle.

    Science.gov (United States)

    Park, Kinam

    2016-07-05

    Controlled drug delivery systems have been successful in introducing improved formulations for better use of existing drugs and novel delivery of biologicals. The initial success of producing many oral products and some injectable depot formulations, however, reached a plateau, and the progress over the past three decades has been slow. This is likely due to the difficulties of formulating hydrophilic, high molecular weight drugs, such as proteins and nucleic acids, for targeting specific cells, month-long sustained delivery, and pulsatile release. Since the approaches that have served well for delivery of small molecules are not applicable to large molecules, it is time to develop new methods for biologicals. The process of developing future drug delivery systems, termed as the invention cycle, is proposed, and it starts with clearly defining the problems for developing certain formulations. Once the problems are well-defined, creative imagination examines all potential options and selects the best answer and alternatives. Then, innovation takes over to generate unique solutions for developing new formulations that resolve the previously identified problems. Ultimately, the new delivery systems will have to go through a translational process to produce the final formulations for clinical use. The invention cycle also emphasizes examining the reasons for success of certain formulations, not just the reasons for failure of many systems. Implementation of the new invention cycle requires new mechanisms of funding the younger generation of scientists and a new way of identifying their achievements, thereby releasing them from the burden of short-termism.

  7. Economy and Transparency: The Model Invention

    Directory of Open Access Journals (Sweden)

    Mahmud Hassan TALUKDAR

    2013-12-01

    Full Text Available Relation of Transparency and Economic growth is a long global debate in the society. Theoretically, policy makers, scholars and researchers argue that there is a close relation among these two variables. However, the quantitative relation and any global model is yet unrevealed. So, the main aim of this paper is to ascertain the nature, dimension and extent of the relationship between economy and Transparency as well as to invent a global model. This paper is useful for researchers, planners, policy makers and scholars who are directly or indirectly involved or willing to involve in the thrust for quantitative relation of these two variables. Literature review is the main source of information of this study. In introductory section, this paper briefly describes theoretical relationship of economy and Transparency as well as it also describes the proxy variables.GDP (2012 of different countries are used as proxy of Economy and Corruption Perception Index (CPI scores (2012 of different countries are used as proxy of level of Transparency. In methodology section this paper describes the detail methodology, sampling procedure and level of analysis. This study randomly selects 30 countries (10 from higher CPI scores+10 from moderate CPI scores+ 10 from lower CPI scores around the globe as sample. In the third section, this research presents the correlation value which divulge that there is a positive correlation (p=.047 with 95% confidence level. That reveals, if the level of transparency of any country increase, the GDP also increase accordingly. Then in this section two quantitative models are developed using linear regression analysis. First invented model is: Economy (GDP in billion US$ = [(8.983*Level of transparency -108.11]. This paper termed the first invented model as “Mahmud EcoT Model-1”. This model calibrates that one unit improvement of transparency leads 8.98 billion US$ improvement in the GDP of a country. Then taking this unit

  8. Mutagenesis in ORF AV2 affects viral replication in Mungbean yellow mosaic India virus

    Indian Academy of Sciences (India)

    A Rouhibakhsh; Q M I Haq; V G Malathi

    2011-06-01

    Mungbean yellow mosaic India virus (MYMIV) is a whitefly-transmitted begomovirus with a bipartite genome. We investigate the functions of the MYMIV-AV2 protein, the open reading frame present upstream of the coat protein gene in DNA A component. The ability of MYMIV-AV2 mutants to replicate, spread and cause symptoms in legume hosts, blackgram, cowpea and French bean was analysed. Plants agroinoculated with mutants K73R, C86S and the double mutant C84S, C86S showed increase in severity of symptoms compared with the wild type. However, mutants W2S and H14Q,G15E caused marked attenuation of symptoms. While the double mutants C84S,C86S caused a 50-fold increase in double-stranded supercoiled and single-stranded DNA accumulation, the mutations W2S and H14Q,G15E showed a decrease in double-stranded supercoiled and single-stranded viral DNA accumulation. Because AV2 mutants affect the ratio between open circular and supercoiled DNA forms, we hypothesize that these mutations may modulate the functions of the replication initiation protein.

  9. Making the Failure More Productive: Scaffolding the Invention Process to Improve Inquiry Behaviors and Outcomes in Invention Activities

    Science.gov (United States)

    Holmes, N. G.; Day, James; Park, Anthony H. K.; Bonn, D. A.; Roll, Ido

    2014-01-01

    Invention activities are Productive Failure activities in which students attempt (and often fail) to invent methods that capture deep properties of a construct before being taught expert solutions. The current study evaluates the effect of scaffolding on the invention processes and outcomes, given that students are not expected to succeed in their…

  10. Making the Failure More Productive: Scaffolding the Invention Process to Improve Inquiry Behaviors and Outcomes in Invention Activities

    Science.gov (United States)

    Holmes, N. G.; Day, James; Park, Anthony H. K.; Bonn, D. A.; Roll, Ido

    2014-01-01

    Invention activities are Productive Failure activities in which students attempt (and often fail) to invent methods that capture deep properties of a construct before being taught expert solutions. The current study evaluates the effect of scaffolding on the invention processes and outcomes, given that students are not expected to succeed in their…

  11. Bioseguridad en granjas avícolas

    Directory of Open Access Journals (Sweden)

    Sandra L. Ricaurte Galindo

    2005-02-01

    Full Text Available La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extraños a la granja, limpieza y desinfección de los galpones, control de visitas, evitar el stress en las aves encasetadas, evitar la contaminación del pienso, control de vacunaciones y medicaciones y control de deyecciones, cadáveres, etc.The biosecurity is the group of practical of handling designed to prevent the entrance and agents' pathologies transmission that can affect the sanity in the poultry farms. The biosecurity is since a fundamental part of any poultry company it provides an increase of the productivity of the chickens and hens and an increase in the economic yield. In general lines, the localization of the farm should be contemplated, characteristic constructive of the ship, control of strange chickens and hens to the farm, cleaning and disinfection of the ship, control of visits, to avoid the stress in the birds housed, to avoid the contamination of the I think, control of vaccinations and medications and dejections control, cadavers, etc.

  12. Phase 4 paroxysmal AV block in a patient with scleroderma.

    Science.gov (United States)

    Butschek, Ross; Powell, Brian D; Littmann, Laszlo

    2013-01-01

    A 72-year-old man with limited cutaneous systemic scleroderma was hospitalized for two episodes of witnessed syncope. The baseline 12-lead electrocardiogram was normal but on telemetry there were numerous episodes of paroxysmal AV block with asystolic periods of up to 7.5 s duration. Analysis of the rhythm strips revealed phase 4 intra-His bundle block characterized by critical P-P intervals that triggered the AV block, and a narrow range of junctional escape to subsequent P wave intervals that were required to release the AV block. A dual chamber pacemaker was implanted. Copyright © 2013 Elsevier Inc. All rights reserved.

  13. Ishockeykjelke - Understell: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  14. How important are local inventive milieus

    DEFF Research Database (Denmark)

    Ejermo, Olof; Hansen, Høgni Kalsø

    2015-01-01

    for demographic and sector effects along with the educational characteristics of parents. This approach allows us to trace how location history influences individuals’ inventive capacity. We focus on three types of influences: (a) future inventors in the municipality around the time of birth, (b) future inventors...... around the time of graduation from high school and (c) future inventors at graduation from higher education. We find suggestive evidence that co-locating with future inventors may impact the probability of becoming an inventor. The most consistent effect is found for place of higher education; some...

  15. How important are local inventive milieus

    DEFF Research Database (Denmark)

    Ejermo, Olof; Hansen, Høgni Kalsø

    2015-01-01

    around the time of graduation from high school and (c) future inventors at graduation from higher education. We find suggestive evidence that co-locating with future inventors may impact the probability of becoming an inventor. The most consistent effect is found for place of higher education; some...... for demographic and sector effects along with the educational characteristics of parents. This approach allows us to trace how location history influences individuals’ inventive capacity. We focus on three types of influences: (a) future inventors in the municipality around the time of birth, (b) future inventors...... a higher education affect the choice of becoming an inventor....

  16. "Oktober i lederstolen" og "Harlekins Alle hjerters dag" : to noveller av Neil Gaiman : oversatt og kommentert

    OpenAIRE

    Eilertsen, Helle Elisabet Jæger

    2011-01-01

    Oppgaven består av oversettelser av to noveller skrevet av Neil Gaiman, og en kommentardel. Novellene er innenfor sjangeren fantastisk litteratur. Kommentardelen tar for seg relevante problemstillinger, blant annet oversettelse av navn, særegne uttrykk og dobbeltbetydning. Den tar også for seg hjemliggjøring/fremmedgjøring og valg av stil. Dette er knyttet til oversettelsesteoretikere som Schleiermacher, Nida, Koller og Berman.

  17. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  18. Plant isoflavone and isoflavanone O-methyltransferase genes

    Science.gov (United States)

    Broeckling, Bettina E.; Liu, Chang-Jun; Dixon, Richard A.

    2014-08-19

    The invention provides enzymes that encode O-methyltransferases (OMTs) from Medicago truncatula that allow modification to plant (iso)flavonoid biosynthetic pathways. In certain aspects of the invention, the genes encoding these enzymes are provided. The invention therefore allows the modification of plants for isoflavonoid content. Transgenic plants comprising such enzymes are also provided, as well as methods for improving disease resistance in plants. Methods for producing food and nutraceuticals, and the resulting compositions, are also provided.

  19. Alteration of plant meristem function by manipulation of the Retinoblastoma-like plant RRB gene

    Science.gov (United States)

    Durfee, Tim; Feiler, Heidi; Gruissem, Wilhelm; Jenkins, Susan; Roe, Judith; Zambryski, Patricia

    2007-01-16

    This invention provides methods and compositions for altering the growth, organization, and differentiation of plant tissues. The invention is based on the discovery that, in plants, genetically altering the levels of Retinoblastoma-related gene (RRB) activity produces dramatic effects on the growth, proliferation, organization, and differentiation of plant meristem.

  20. Alteration of plant meristem function by manipulation of the Retinoblastoma-like plant RRB gene

    Energy Technology Data Exchange (ETDEWEB)

    Durfee, Tim (Madison, WI); Feiler, Heidi (Albany, CA); Gruissem, Wilhelm (Forch, CH); Jenkins, Susan (Martinez, CA); Roe, Judith (Manhattan, KS); Zambryski, Patricia (Berkeley, CA)

    2007-01-16

    This invention provides methods and compositions for altering the growth, organization, and differentiation of plant tissues. The invention is based on the discovery that, in plants, genetically altering the levels of Retinoblastoma-related gene (RRB) activity produces dramatic effects on the growth, proliferation, organization, and differentiation of plant meristem.

  1. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  2. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  3. EST Table: AV399431 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399431 NV120218 10/09/28 91 %/131 aa ref|NP_047488.1| CG30 [Bombyx mori NPV] gb|A...AC63757.1| CG30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  4. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  5. EST Table: AV404175 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404175 pg--0560 10/09/28 100 %/209 aa ref|NP_040587.1| capsid component [Enteroba...EFF06860.1| phage major capsid protein E [Escherichia coli B185] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404434 pg-- ...

  6. EST Table: AV399451 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399451 NV120246 10/09/28 94 %/223 aa ref|NP_047521.1| AcMNPV orf124 [Bombyx mori ...NPV] gb|AAC63790.1| AcMNPV orf124 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399564 NV12 ...

  7. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  8. AV-95 Sun Devil: High-Speed Military Rotorcraft

    Science.gov (United States)

    1996-01-01

    The AV-95 Sun Devil must combine helicopter capabilities, such as vertical takeoff and landings (VTOL) and rotor-powered flight, along with long-duration cruise and high-speed dash capabilities unobtainable by conventional helicopters. To be able to perform both tasks, and perform them well, the AV-95 Sun Devil design incorporates several unconventional devices; the AV-95 uses two convertible turbofan engines, able to provide both shaft power for the main rotor and tall fan as well as jet thrust either separately or simultaneously. Other devices used for the AV-95 include a variable diameter main rotor and a blown flap. In helicopter mode, the AV-95 Sun Devil performs like a winged helicopter. The addition of wings to an attack helicopter results in two significant advantages. First, the addition of wings makes a helicopter more maneuverable than a wingless, but otherwise similar helicopter. Second, since the wings produce lift, rotor stall and compressibility effects can be significantly delayed at high tip velocities. In fixed-wing mode, the main rotor is completely off-loaded but slightly powered, and the rotor diameter has been minimized. The AV-95 Sun Devil has many advantages over other VTOL aircraft. The conversion process is simple and fast; conversion does not make the AV-95 vulnerable to enemy attack during conversion such as a tilt-wing or a tilt-rotor. Stop-rotor aircraft and a stowed rotor aircraft require heavy breaking of the rotor for conversion; this adds time for conversion and weight to the aircraft. Because the AV-95 never stops the rotor in flight, much weight is spared, and conversion is much simpler and faster.

  9. EST Table: AV404360 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404360 pg--0892 11/12/09 n.h 10/09/28 61 %/132 aa sp|P03764.2|STF_LAMBD RecName: ...Full=Side tail fiber protein 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404360 pg-- ...

  10. EST Table: AV399747 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399747 NV120691 10/09/28 89 %/128 aa ref|YP_950793.1| gp41 [Maruca vitrata MNPV] ...gb|ABL76015.1| gp41 [Maruca vitrata MNPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399524 NV12 ...

  11. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  12. Gradering av kvaliteten på dokumentasjonen

    Directory of Open Access Journals (Sweden)

    Gunn E. Vist

    2013-11-01

    Full Text Available Hva menes med at noe er ”godt dokumentert”? I hvilken grad kan vi stole på forskningsresultater? Den mest brukte metoden for å vurdere kvalitet på dokumentasjon og styrke på anbefalinger er GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE brukes i systematiske oversikter og i retningslinjer der man vurderer effekten av og gir anbefalinger om ulike behandlingsalternativer. I GRADE gjøres et klart skille mellom kvaliteten på dokumentasjonen og styrken på anbefalingene. For å vurdere kvaliteten på dokumentasjonen tar GRADE utgangspunkt i en godt utført systematisk oversikt som omfatter den aktuelle problemstillingen. Både randomiserte forsøk og observasjonsstuder kan inngå. GRADE benytter fem kriterier som vurderes for eventuell nedgradering av kvaliteten på dokumentasjonen: studiekvalitet, konsistens mellom studiene, direkthet, presisjon og rapporteringsskjevheter. I tillegg kan observasjonsstudier vurderes for oppgradering ved følgende tre kriterier: sterke assosiasjoner, dose-responseffekter og forvekslingsfaktorer. Alle vurderingene noteres og presenteres sammen med resultatene i oppsummeringstabeller.Vist GE, Sæterdal I, Vandvik PO, Flottorp SA. Grading the quality of the evidence. Nor J Epidemiol 2013; 23 (2: 151-156.ENGLISH SUMMARY What is meant by the claim that something is “well documented”? How much confidence can we have in the results? The most commonly used method to grade the quality of the evidence is GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE is used in systematic reviews, where the effects of different treatments or options are being compared, and in guidelines with recommendations about the competing options. GRADE makes a clear distinction between the quality of the evidence and the strength of recommendation. When grading the quality of the evidence with GRADE, the starting point is a well conducted systematic review of research on the

  13. Exploring the locus of invention : The dynamics of network communities and firms’ invention productivity

    NARCIS (Netherlands)

    Sytch, M.; Tatarynowicz, A.

    2014-01-01

    Departing from prior research analyzing the implications of social structure for actors' outcomes by applying either an ego network or a global network perspective, this study examines the implications of network communities for the invention productivity of firms. Network communities represent

  14. Evaluation of Energy-Related Inventions Program: An Empirical Analysis of 204 Inventions

    Energy Technology Data Exchange (ETDEWEB)

    Brown, M.A.

    1987-01-01

    This report is an evaluation of the Energy-Related Inventions Program (ERIP). It assesses the program's effectiveness and impacts, characterizes participating inventions and inventors, and identifies correlates of successful commercialization in order to suggest possible improvements. Seventy of the 204 ERIP inventions that were studied were successfully introduced into the market, accounting for more than $200M in sales from 1976 through 1984. During 1984, 921 full-time equivalent employees were supported directly by ERIP inventors or their licensees. (Estimates of indirect economic impacts are also contained in the report.) Data on patterns of fund raising clearly show a need for assistance by programs like ERIP. Commercially successful inventors shared several traits. They had less formal education, fewer patents, more work experience in small firms, more outside funding early in their work, more shared responsibility with others for invention development, more management experience, and greater previous experience with starting new businesses. Recommendations are made regarding: (1) priorities for allocating ERIP grants; (2) improved efficiency of the NBS/DOE operations; (3) delivery of technical and commercialization assistance to grant recipients; and (4) further evaluation research.

  15. Inventing Songs, Inventing Worlds: The "Genesis" of Creative Thought and Activity in Young Children's Lives

    Science.gov (United States)

    Barrett, Margaret S.

    2006-01-01

    This article draws on systems views of creativity and their application in music education, to argue that young children's independent invented song making evolves from their early musico-communicative interaction with others, is evidential of their capacity for "elaboration," and is foundational in the development of creative thought and activity…

  16. Problemstillingar rundt framføring av transkribert musikk - Ei analyse av Bach/Busoni: Chaconne i d-moll

    OpenAIRE

    Flem, Kato Nogva

    2014-01-01

    Ei samanlikning og analyse av Busoni sin transkripsjon av Bach sin Chaconne frå partita nr. 2 for solofiolin. Partita for Violin No. 2 was written by Johann Sebastian Bach during 1717-1723 and consists of five movements; Allemande, Courante, Sarabande, Gigue and Chaconne. The chaconne is longer than the rest of the piece combined, and is frequently played separately. Yehudi Menuhin calls the Chaconne "the greatest structure for solo violin that exists." (Menuhin, 1997, p. 236) Violinist...

  17. Enhanced A-V nodal conduction (Lown-Ganong-Levine syndrome) by congenitally hypoplastic A-V node.

    Science.gov (United States)

    Ometto, R; Thiene, G; Corrado, D; Vincenzi, M; Rossi, L

    1992-11-01

    The basic anatomical substrate of enhanced A-V nodal conduction, manifesting or not as Lown-Ganong-Levine syndrome, is still a controversial issue. We describe the case of a 34-year-old man who presented episodes of ventricular fibrillation. Electrophysiological studies showed that the AH interval was 55 ms, and increased by only 20 ms at paced cycle lengths of 300 ms; atrial pacing induced atrial fibrillation, with a shortest RR interval of 240 ms. Despite verapamil therapy, this patient died suddenly at home. Histological study disclosed a severe A-V node hypoplasia that was evidently congenital in nature; the rest of the conduction system was normal, and no accessory A-V pathways were present. We suggest that enhanced A-V nodal conduction in this patient was due to the developmental defect in the A-V node; this abnormality caused a loss of specific impulse-delaying function, and thus allowed rapid, unfiltered atrial impulses to reach the lower A-V junction and ventricles.

  18. Invention Development Program Helps Nurture NCI at Frederick Technologies | Poster

    Science.gov (United States)

    The Invention Development Fund (IDF) was piloted by the Technology Transfer Center (TTC) in 2014 to facilitate the commercial development of NCI technologies. The IDF received a second round of funding from the NCI Office of the Director and the Office of Budget and Management to establish the Invention Development Program (IDP) for fiscal year 2016. The IDP is using these funds to help advance a second set of inventions.

  19. Invention Development Program Helps Nurture NCI at Frederick Technologies | Poster

    Science.gov (United States)

    The Invention Development Fund (IDF) was piloted by the Technology Transfer Center (TTC) in 2014 to facilitate the commercial development of NCI technologies. The IDF received a second round of funding from the NCI Office of the Director and the Office of Budget and Management to establish the Invention Development Program (IDP) for fiscal year 2016. The IDP is using these funds to help advance a second set of inventions.

  20. Experiences of membrane technique in flue gas condensate treatment applications; Utvaerdering av erfarenheter av membranteknik foer rening av roekgaskondensat

    Energy Technology Data Exchange (ETDEWEB)

    Goldschmidt, Barbara; Ekdahl, Emma; Hellman, Mats

    2009-07-01

    Investing in a flue gas condensate treatment plant often turns out to be very profitable. The profitability comes from savings in energy and water consumption when treated waste water is recirculated, and also from savings in the NO{sub x} fee as condensate treatment allows for higher ammonia injection rates in the SNCR (NO{sub x} reduction) system. The membrane based technologies for flue gas treatment, which were investigated in this report, have proven to be successful and are operating well. However, they require that the project management is committed and acquaint themselves with the technology to avoid problems during commissioning and operation. In this project, experience with membrane based flue gas condensate treatment at ten different plants was investigated and evaluated. The ten plants are either biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. Membrane based flue gas condensate treatment is used by circa ten Swedish plants (Ultra Filtration membranes and/or Reverse Osmosis membranes, and at some plants also membranes for ammonia and carbon dioxide removal). All plants are biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. In Sweden, no plant firing municipal waste has yet been equipped with membrane based flue gas condensate treatment. These plants usually use precipitation and filtration technologies instead. Also the purpose of the condensation step is primarily to operate as a wet flue gas cleaning step. The heat recovery is of subordinate importance. Typical for these plants is also that they use condensation in several steps. The condensates from the different steps are often treated separately, as they may be of very different qualities. The RO unit is the main equipment in a membrane based water treatment plant. Pre-treatment and post-treatment of the RO water is adjusted to the incoming condensate quality, and to the requirements on the effluent. The

  1. 77 FR 60442 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2012-10-03

    ... . Collaborative Research Opportunity: The Eunice Kennedy Shriver National Institute of Child Health and Human... vaccination for prevention of HIV-1 infections. More specifically, the later invention provides a...

  2. INVENTION, INNOVATION SYSTEMS, AND THE FOURTH INDUSTRIAL REVOLUTION

    National Research Council Canada - National Science Library

    Arthur Daemmrich

    2017-01-01

    This article reviews the interplay of major inventions and changes to innovation systems during three historical industrial revolutions as the basis for understanding whether a new revolutionary era...

  3. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  4. The electronics revolution inventing the future

    CERN Document Server

    Williams, J B

    2017-01-01

    This book is about how electronics, computing, and telecommunications have profoundly changed our lives – the way we work, live, and play. It covers a myriad of topics from the invention of the fundamental devices, and integrated circuits, through radio and television, to computers, mobile telephones and GPS. Today our lives are ruled by electronics as they control the home and computers dominate the workspace. We walk around with mobile phones and communicate by email. Electronics didn’t exist until into the twentieth century. The industrial revolution is the term usually applied to the coming of steam, railways and the factory system. In the twentieth century, it is electronics that has changed the way we gather our information, entertain ourselves, communicate and work. This book demonstrates that this is, in fact, another revolution. .

  5. Consciousness and the Invention of Morel

    Science.gov (United States)

    Perogamvros, Lampros

    2013-01-01

    A scientific study of consciousness should take into consideration both objective and subjective measures of conscious experiences. To this date, very few studies have tried to integrate third-person data, or data about the neurophysiological correlates of conscious states, with first-person data, or data about subjective experience. Inspired by Morel's invention (Casares, 1940), a literary machine capable of reproducing sensory-dependent external reality, this article suggests that combination of virtual reality techniques and brain reading technologies, that is, decoding of conscious states by brain activity alone, can offer this integration. It is also proposed that the multimodal, simulating, and integrative capacities of the dreaming brain render it an “endogenous” Morel's machine, which can potentially be used in studying consciousness, but not always in a reliable way. Both the literary machine and dreaming could contribute to a better understanding of conscious states. PMID:23467765

  6. The invention of the athletic body

    Directory of Open Access Journals (Sweden)

    Hortensia Moreno

    2013-01-01

    Full Text Available Based on two mythic figures − one belonging to classic Greece (the “Glowing Body”, and another to primitive Christianity (the “Heavenly Body” − I reflect on the symbolic logic of exclusion as enacted in four moments in the history of the Olympic Games. The first has to do with the invention of amateurism in the sporting philosophy of Coubertin, or the class exclusion. The second refers to the Anthropology Days held at the 1904 Olympic Games in Saint Louis (Missouri, or the ethnic/racial exclusion. The third is the Berlin Parade of Nations in 1936, or the national supremacy. The fourth explores the introduction of gender verification in Mexico City (1968, or the gender exclusion. In this fashion, we re-connect the imagined/imaginary configuration of the body with practices and politics which will result in an anthropological rationalization of discrimination.

  7. [The invention and evolution of the stethoscope].

    Science.gov (United States)

    Hong, Cheng; Wang, Wei; Zhong, Nan-Shan; Liu, Yuan-Ming

    2010-11-01

    There is a record of direct auscultation in the Hippocratic Corpus and this auscultation method has been used for more than 2000 years. In 1816, the first monaural stethoscope was invented by a French physician Dr. Rene Laennec, who also wrote books introducing how to use the stethoscope and auscultation. This instrument has been improved by several doctors and in 1851,the one improved by George Cammann, an American doctor, was the model of today's stethoscope. The electrical stethoscope was produced by the 3M(TM) Littmann Company in 1999, after which the audio files could be saved. In 2000, the vibration response imaging system was introduced into medicine. In 2006, a noise-free active stethoscope was displayed in the Acoustics Conference held in Honolulu, USA. This kind of stethoscope could be used in noisy or bumpy circumstances. These new pieces of equipment made the stethoscope's application field even broader.

  8. Physical tools for textile creativity and invention

    DEFF Research Database (Denmark)

    Heimdal, Elisabeth Jacobsen; Lenau, Torben Anker

    2010-01-01

    Two textile research projects (one completed and one ongoing) are described, where physical inspirational tools are developed and tested with the aim of stimulating textile creativity and invention, i.e. the use of textile materials in new kinds of products, thus bringing textiles into new contexts....... The first research project (completed) concerns how textile designers use new responsive materials and technologies, whereas the second (ongoing) concerns how architects and design engineers can use textile materials. In both projects, the developed inspirational tool is tested through workshops...... with the mentioned stakeholders. In these workshops, new ways of disseminating the results from research in textiles and textile design are experimented with. The submitted contribution therefore mainly addresses the role of interdisciplinarity in textile design research as well as the impact of new materials...

  9. The Democratic Invention. A Reading of Lefort.

    Directory of Open Access Journals (Sweden)

    Matías Sirczuk

    2014-12-01

    Full Text Available In this paper I will present the way in which Lefort interprets modern democracy as a new form of society in regard to the sources of law and legitimacy. Lefort is a thinker who is difficult to place within the context of contemporary political theory: he not only defends democracy against Marxism but also thinks that this form of society cannot be circumscribed within the limits of the modern state, nor be understood through the categories that the tradition of political philosophy has developed to distinguish between political regimes. Lefort combines the defense of democracy with a radical critique of the established order. He identifies the democratic invention with the institution of a dynamic that makes, by right, the radical questioning of law the source of political legitimacy.

  10. Consciousness and the Invention of Morel

    Directory of Open Access Journals (Sweden)

    Lampros ePerogamvros

    2013-03-01

    Full Text Available A scientific study of consciousness should take into consideration both objective and subjective measures of conscious experiences. To this date, very few studies have tried to integrate third-person data, or data about the neurophysiological correlates of conscious states, with first-person data, or data about subjective experience. Inspired by Morel’s invention (Casares, 1940, a literary machine capable of reproducing sensory-dependent external reality, this article suggests that combination of virtual reality techniques and brain reading technologies, that is, decoding of conscious states by brain activity alone, can offer this integration. It is also proposed that the multimodal, simulating and integrative capacities of the dreaming brain render it an 'endogenous' Morel's machine, which can potentially be used in studying consciousness, but not always in a reliable way. Both the literary machine and dreaming could contribute to a better understanding of conscious states.

  11. 快速 AVS 帧内预测算法%FAST AVS INTRA PREDICTION ALGORITHM

    Institute of Scientific and Technical Information of China (English)

    王双龙

    2015-01-01

    As to the complexity process of choosing best probable encoding mode in AVS intra prediction,we proposed a fast intra predic-tion encoding algorithm.With the analysis of AVS intra prediction encoding theory and its implementation in reference software GDM2.1,we derived the threshold of zero coefficient block determination.The fast algorithm determines whether or not the current block is a zero coeffi-cient block according to its threshold discriminant condition.For zero coefficient block,it encodes cbp element directly and terminates intra prediction encoding in advance,which avoids the consequent complex process.As for the non-zero coefficient blocks,the fast selection algo-rithm associating the time domain SAD and the frequency domain SATD is used,which excludes 40% to 80% impossible prediction modes, and the rate distortion function is applied to the remained prediction modes to select the best prediction mode.It was verified through experi-ment that when PSNR (peak signal-to-noise ratio)decreased within 0.25db and bits rate increased within 2%,the time of AVS encoding de-creased over 40%,and the encoding efficiency was largely improved as well.%针对 AVS(Audio Video code Standard)帧内预测中选择最优编码模式流程复杂的问题,提出一种快速帧内预测编码的算法。通过分析 AVS 帧内预测编码的原理及其在参考软件 GDM2.1中的代码实现,推导出判定零系数块的阈值。该快速算法根据零系数块的判定阈值条件判定当前块,对于零系数块,直接编码 cbp 元素,提前中止帧内预测编码,避免了后续的复杂流程;对于非零系数块,采用时域 SAD(Sum of Absolute Difference)与频域 SATD(Sum of Absolute Transformed Difference)相联合的快速选择算法,排除了40%~80%的不可能预测模式,对余下的模式采用率失真代价函数的方法选取最佳预测模式。经实验验证,在 PSNR(Peak Sig-nal to Noise Ratio)降低0

  12. Ethical limitations in patenting biotechnological inventions.

    Science.gov (United States)

    Lugagnani, V

    1999-01-01

    In order to connect ethical considerations with practical limits to patentability, the moral judgement should possibly move from the exploitation of the invention to the nature and/or objectives of Research and Development (R&D) projects which have produced it: in other words, it appears quite reasonable and logical that Society is not rewarding unethical R&D activities by granting intellectual property rights. As far as biotechnology R&D is concerned, ethical guidance can be derived from the 1996 Council of EuropeOs OConvention for the protection of human rights and dignity of the human being with regard to the application of biology and medicineO, whose Chapter V - Scientific research - provides guidelines on: i. protection of persons undergoing research (e.g. informed consent); ii. protection of persons not able to consent to research; iii. research on embryos in vitro. As far as the specific point of patenting biotechnology inventions is concerned, the four exclusions prescribed by Directive 98/44/EC (i.e. human cloning, human germ-line gene therapy, use of human embryos for commercial purposes, unjustified animal suffering for medical purposes) are all we have in Europe in terms of ethical guidance to patentability. In Italy, in particular, we certainly need far more comprehensive legislation, expressing SocietyOs demand to provide ethical control of modern biotechnology. However it is quite difficult to claim that ethical concerns are being raised by currently awarded biotechnology patents related to living organisms and material thereof; they largely deal with the results of genomic R&D, purposely and usefully oriented toward improving health-care and agri-food processes, products and services. ONo patents on lifeOO can be an appealing slogan of militants against modern biotechnology, but it is far too much of an over-simplified abstraction to become the Eleventh Commandment our Society.

  13. 50 Years of ``Scaling'' Jack Kilby's Invention

    Science.gov (United States)

    Doering, Robert

    2008-03-01

    This year is the 50th anniversary of Jack Kilby's 1958 invention of the integrated circuit (IC), for which he won the 2000 Nobel Prize in Physics. Since that invention in a laboratory at Texas Instruments, IC components have been continuously miniaturized, which has resulted in exponential improvement trends in their performance, energy efficiency, and cost per function. These improvements have created a semiconductor industry that has grown to over 250B in annual sales. The process of reducing integrated-circuit component size and associated parameters in a coordinated fashion is traditionally called ``feature-size scaling.'' Kilby's original circuit had active (transistor) and passive (resistor, capacitor) components with dimensions of a few millimeters. Today, the minimum feature sizes on integrated circuits are less than 30 nanometers for patterned line widths and down to about one nanometer for film thicknesses. Thus, we have achieved about five orders of magnitude in linear-dimension scaling over the past fifty years, which has resulted in about ten orders of magnitude increase in the density of IC components, a representation of ``Moore's Law.'' As IC features are approaching atomic dimensions, increasing emphasis is now being given to the parallel effort of further diversifying the types of components in integrated circuits. This is called ``functional scaling'' and ``more then Moore.'' Of course, the enablers for both types of scaling have been developed at many laboratories around the world. This talk will review a few of the highlights in scaling and its applications from R&D projects at Texas Instruments.

  14. Kortisonskepsis : En studie om holdninger til kortisonkrem blant foreldre av barn med atopisk eksem

    OpenAIRE

    Gustavsen, Hanne Engstrøm

    2010-01-01

    Bakgrunn: Kortisonkremer er en viktig del av behandlingen mot atopisk eksem. Mange foreldre er skeptiske til bruken av kortisonkremer, fordi de har lest eller hørt om bivirkninger. Pasienters og pårørendes holdninger til bruk av kortisonkrem kan påvirke gjennomføringen av behandlingen. Formål: Vi ønsket å undersøke holdninger til bruk av kortisonkrem blant foreldre og pårørende av barn med atopisk eksem. Vi ville også undersøke om det er en sammenheng mellom kunnskapsnivå om kortisonkreme...

  15. Utviklingen av Noark-standarden 1984 – 2008

    Directory of Open Access Journals (Sweden)

    Trond Sirevåg

    2014-11-01

    Full Text Available Artikkelen behandler utviklingen av Noark – standarden for elektronisk arkivdanning i norsk offentlig forvaltning – fra versjon 1 (1984 til versjon 5 (2008. Den beskriver omstendighetene som medførte at standarden ble til i 1984, og søker å forklare hvorfor og hvordan det lyktes å utbre standarden slik at Noark-systemer ble enerådende i offentlig forvaltning i løpet av 1990-årene. Riksarkivarens strategier i Noark-utviklingen behandles, – de som fra først av fikk Riksarkivaren til å engasjere seg i standardiseringsarbeidet, de som deretter fikk Riksarkivaren til å overta forvalteransvaret for Noark, og de som senere er endret eller justert som resultat av erfaringer med Noark-baserte systemer og av nyåpnede teknologiske muligheter. Særlig vekt legges på å belyse Riksarkivarens motiver for å overta ansvaret for Noark-standarden fra 1990. Noark plasseres også i det internasjonale bildet, og sammenholdes med andre standarder som ISO 15489 og EU-standarden MoReq. Da Noark-utviklingen startet i 1984, pågikk tilsvarende utviklingsprosjekter både i Danmark og i Sverige. Artikkelen søker forklaringer på at en journal- og sakarkivstandard bare ble en realitet i Norge.

  16. Cloning and characterization of trichome-specific promoter of cpr71av1 gene involved in artemisinin biosynthesis in Artemisia annua L.

    Science.gov (United States)

    Wang, Yueyue; Yang, Ke; Jing, Fuyuan; Li, Meiya; Deng, Ting; Huang, Runze; Wang, Boshi; Wang, Guofeng; Sun, Xiaofen; Tang, Ke-Xuan

    2011-01-01

    Artemisinin, a sesquiterpene lactone endoperoxide derived from Artemisia annua L. (Asteraceae), is the most effective antimalarial drug. We used two methods: genome walking and thermal asymmetric interlaced polymerase chain reaction, to isolate the unknown 5'-flanking sequence of the cyp71av1 gene. The subsequent sequence analysis using bioinformatics software revealed that there are several cis-acting elements inside the cyp71av1 promoter. The 5'-rapid amplification of the cDNA ends method was used to determine the transcription start site of the cyp71av1 gene. We then mapped it at the 18 base upstream of the ATG initiation codon. For simple functional characterization, we built fusion vectors between the 5'-deletion promoter and the gas reporter gene. The expression levels of the transferred vectors into A. annua L. were analyzed by the transient expression way. The beta-glucuronidase assay results indicated that deletion of the region to -1551 bp did not lead to much damage in the GUS activity, whereas further deletion, to -1155 bp, resulted in a 5.5-fold reduction of GUS activity. In stabilized transgenic A. annua L. seedlings we observed that GUS expression was restricted to trichomes, which means that the promoter of the cyp71av1 gene is trichome-specific. Compared with the constitutive CaMV 35S promoter, which can express genes throughout the plant, influence on the trichome system through the trichome-specific expression promoter merely imperils plant growth. In addition, the promoter of the cyp71av1 gene contains several binding sites for transcription factors, which implies that the cyp71av1 promoter responds to more than one form of stimulation.

  17. Distant Recombination and the Creation of Basic Inventions

    DEFF Research Database (Denmark)

    Barirani, Ahmad; Beaudry, Catherine; Agard, Bruno

    2015-01-01

    This article explores whether the relationship between the breath of technological integration (recombination distance) and the breath of an invention׳s subsequent application (basicness) is moderated by the sector of activity (private or public), science-linkage strength and industry characteris...

  18. The Employee Invention Report (EIR) | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    After making a unique, non-obvious, and useful discovery, NIH researchers must immediately contact their Laboratory or Branch Chief and inform him or her of a possible invention, and then consult with your NCI TTC Technology Transfer Manager about submitting an Employee Invention Report (EIR) Form. | [google6f4cd5334ac394ab.html

  19. Using Invention to Change How Students Tackle Problems

    Science.gov (United States)

    Taylor, Jared L.; Smith, Karen M.; van Stolk, Adrian P.; Spiegelman, George B.

    2010-01-01

    Invention activities challenge students to tackle problems that superficially appear unrelated to the course material but illustrate underlying fundamental concepts that are fundamental to material that will be presented. During our invention activities in a first-year biology class, students were presented with problems that are parallel to those…

  20. 37 CFR 41.206 - Common interests in the invention.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Common interests in the invention. 41.206 Section 41.206 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... Interferences § 41.206 Common interests in the invention. An administrative patent judge may decline to declare...

  1. 42 CFR 59.210 - Inventions or discoveries.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Inventions or discoveries. 59.210 Section 59.210... PLANNING SERVICES Grants for Family Planning Service Training § 59.210 Inventions or discoveries. Any grant.... Appropriate measures shall be taken by the grantee and by the Secretary to assure that no contracts...

  2. 42 CFR 61.20 - Inventions or discoveries.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Inventions or discoveries. 61.20 Section 61.20..., TRAINING FELLOWSHIPS Regular Fellowships § 61.20 Inventions or discoveries. Any fellowship award made... measures shall be taken by the fellow, the sponsoring institution, and the Surgeon General to assure that...

  3. 50 CFR 401.21 - Patents and inventions.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Patents and inventions. 401.21 Section 401... CONSERVATION, DEVELOPMENT AND ENHANCEMENT § 401.21 Patents and inventions. Determination of the patent rights... to the Act shall be consistent with the “Government Patent Policy” (President's memorandum for...

  4. 77 FR 32642 - Patents and Inventions; Delegation of Authority

    Science.gov (United States)

    2012-06-01

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention Patents and Inventions; Delegation of... and patent program of CDC and the authority to make determinations of rights in inventions and...

  5. 75 FR 21634 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-04-26

    ... Thereof in Super Resolution Microscopy Description of Invention: The technology offered for licensing and for further development is in the field of fluorescence microscopy. More specifically, the invention describes and claims the composite probes for super resolution optical techniques using super resolution...

  6. Using Invention to Change How Students Tackle Problems

    Science.gov (United States)

    Taylor, Jared L.; Smith, Karen M.; van Stolk, Adrian P.; Spiegelman, George B.

    2010-01-01

    Invention activities challenge students to tackle problems that superficially appear unrelated to the course material but illustrate underlying fundamental concepts that are fundamental to material that will be presented. During our invention activities in a first-year biology class, students were presented with problems that are parallel to those…

  7. From inventivity in Limerick to creativity in Aveiro: lessons learnt

    CSIR Research Space (South Africa)

    Wong, W

    2009-01-01

    Full Text Available around four key questions: nature vs. nurture: can creative invention be taught; what tools and methods are there to help students learn to develop creative solutions; how to train educators in creative invention; and what are the stumbling blocks...

  8. Fight plant pests using RNA interference

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ CAS plant physiologists have recently invented a plant-mediated RNA interference (RNAi) technique to effectively and specifically control the gene expression of the cotton bollworm (Helicoverpa armigera) and stunt its growth.

  9. THE VALUE AND ECONOMIC EFFECTS OF UNAPPLIED INVENTIONS

    Directory of Open Access Journals (Sweden)

    Raul Sorin V. FÂNTÂNĂ

    2014-06-01

    Full Text Available The accounting regulations, the guidelines for their application and other articles by accounting specialists argue that inventions created internally are not recognized as intangible assets. Only assets acquired separately can be measured reliably, based on the document justifying the purchase transaction. Other specialised papers show that it is difficult to establish the existence of this intangible asset and its credible cost. That is, it can give or calculate a value of the invention only if it can show the acceptable cost of achieving it. But all these works argue that the protection of inventions is profitable if it is the basis of a new business, if it promotes or protects the current activity. However, these papers elude - because it is uncomfortable - the situation where an invention created internally has a value only because it forecloses the market. It is curious that an invention has accounting value only when traded.

  10. Kartläggning av byggprocessen hos Peab med hjälp av SCOR

    OpenAIRE

    Johansson, Robin

    2012-01-01

    Detta är ett examensarbete utfört på Institutionen för teknik och naturvetenskap (ITN) i Norrköping som är en del av Linköpings Universitet i samarbete med Peab som intressent. Historiskt sett har byggbranschens intresse för logistik varit svalt vilket har lett till att logistiken inom denna bransch har halkat efter i förhållande till övriga branscher. Syftet med detta examensarbete är att utifrån ett logistiskt synsätt tillhandahålla anpassningsförslag till SCOR-processerna ”Make” och ”Retur...

  11. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  12. Solmoduler på balkongfronter : Renovering av flerbostadshus i miljonprogrammet

    OpenAIRE

    Persson, Maria

    2015-01-01

    Under det senaste seklet har en intensiv energianvändning orsakat stora utsläpp av koldioxid och andra växthusgaser i atmosfären med negativa miljöeffekter som följd. Den alltjämt ökade efterfrågan på elektricitet runtom i världen måste mötas av förnybara energikällor i kombination med energieffektiviseringar för att inte riskera ytterligare miljöförstöring. I Sverige är bostads- och servicesektorn en intensiv energianvändare och några av de byggnader som förbrukar mest energi finns i miljonp...

  13. En kartläggning av stereoskopisk 3D

    OpenAIRE

    Holmström, Benny

    2011-01-01

    Det här lärdomsprovet är en genomgång av ett av den moderna tidens största modeord: stereoskopisk 3D och syskontermen autostereoskopisk 3D. Kort sagt de tekniker som går ut på att leverera en bild till vardera av människans två ögon och därmed simulera djup i tvådimensionella bilder. Det här kan göras på en mängd olika sätt, och i detta examensarbete går jag igenom de vanligaste teknikerna och förklarar dem kortfattat, en och en. Utöver tekniken analyserar jag även dagens marknad, teknikernas...

  14. 37 CFR 1.475 - Unity of invention before the International Searching Authority, the International Preliminary...

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Unity of invention before the... Invention § 1.475 Unity of invention before the International Searching Authority, the International... application shall relate to one invention only or to a group of inventions so linked as to form a single...

  15. Brachial artery aneurysms following brachio-cephalic AV fistula ligation.

    Science.gov (United States)

    Khalid, Usman; Parkinson, Frances; Mohiuddin, Kamran; Davies, Paula; Woolgar, Justin

    2014-01-01

    Peripheral artery aneurysms proximal to a long-standing arteriovenous (AV) fistula can be a serious complication. It is important to be aware of this and manage it appropriately. Vascular access nurses input all data regarding patients undergoing dialysis access procedures into a securely held database prospectively. This was retrospectively reviewed to identify cases of brachial artery aneurysms over the last 3 years. In Morriston Hospital, around 200 forearm and arm AV fistulas are performed annually for vascular access in renal dialysis patients. Of these, approximately 15 (7.5%) are ligated. Three patients who had developed brachial artery aneurysms following AV fistula ligation were identified. All 3 patients had developed brachial artery aneurysms following ligation of a long-standing brachio-cephalic AV fistula. Two patients presented with pain and a pulsatile mass in the arm, and one presented with pins and needles and discoloration of fingertips. Two were managed with resection of the aneurysm and reconstruction with a reversed long saphenous vein interposition graft, the third simply required ligation of a feeding arterial branch. True aneurysm formation proximal to an AV fistula that has been ligated is a rare complication. There are several reasons for why these aneurysms develop in such patients, the most plausible one being the increase in blood flow and resistance following ligation of the AV fistula. Of note, all the patients in this study were on immunosuppressive therapy following successful renal transplantation. Vigilance by the vascular access team and nephrologists is paramount to identify those patients who may warrant further evaluation and investigation by the vascular surgeon.

  16. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  17. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_3_ORF2 E26799A422BE33BE PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) NA ? IPR015500 unintegrated ...

  18. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  19. Inventions on baker's yeast strains and specialty ingredients.

    Science.gov (United States)

    Gélinas, Pierre

    2009-06-01

    Baker's yeast is one of the oldest food microbial starters. Between 1927 and 2008, 165 inventions on more than 337 baker's yeast strains were patented. The first generation of patented yeast strains claimed improved biomass yield at the yeast plant, higher gassing power in dough or better survival to drying to prepare active dry baker's yeast. Especially between 1980 and 1995, a major interest was given to strains for multiple bakery applications such as dough with variable sugar content and stored at refrigeration (cold) or freezing temperatures. During the same period, genetically engineered yeast strains became very popular but did not find applications in the baking industry. Since year 2000, patented baker's yeast strains claimed aroma, anti-moulding or nutritive properties to better meet the needs of the baking industry. In addition to patents on yeast strains, 47 patents were issued on baker's yeast specialty ingredients for niche markets. This review shows that patents on baker's yeast with improved characteristics such as aromatic or nutritive properties have regularly been issued since the 1920's. Overall, it also confirms recent interest for a very wide range of tailored-made yeast-based ingredients for bakery applications.

  20. Carrier system for a plant extract or bioactive compound from a plant

    DEFF Research Database (Denmark)

    2016-01-01

    This invention relates to a carrier system for use in producing a beverage with a metered amount of plant extract or bioactive compound.......This invention relates to a carrier system for use in producing a beverage with a metered amount of plant extract or bioactive compound....

  1. Modellering og dimensjonering av kaianlegg etter Eurokode 2

    OpenAIRE

    Lilleaker, Tore; Tvervåg, Henrik

    2010-01-01

    Dette er sluttrapporten for masteroppgaven på en kaikonstruksjon utført ved NTNU, institutt for konstruksjonsteknikk. Det er i oppgaven gjennomført en prosjektering og dimensjonering av en betongkai etter NS-EN 1992-1-1. Det er også gjennomført et litteraturstudie med en tilhørende teoridel om bestandighet for betongkonstruksjoner i et marint miljø, samt at det er gjennomført en sannsynlighetsbasert bestandighetsanalyse av denne konstruksjonen. Avslutningsvis er det drøftet litt rundt teori, ...

  2. EST Table: AV403981 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available terminase large subunit (DNA packaging protein A) from bacteriophage origin [Escherichia coli UMN026] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403981 pg-- ... ...AV403981 pg--0297 11/12/09 n.h 10/09/28 100 %/265 aa ref|YP_002411376.1| terminase large subunit (DNA packag...ing protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1|

  3. Modellering av nedslagsfeltet- Veumdalen i Fredrikstad med programmet SWMM

    OpenAIRE

    2015-01-01

    Fredrikstad kommune har hatt store prosjekter pågang i de siste årene i forbindelse med opprustning av ledningsnettet. Oppfylte kjellere har vært en viktig tema for kommunen, og de har en intensjon om å redusere faren for oversvømmelser i utsatte steder. En av de utsatte stedene i Fredrikstad er Veumdalen som har problemer med oversvømmelser nesten hvert år. Som en forebyggende tiltak har kommunen i samarbeid med COWI bygget en tunnel fra Veumveien/Veumbekken til Seutelva. Det ...

  4. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  5. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  6. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  7. EST Table: AV399757 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399757 NV120719 11/12/09 n.h 10/09/28 83 %/234 aa ref|NP_047435.1| AcMNPV orf30 [...Bombyx mori NPV] gb|AAC63704.1| AcMNPV orf30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399757 NV12 ...

  8. Prosjektering og analyse av Nordøyvegen bru 3

    OpenAIRE

    Lauknes, Andreas; Arild, Audun

    2016-01-01

    Rapporten tar for seg prosjektering av en etteroppspent betongbru, der beregninger og dimensjoneringen er i henhold til det Europeiske regelverket, nasjonale tillegg og Håndbøker fra Statens vegvesen. Brua som skal dimensjoneres og bli gjort kapasitetskontroll for er Nordøyvegen bru 3, som skal bygges som en del av et større fastlandsprosjekt for nordøyene i Haram kommune. Brua skal bygges som en bjelke-/platebru, og konstruksjonsmetoden er fritt frambygg med totalt syv byggefaser. Den består...

  9. Fysisk aktivitet inom rehabiliteringen av anorexi : - En systematisk litteraturstudie

    OpenAIRE

    Högnäs, Maria

    2011-01-01

    Studiens syfte var att undersöka hur fysisk aktivitet påverkar unga flickor (12-24 år) med anorexi, i samband med rehabilitering. Skribenten vill dessutom ytterligare få specificerat vilken typ av fysisk aktivitet som kan vara lämplig för denna målgrupp. Frågeställningarna besvaras genom en systematisk litteraturstudie. Genom databassökning och frisökning hittades 14 relevanta artiklar som genomgick en kvalitetsgranskning, enligt en modifierad metod för kvalitetsgranskning av Forsberg & Wengs...

  10. Inventions Utilizing Microfluidics and Colloidal Particles

    Science.gov (United States)

    Marr, David W.; Gong, Tieying; Oakey, John; Terray, Alexander V.; Wu, David T.

    2009-01-01

    Several related inventions pertain to families of devices that utilize microfluidics and/or colloidal particles to obtain useful physical effects. The families of devices can be summarized as follows: (1) Microfluidic pumps and/or valves wherein colloidal-size particles driven by electrical, magnetic, or optical fields serve as the principal moving parts that propel and/or direct the affected flows. (2) Devices that are similar to the aforementioned pumps and/or valves except that they are used to manipulate light instead of fluids. The colloidal particles in these devices are substantially constrained to move in a plane and are driven to spatially order them into arrays that function, variously, as waveguides, filters, or switches for optical signals. (3) Devices wherein the ultra-laminar nature of microfluidic flows is exploited to effect separation, sorting, or filtering of colloidal particles or biological cells in suspension. (4) Devices wherein a combination of confinement and applied electrical and/or optical fields forces the colloidal particles to become arranged into three-dimensional crystal lattices. Control of the colloidal crystalline structures could be exploited to control diffraction of light. (5) Microfluidic devices, incorporating fluid waveguides, wherein switching of flows among different paths would be accompanied by switching of optical signals.

  11. The practical Einstein experiments, patents, inventions

    CERN Document Server

    Illy, József

    2012-01-01

    Albert Einstein may be best known as the wire-haired whacky physicist who gave us the theory of relativity, but that's just one facet of this genius' contribution to human knowledge and modern science. As Jozsef Illy expertly shows in this book, Einstein had an eminently practical side as well. As a youth, Einstein was an inveterate tinkerer in the electrical supply factory his father and uncle owned and operated. His first paid job was as a patent examiner. Later in life, Einstein contributed to many inventions, including refrigerators, microphones, and instruments for aviation. In published papers, Einstein often provided ways to test his theories and fundamental problems of the scientific community of his times. He delved deeply into a variety of technological innovations, most notably the gyrocompass, and consulted for industry in patent cases and on other legal matters. Einstein also provided explanations for common and mundane phenomena, such as the meandering of rivers. In these and other hands-on exam...

  12. Why Is Hard To Patent An Invention?

    Directory of Open Access Journals (Sweden)

    2007-01-01

    Full Text Available When employed by a company, in almost all the cases a new employee has to sign an agreement giving the company exclusive rights to any intellectual property developed as part of their work assignments. This agreement could extend beyond a change of jobs and cause conflict of interests in new employment situations. A patent is a government-granted monopoly given to an inventor as both a reward for the intellectual and financial investment, and a stimulus to innovate. As a monopoly, the patent has legal power to exclude others from exploiting the invention in any way for a period of 20 years from the time the patent application has been filed. A trademark provides instant recognition of a product or company; a service mark provides instant recognition of a service. They both have unlimited lifetime. But the owner must renew or confirm continuous use at the end of five years, and every 10 years thereafter. A trade secret is information keep secret by the owner to give him advantage over competitors. Since it is secret, a trade secret protection has unlimited lifetime.

  13. CERN at the International Inventions Fair

    CERN Document Server

    2007-01-01

    CERN is the guest of honour at the 35th International Inventions Fair, which will take place from 18th to 22nd April at Palexpo, in Geneva. CERN has been chosen as the guest of honour for its ability to develop new technologies and translate them for the benefit of society. For the Fair, CERN has teamed up with ten companies that have made use of technologies and ideas from the Laboratory. The CERN stand at the exhibition will be dedicated to a presentation of the Laboratory and the LHC. Each of the technologies featured will be highlighted on the stand, along with the companies that have put them into more general use. This will allow visitors to trace the path from basic research to practical application from start to finish. One example is Medipix, a particle detection technology that has found applications in medical imaging. Visitors to the Fair will be able to see a Medipix detector in action on the CERN stand, and use it to view the particles emitted by everyday objects.

  14. Norsk passivhusstandard og Passivhauskonzept: en sammenlignende analyse av krav og kriterier

    DEFF Research Database (Denmark)

    Anton, Karin; Vestergaard, Inge

    kriterier som omfattes av passivhuskonseptet med tilhørende sertifisering og kriterier i Norsk Standard 3701. Gjennom analysen ønsker vi å systematisere og sammenlikne de forskjellige kriteriene i standarden: optimalisering, kuldebroer, lufttetthet og trykktesting, utnyttelse av passiv solenergi, bruk av...

  15. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...

  16. Invention as a combinatorial process: evidence from US patents.

    Science.gov (United States)

    Youn, Hyejin; Strumsky, Deborah; Bettencourt, Luis M A; Lobo, José

    2015-05-06

    Invention has been commonly conceptualized as a search over a space of combinatorial possibilities. Despite the existence of a rich literature, spanning a variety of disciplines, elaborating on the recombinant nature of invention, we lack a formal and quantitative characterization of the combinatorial process underpinning inventive activity. Here, we use US patent records dating from 1790 to 2010 to formally characterize invention as a combinatorial process. To do this, we treat patented inventions as carriers of technologies and avail ourselves of the elaborate system of technology codes used by the United States Patent and Trademark Office to classify the technologies responsible for an invention's novelty. We find that the combinatorial inventive process exhibits an invariant rate of 'exploitation' (refinements of existing combinations of technologies) and 'exploration' (the development of new technological combinations). This combinatorial dynamic contrasts sharply with the creation of new technological capabilities-the building blocks to be combined-that has significantly slowed down. We also find that, notwithstanding the very reduced rate at which new technologies are introduced, the generation of novel technological combinations engenders a practically infinite space of technological configurations.

  17. Commercial progress and impacts of inventions and innovations

    Energy Technology Data Exchange (ETDEWEB)

    Perlack, R.D.; Rizy, C.G.; Franchuk, C.A.; Cohn, S.M.

    1999-08-01

    This report presents the survey results from the 1997 inventions and innovations evaluation questionnaire. The evaluation impacts are based on responses from 136 out of 334 inventors sent the questionnaire. In 1996, there were 67 inventions identified that currently have direct, licensed, or spinoff sales. In total, the number of inventions and innovations with current sales and past sales (now retired from the market) is 144. This represents a commercial success rate of over 27%. For these grant-receiving inventions, the following performance metrics are of interest: (1) total cumulative direct and licensed sales through 1996 were $700 million (1995$), in addition, cumulative spinoff sales and royalties were $90 million and $20 million (1995$) through 1996, respectively; (2) employment sustained by direct and licensed sales was 1,189 full-time equivalents in 1996, employment attributable to technologies with no sales was 90 full-time equivalents, and the annual federal income taxes collected as a result of this employment was in excess of $6 million; and (3) energy savings attribute to supported inventions and innovations were estimated at 78 trillion Btu in 1996 with an estimated value of nearly $190 million (1995$), the associated reduction in carbon emissions was over 1.5 million metric tons. In terms of future commercialization progress and impacts, the 1997 survey revealed that 60% of the respondents are actively pursuing their invention, and nearly 50% of the inventions are in the prototype development, pre-production prototype testing, and pre-production development stages.

  18. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  19. 7 CFR 1209.75 - Patents, copyrights, inventions, publications, and product formulations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, publications, and..., Research, and Consumer Information Order Miscellaneous § 1209.75 Patents, copyrights, inventions, publications, and product formulations. Any patents, copyrights, inventions, publications, or...

  20. 7 CFR 1215.75 - Patents, copyrights, inventions, publications, and product formulations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, publications, and..., and Consumer Information Order Miscellaneous § 1215.75 Patents, copyrights, inventions, publications, and product formulations. Any patents, copyrights, inventions, publications, or product...

  1. Must an inventor "possess" an invention to patent it?

    Science.gov (United States)

    Woessner, Warren D; Chadwick, Robin A

    2014-09-18

    The requirements for patenting inventions relating to biotechnology have become increasingly strict and complicated in recent years. Despite early patent rulings that there is no need for an inventor to "reduce to practice" an invention, the courts are now ruling that an inventor must "possess" his or her invention before filing for patent. This review discusses what such "possession" may mean and describes decisions in which courts have found that an inventor has met or failed the possession test before filing for patent protection. Copyright © 2014 Cold Spring Harbor Laboratory Press; all rights reserved.

  2. [Developments and inventions from Germany : Influence on international ophthalmology].

    Science.gov (United States)

    Müller, M; Pavlovic, I; Schmack, I; Ohrloff, C; Kohnen, T

    2017-07-24

    There are various developments and inventions from Germany that have influenced not only the domestic but also the international field of ophthalmology. Beginning with the invention of the ophthalmoscope by Hermann von Helmholtz in 1850, to the establishment of the "Archives of Ophthalmology" medical journal, a publication founded by Albrecht von Graefe in 1854, through to the development of the retinal chip by Eberhart Zrenner and colleagues with the first clinical data collected in 2007. The abovenamed and further developments and the German ophthalmologists behind these inventions are discussed in more detail.

  3. Long-time effects of run-off water from ash recycling to a planted forest. Final report for a partial study in the project 'Forestry measures - effects on carbon-, nutrients and heavy metal flows' financed by the Swedish Energy Agency; Laangtidsverkan paa avrinnande vatten av askaaterfoering till plantskog. Slutrapport foer en delstudie inom det av Energimyndigheten finansierade projektet 'Skogliga aatgaerder - effekter paa kol-, naering och tungmetalIfloeden'

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Torbjoern; Eriksson, Hillevi

    2001-06-01

    The chemical composition of runoff from a wood ash fertilized catchment in central Sweden has been studied during eight years after the treatment. The effects of the ash treatment was compared with a 12 year long reference period and a reference catchment close to the ash treated area was earlier (winter 1980/81) whole-tree-harvested to 90 %. At the same time the reference area was stemwood harvested on 60 % of the area. Both areas were planted with spruce and pine. Granulated ash was spread on the whole-tree-harvested area, by helicopter, on two occasions (1 ton per hectare in May 1989 and 2 tonnes per hectare in October 1991). During the first ash application a marked peak in K concentration was observed. The second ash application caused a high peak in K concentration. Short-lived peaks was also observed for pH, electric conductivity, ANC, Mg, Na and Cl. Significant increases of pH, electric conductivity, Ca, K and Cl was observed in runoff water from the ash treated area during the 8-year-period after the last ash spreading. However, during the same period concentrations of NH{sub 4}-N, NO{sub 3}-N and total N have shown a relative decrease in runoff water from the ash treated area, compared to the reference area.

  4. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  5. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  6. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  7. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  8. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  9. EST Table: AV405806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405806 wdV30260 10/09/28 65 %/199 aa ref|NP_001119709.1| transformer 2 isoform E ...[Bombyx mori] gb|AAX47003.1| transformer-2 protein E [Bombyx mori] 10/08/28 low homology 10/08/27 low homolo

  10. EST Table: AV400604 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400604 br--1517 10/09/28 48 %/208 aa ref|XP_001863389.1| wolfram syndrome 1 [Cule...x quinquefasciatus] gb|EDS38516.1| wolfram syndrome 1 [Culex quinquefasciatus] 10/08/28 50 %/173 aa FBpp0291

  11. EST Table: AV398407 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398407 NV021774 10/09/28 100 %/186 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...507-PA 10/09/10 48 %/236 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  12. EST Table: AV398495 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398495 NV021874 10/09/28 91 %/209 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 54 %/213 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  13. EST Table: AV401468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401468 e96h0771 10/09/28 87 %/171 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 55 %/166 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 e96h ...

  14. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  15. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  16. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  17. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  18. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  19. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  20. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  1. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  2. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  3. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  4. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  5. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  6. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  7. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  8. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  9. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  10. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  11. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  12. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  13. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  14. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  15. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  16. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  17. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  18. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  19. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  20. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  1. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  2. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  3. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  4. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  5. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  6. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  7. EST Table: AV399507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399507 NV120319 10/09/28 70 %/144 aa ref|YP_803401.1| baculovirus repeated ORF-b [Anticars...ia gemmatalis nucleopolyhedrovirus] gb|ABI13791.1| baculovirus repeated ORF-b [Anticarsia gemmatali

  8. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  9. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  10. EST Table: AV403894 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ref|XP_001605691.1| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/08/28 52...%/206 aa gi|189241712|ref|XP_968082.2| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] AV403894 pg-- ...

  11. Centralized Library Services for Audiovisual Media. AV in Action 4.

    Science.gov (United States)

    Nederlands Bibliotheek en Lektuur Centrum, The Hague (Netherlands).

    Designed to provide assistance to countries in developing centralized services to their libraries for nonbook materials, this pamphlet contains examples from five countries that have succeeded in establishing such services. Those examples include: (1) "The Central Library Service for AV-Materials in Denmark" (Suzanne Hemmeth…

  12. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  13. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  14. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something about...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  15. EST Table: AV398194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398194 NV021231 10/09/28 38 %/170 aa ref|NP_724426.2| vulcan, isoform D [Drosophi...la melanogaster] gb|AAM68355.2| vulcan, isoform D [Drosophila melanogaster] 10/08/28 38 %/170 aa FBpp0289730

  16. EST Table: AV406060 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406060 wdV30561X 10/09/28 99 %/122 aa gb|ACN86367.1| troponin T transcript varian...006588#locus:tnt- 3#status:Partially_confirmed#UniProt:B9WRS6#protein_id:AC M46022.1 10/09/10 81 %/122 aa AG

  17. EST Table: AV405690 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405690 wdV30118 10/09/28 93 %/225 aa ref|NP_001040124.1| exuperantia [Bombyx mori] gb|ABD36117.1| exuperan...9360-PA 10/09/10 53 %/220 aa gi|91085815|ref|XP_974770.1| PREDICTED: similar to exuperantia [Tribolium castaneum] FS919769 wdV3 ...

  18. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  19. EST Table: AV401871 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401871 heS00267 11/12/09 GO hit GO:0046872(metal ion binding) 10/09/28 65 %/194 aa gb|ACR61720.1| triglyce...ride lipase [Manduca sexta] 10/08/28 48 %/206 aa FBpp0147001|DgriGH13095-PA 10/08/2

  20. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  1. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  2. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  3. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  4. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  5. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  6. EST Table: AV405516 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405516 wdV10864 10/09/28 33 %/180 aa ref|XP_969213.1| PREDICTED: similar to artemis...0768|ref|XP_969213.1| PREDICTED: similar to artemis protein [Tribolium castaneum] FS920671 wdV1 ...

  7. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  8. Plant growth promoting rhizobacterium

    Science.gov (United States)

    Doktycz, Mitchel John; Pelletier, Dale A.; Schadt, Christopher Warren; Tuskan, Gerald A.; Weston, David

    2015-08-11

    The present invention is directed to the Pseudomonas fluorescens strain GM30 deposited under ATCC Accession No. PTA-13340, compositions containing the GM30 strain, and methods of using the GM30 strain to enhance plant growth and/or enhance plant resistance to pathogens.

  9. Plant growth promoting rhizobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, Mitchel John; Pelletier, Dale A.; Schadt, Christopher Warren; Tuskan, Gerald A.; Weston, David

    2015-08-11

    The present invention is directed to the Pseudomonas fluorescens strain GM30 deposited under ATCC Accession No. PTA-13340, compositions containing the GM30 strain, and methods of using the GM30 strain to enhance plant growth and/or enhance plant resistance to pathogens.

  10. Forskerskoler som modeller for forskerutdanning: Progresjon og utvikling av ekspertise

    Directory of Open Access Journals (Sweden)

    Sten Ludvigsen

    2013-12-01

    Full Text Available I de senere årene har forskerskoler blitt fremhevet som en mulig løsning på ulike utfordringer innenfor forskerutdanningen. På bakgrunn av erfaringer med to forskerskoler innenfor utdanningsvitenskap, vil vi i denne artikkelen belyse to problemstillinger: Hvordan kan man organisere læringsforløpet til ph.d.-kandidatene slik at det støtter deres progresjon? Og hva må forskerutdanningen inneholde for at ph.d.-kandidatene skal utvikle tilstrekkelig ekspertise innenfor et avgrenset kunnskapsområde?For å skape progresjon, bør utdanningsprogrammet bidra til å gi struktur og angi faglig retning. Videre må utdanningselementene være relevante for avhandlingsarbeidet. I tillegg kan progresjon fremmes gjennom seminarer, der utviklingen av tekster og artikler følges opp. Argumentet om at forskerskoler bør bygge på gode forskningsmiljøer har stått sentralt i utredningen av ulike modeller for forskerutdanning i Norge. Ett aspekt som har fått økende oppmerksomhet er betydningen av å oppnå en tilstrekkelig grad av spesialisering. Uten utvikling av en slik ekspertise, vil ph.d.-kandidatene ikke kunne publisere internasjonalt og delta i forskningsfellesskap.Ved Det utdanningsvitenskapelige fakultet har man de siste 10 årene utviklet flere typer forskerskoler. I denne artikkelen tar vi utgangspunkt i den UiO-finansierte, tematisk avgrensede forskerskolen «Læring, kommunikasjon og IKT» (2004–2008 og den NFR-finansierte nasjonale forskerskolen i utdanningsvitenskap, NATED (2008–2016, hvor ph.d.-kandidatene deltar i faglige aktiviteter organisert i fire spor.Metodene som brukes for å besvare problemstillingene omfatter intervjuer, spørreskjema og refleksjoner vedrørende de to ulike forskerskolene.Resultatene viser at man kan oppnå nødvendig spesialisering, høy kvalitet, høy tilfredshet og høy relevans ved bruk av forskerskoler som virkemiddel i forskerutdanningen. Begge forskerskolene har tilrettelagt for internasjonal

  11. Minimizing ventricular pacing by a novel atrioventricular (AV) delay hysteresis algorithm in patients with intact or compromised intrinsic AV conduction and different atrial and ventricular lead locations.

    Science.gov (United States)

    Pakarinen, Sami; Toivonen, Lauri

    2013-09-01

    To investigate if an advanced AV search hysteresis (AVSH) algorithm, Ventricular Intrinsic Preference (VIP(™)), reduces the incidence of ventricular pacing (VP) in sinus node dysfunction (SND) with both intact and compromised AV conduction and with intermittent AV block regardless of the lead positions in the right atria and the ventricle. Patients were classified as having intact AV (AVi) conduction if the PR interval was ≤ 210 ms on ECG and 1:1 AV conduction during atrial pacing up to 120 bpm with PR interval ≤ 350 ms. Otherwise the AV conduction was classified as compromised (AVc). Both AVi and AVc patients were randomized to VIP ON or OFF. VIP performed an intrinsic AV conduction search every 30 s for three consecutive atrial cycles with the extension of the sensed and paced AV (SAV/PAV) delays from basic values of 150/200 ms to 300/350 ms. Extended AV intervals were allowed for three cycles when VP occurred before returning to basic AV delays. The primary end-point was %VP at 12 months. Among 389 patients, 30.1% had intact and 69.9% had compromised AV conduction. The mean %VP at 12 months was 9.6% by VIP compared to 51.8% with standard AV settings in patients with AVi (P < 0.0001) and 28.0% versus 78.9% (P < 0.0001) with AVc. With VIP, excessive %VP among most used lead positions was not seen. Conversely, when VIP was off %VP was low only in patients who had leads in the RA septal-RV septal position (23.0%). VIP feature reduces VP both in patients with SND and with intermittent heart block regardless of the lead positions in the right atria and the ventricle.

  12. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  13. Fra strømfordeling til pengestrøm? : Statnett fra forvaltningsbedrift til statsforetak : en konsekvensanalyse av omorganiseringen av Statnett seks år etter

    OpenAIRE

    Knudsen, Halvor Gillund

    1998-01-01

    Fra strømfordeling til pengestrøm? Statnett fra forvaltningsbedrift til statsforetak en konsekvensanalyse av omorganiseringen av Statnett seks år etter. Tema for oppgaven er konsekvenser av endrete tilknytningsformer i staten. Temaet er kommet frem gjennom tilknytning til et samarbeidsprosjekt mellom Universitetet i Oslo ved Vitenskapsbutikken og Arbeids- og administrasjonsdepartementet. Årsaken til at man ønsker å se på slike forhold er den stadige kritikken mot en etter sigende alt for...

  14. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  15. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  16. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  17. Forbuden frukt smaker best en studie av nordmenns spise- og drikkemønster av sjokolade, søtsaker, salt snacks, sukkerholdige leskedrikker og lignende

    OpenAIRE

    Bugge, Annechen Bahr

    2010-01-01

    Denne studien er en del av forskningsprosjektene Young Food og HealthMeal. Begge prosjektene er finansiert av Norges forskningsråd. Temaet i rapporten er nordmenns spise- og drikkemønster av en type mat og drikke som helsemyndighetene ønsker at befolkningen skal redusere forbruket sitt av – slik som sjokolade, søtsaker, søte bakervarer, salt snacks og sukkerholdige drikker. Selv om forbruksutviklingen de seneste par årene har vist positive tendenser, har altså nordmenn fremdeles et langt høye...

  18. En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap

    OpenAIRE

    2014-01-01

    Abstrakt Utvecklingsarbetet ”En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap”, är en fortsättning på examensarbetet ”Abort - En systematisk översikt av kvinnornas upplevelser och av vårdpersonalens betydelse” som publicerades och presenterades våren 2013. Syftet med utvecklingsarbetet är att producera en handlingsmodell för hälsovårdspersonalen. Handlingsmodellen kommer att ge råd och tips på hur man som hälsovårdspe...

  19. 75 FR 26258 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-05-11

    ... information. Parvovirus B19 Codon Optimized Structural Proteins for Vaccine and Diagnostic Applications Description of Invention: Parvovirus B19 (B19V) is the only known pathogenic human parvovirus. Infection by...

  20. Determining the Effect of Interactive Invention Instructional Strategy ...

    African Journals Online (AJOL)

    First Lady

    Key Words: Interactive invention, achievement in Physics, Pre-service teachers ... country has been changing from one system of education to another. However, the .... Where the main effects were significant, the multiple classification analysis.

  1. Do We Need to Redefine the Top Four Inventions?

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    China’s traditional top four inventions have taken on a new look. An exhibition recently held at the China Science and Technology Museum in Beijing showed that the old stalwarts of compass, papermak-

  2. Compounds and methods for improving plant performance

    Energy Technology Data Exchange (ETDEWEB)

    Unkefer, Pat J.; Knight, Thomas Joseph

    2016-09-20

    The invention is directed to methods and compositions for increasing a growth characteristic of a plant, increasing nutrient use efficiency of a plant, or improving a plant's ability to overcome stress comprising applying a composition comprising ketosuccinamate, a derivative thereof, or a salt thereof, to the plant or to a propagation material of the plant.

  3. Compounds and methods for improving plant performance

    Science.gov (United States)

    Unkefer, Pat J.; Knight, Thomas Joseph

    2016-09-20

    The invention is directed to methods and compositions for increasing a growth characteristic of a plant, increasing nutrient use efficiency of a plant, or improving a plant's ability to overcome stress comprising applying a composition comprising ketosuccinamate, a derivative thereof, or a salt thereof, to the plant or to a propagation material of the plant.

  4. Cloning and characterization of a novel apolipoprotein gene, apolipoprotein AV, in tree shrews.

    Science.gov (United States)

    Li, Guoping; Luo, Huairong; Sun, Guotao; Wu, Guisheng; Wu, Gang; Wang, Yan; Man, Yong; Wang, Shu; Li, Jian; Chen, Baosheng

    2013-09-01

    Apolipoprotein AV (apoAV) modulates plasma triglyceride levels, which is an independent risk factor for cardiovascular disease. ApoAV is also involved in atherosclerosis lesion formation. In order to systematically evaluate the apolipoprotein-related gene profile in tree shrew, a model for its insusceptibility to atherosclerosis, we performed apoAV cloning and characterization. The full-length cDNA of apoAV was identified using SMART-RACE. ApoAV cDNA sequence revealed two transcripts, 1,948 and 1,397 base pairs, due to alternative polyadenylation. These two transcripts share the same open reading frame (ORF), which encodes a 369-amino acid protein with high identity to human apoAV (75 %), including a 23-amino acid N-terminal signal peptide. ApoAV is expressed exclusively in the liver. Mature apoAV was expressed in E. coli BL21(DE3) and purified by Ni-chelated resin. Lipoprotein lipase activity was significantly stimulated by this recombinant protein. The full-length ORF of apoAV was cloned into pDsRed-monomer-N1 vector with a red fluorescent protein tag and was primarily localized in cytoplasm of hepG2 cells. The successful cloning, expression and localization of apoAV in tree shrew has laid down the foundation for further investigation on its structure and functions.

  5. 42 CFR 86.3 - Inventions and discoveries.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Inventions and discoveries. 86.3 Section 86.3... General § 86.3 Inventions and discoveries. Any grant award pursuant to § 86.14 or § 86.33 is subject to... whether within the scope of the project as approved or otherwise. Appropriate measures shall be taken by...

  6. Patents on computer-related inventions in India

    OpenAIRE

    Noto La Diega, Guido

    2016-01-01

    In India, sec. 3(k) of the Patents Act 1970 clearly excludes the patentability of computer programmes per se. For many years, the regime of computer-implemented inventions has been unclear, until the Controller General of Patents, Designs and Trade Marks (the Indian homologous of the Intellectual Property Office) issued its Guidelines on the examination of computer-related inventions. Notably, this gave rise the civil society’s protests; indeed, there was the fear that the government was surr...

  7. 10 Inventions on improving keyboard efficiency: A TRIZ based analysis

    OpenAIRE

    Mishra, Umakant

    2013-01-01

    A keyboard is the most important input device for a computer. With the development of technology a basic keyboard does not want to remain confined within the basic functionalities of a keyboard, rather it wants to go beyond. There are several inventions which attempt to improve the efficiency of a conventional keyboard. This article illustrates 10 inventions from US Patent database all of which have proposed very interesting methods for improving the efficiency of a computer keyboard. Some in...

  8. 10 Inventions on keyboard attachments-A TRIZ based analysis

    OpenAIRE

    Mishra, Umakant

    2013-01-01

    Although the primary objective of the keyboard to input data into the computer, the advanced keyboards keep various other things in mind, such as, how to use the same keyboard for various other purposes, or how to use the same keyboard efficiently by using various other attachments to the keyboard. This objective led to various inventions on keyboard attachments, some of which are illustrated below in this article. This article illustrates 10 inventions on various keyboard attachments from US...

  9. Viktigheten av fysisk aktivitet og trening blant eldre

    Directory of Open Access Journals (Sweden)

    Hilde Lohne-Seiler

    2012-11-01

    Full Text Available Regelmessig fysisk aktivitet er viktig for eldres helse. Sammenhengen mellom en fysisk aktiv livsstil og helsegevinster som forebygging av sykdom, opprettholdelse av uavhengighet og økt livskvalitet er godt dokumentert (ACSM's Position Stand 1998; Spirduso & Cronin, 2001; Taylor et al., 2004. Hensikten med denne oversiktsartikkelen er derfor å redegjøre for viktigheten av regelmessig fysisk aktivitet og trening i aldringsprosessen, samt utdype sammenhengen mellom en fysisk aktiv livsstil og fysisk funksjon blant eldre. Basert på en nasjonal multisenterstudie (Anderssen et al., 2009, tilfredsstilte 20% voksne og eldre (20-85 år de nasjonale anbefalinger om 30 minutter med daglig fysisk aktivitet. Kun 12% i den eldste aldersgruppen (80-85 år tilfredsstilte anbefalingene. Totalt fysisk aktivitetsnivå, målt ved hjelp av akselerometer, ble redusert med økende alder, hvor de eldste (80-85 år hadde 50% lavere aktivitetsnivå sammenlignet med de yngste (65-69 år (Lohne-Seiler et al., 2012. Fra 25-års alder reduseres utholdenhet og muskelstyrke med 10% per 10 år dersom individet er inaktiv (Heath et al., 1981; Wilmore, 1991. Systematisk utholdenhets- og styrketrening ser derimot ut til å redusere tapet med inntil halvparten, det vil si en reduksjon tilsvarende 5% per 10 år hos fysisk aktive individer (Heath et al., 1981. Eldre individer ser ut til å ha de samme treningsinduserte effekter som yngre, det vil si at man får effekt av økt aktivitet uansett alder, og da også lik prosentvis fremgang (Hagberg et al., 1989. Studier har vist at det er mulig å øke maksimalt oksygenopptak og maksimal muskelstyrke med inntil 10-20% i løpet av en 12 ukers intervensjon (Hagberg et al., 1989; Reeves et al., 2003; Lohne-Seiler et al, in press. Da muskelstyrke ser ut til å ha en sterk sammenheng med individets funksjonsevne/mobilitet, er det viktig å kunne tilrettelegge for systematisk styrketrening for eldre for på den måten å oppnå

  10. Regulating nutrient allocation in plants

    Science.gov (United States)

    Udvardi, Michael; Yang, Jiading; Worley, Eric

    2014-12-09

    The invention provides coding and promoter sequences for a VS-1 and AP-2 gene, which affects the developmental process of senescence in plants. Vectors, transgenic plants, seeds, and host cells comprising heterologous VS-1 and AP-2 genes are also provided. Additionally provided are methods of altering nutrient allocation and composition in a plant using the VS-1 and AP-2 genes.

  11. Regulating nutrient allocation in plants

    Energy Technology Data Exchange (ETDEWEB)

    Udvardi, Michael; Yang, Jiading; Worley, Eric

    2014-12-09

    The invention provides coding and promoter sequences for a VS-1 and AP-2 gene, which affects the developmental process of senescence in plants. Vectors, transgenic plants, seeds, and host cells comprising heterologous VS-1 and AP-2 genes are also provided. Additionally provided are methods of altering nutrient allocation and composition in a plant using the VS-1 and AP-2 genes.

  12. Kartlegging av læreres kunnskap er ikke enkelt

    Directory of Open Access Journals (Sweden)

    Reidar Mosvold

    2015-05-01

    Full Text Available Læreres kunnskap har betydning for elevenes læring, og som et ledd i prosessen for styrking av kvaliteten i norsk skole har politikere i senere tid ytret ønske om å kartlegge læreres kunnskap. Kartlegging av læreres kunnskap er imidlertid ikke enkelt, og i denne artikkelen undersøker vi hvordan de samme lærernes undervisningskunnskap i matematikk kan se ut til å være forskjellig når den måles ved hjelp av oppgaver med ulikt format. Deltakerne i studien var 30 praktiserende lærere, og instrumentet besto av 28 flervalgsoppgaver med tilhørende åpne oppgaver. Sammenhengen mellom lærernes kunnskap slik den måles ved hjelp av flervalgsoppgavene og de åpne oppgavene er ikke alltid klar. Det er derfor nødvendig å tilnærme seg måling av læreres undervisnings-kunnskap i matematikk med stor varsomhet. Nærmere undersøkelser er nødvendig for å finne ut hva slags type kunnskap som kan måles med ulike typer oppgaver og hva slags måleinstrumenter som kan brukes til hvilke formål.Nøkkelord: Undervisningskunnskap i matematikk, kartlegging, måleinstrument-er, flervalgsoppgaver AbstractTeachers’ knowledge influence students’ learning, and as part of their attempts to increase the quality of Norwegian schools, politicians have announced their intentions to measure the knowledge of teachers. Measuring teacher knowledge is not straightforward, however, and this article investigates how a group of mathematics teachers’ knowledge might appear different when measured by items of different formats. The participants in this study were 30 in-service teachers, and the instrument consisted of 28 multiple-choice items with associated open-response items. The connection between the teachers’ know-ledge as measured by multiple-choice items and open-response items is not always straightforward. As an implication, it is necessary to approach measure-ment of teachers’ mathematical knowledge for teaching with great care. Further studies are

  13. Avsluttende studentevaluering i Bachelorutdanningen : avgangsstudenters vurdering av undervisning og utdanning ved Politihøgskolen, Kull 05–08

    OpenAIRE

    Hove, Kjersti

    2010-01-01

    Denne rapporten inneholder en oppsummering og enkle analyser av studenters evaluering av utdanningen ved slutten av studiet. Evalueringen bygger delvis på spørsmål hentet fra StudData, og en tilsvarende rapport fra HiO ( Hatlevik, Ida Katrine Riksaasen: Avgangsstudenten – Studentenes vurdering av undervisning, praksis, studieforhold, tilegnet kompetanse, studieatferd og fremtidig utdanning. HiO-notat nr 2 -2009) hvor analyser av flere studentgruppers evalueringer er sammenstilt. Rapporten fra...

  14. Plants with useful traits and related methods

    Energy Technology Data Exchange (ETDEWEB)

    Mackenzie, Sally Ann; De la Rosa Santamaria, Roberto

    2017-07-18

    The present invention provides methods for obtaining plants that exhibit useful traits by transient suppression of the MSH1 gene of the plants. Methods for identifying genetic loci that provide for useful traits in plants and plants produced with those loci are also provided. In addition, plants that exhibit the useful traits, parts of the plants including seeds, and products of the plants are provided as well as methods of using the plants.

  15. Plants with useful traits and related methods

    Energy Technology Data Exchange (ETDEWEB)

    Mackenzie, Sally Ann; De la Rosa Santamaria, Roberto

    2016-10-25

    The present invention provides methods for obtaining plants that exhibit useful traits by transient suppression of the MSH1 gene of the plants. Methods for identifying genetic loci that provide for useful traits in plants and plants produced with those loci are also provided. In addition, plants that exhibit the useful traits, parts of the plants including seeds, and products of the plants are provided as well as methods of using the plants.

  16. Plants with useful traits and related methods

    Science.gov (United States)

    Mackenzie, Sally Ann; De la Rosa Santamaria, Roberto

    2016-10-25

    The present invention provides methods for obtaining plants that exhibit useful traits by transient suppression of the MSH1 gene of the plants. Methods for identifying genetic loci that provide for useful traits in plants and plants produced with those loci are also provided. In addition, plants that exhibit the useful traits, parts of the plants including seeds, and products of the plants are provided as well as methods of using the plants.

  17. Sifting of waste; Siktning av avfall

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Andreas [SP Technical Research Inst. of Sweden, Boraas (Sweden); Johnsson, Anders [Boraas Energi och Miljoe, Boraas (Sweden); Yoshiguchi, Hitomi [Stena Metall, Goeteborg (Sweden); Steenari, Britt-Marie [Chalmers Tekniska Hoegskola, Goeteborg (Sweden); Bostroem, Sara [Renova AB, Goeteborg (Sweden); Fredaeng, Julia [Dalkia, Stockholm (Sweden); Bisaillon, Mattias [Profu AB, Moelndal (Sweden); Andersson, Hans [Metso Power, Tammerfors (Finland)

    2008-08-15

    Waste as a fuel is characterized by high levels of inert components (ash) that may cause problems in a combustion process that result in high costs for operation and maintenance (e.g. large ash flows, high need for additives). A potential method for reduction of these costs is to separate inert components through sifting prior the combustion process. Previously it has been found that a major share of the unwanted components is found in the fine grains. However, the practical relevance of sifting has not been verified against boiler performance. Therefore, the prospects for sifting as a pre-treatment method was investigated at Boraas Energi och miljoe with the aim to characterize the composition in the fine-grained residues and to determine the effects from sifting on the boiler performance. The project includes also a short report on possible markets for the fine-grained residues. The effect target is to increase the boiler availability and to reduce the cost for operation and maintenance. The target groups for the work are owners of Energy-from-Waste plants as well as constructors of plants and sieves. The work shows that sifting can be beneficial from an economical point of view if a suitable market for the fine-grained residues is found. Several theoretical markets exist but the governing parameter is the actual costs for the post-treatment.

  18. Wirevagn : Utvecklingen av en utrullare för hisslinor

    OpenAIRE

    Rehnsfeldt, Patrik

    2014-01-01

    Kandidatexamensarbetet som utgick från en förfrågan från företaget Irongrip AB hade som mål att utveckla ett produktförslag på en utlindare av stålvajer för hissmontörer. Irongrip AB som tillverkar och säljer verktyg för hantering av stålvajer hade uppmärksammat att en efterfrågan på en sådan produkt fanns på marknaden då befintliga lösningar var bristfälliga och inte hade alla de funktioner som är önskvärda hos en sådan produkt.Arbetet inleddes med en förstudie där studiebesök vid lindragnin...

  19. 43 CFR 6.10 - Publicity concerning the invention after patent application is filed.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Publicity concerning the invention after... Interior PATENT REGULATIONS Inventions by Employees § 6.10 Publicity concerning the invention after patent application is filed. In order that the public may obtain the greatest possible benefit from inventions in...

  20. 38 CFR 1.655 - Government license in invention of employee.

    Science.gov (United States)

    2010-07-01

    ... invention of employee. 1.655 Section 1.655 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS GENERAL PROVISIONS Inventions by Employees of Department of Veterans Affairs § 1.655 Government license in invention of employee. If an invention is made by an employee and it is determined that the...

  1. 43 CFR 6.9 - Publication and public use of invention before patent application is filed.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Publication and public use of invention... Interior PATENT REGULATIONS Inventions by Employees § 6.9 Publication and public use of invention before patent application is filed. (a) Publication or public use of an invention constitutes a statutory bar to...

  2. 38 CFR 1.663 - Licensing of Government-owned inventions.

    Science.gov (United States)

    2010-07-01

    ...-owned inventions. 1.663 Section 1.663 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS GENERAL PROVISIONS Inventions by Employees of Department of Veterans Affairs § 1.663 Licensing of Government-owned inventions. (a) The licensing of Government-owned inventions under VA control and custody...

  3. 10 CFR 603.870 - Marking of documents related to inventions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Marking of documents related to inventions. 603.870... documents related to inventions. To protect the recipient's interest in inventions, the TIA should require the recipient to mark documents disclosing inventions it desires to protect by obtaining a patent. The...

  4. 37 CFR 1.296 - Withdrawal of request for publication of statutory invention registration.

    Science.gov (United States)

    2010-07-01

    ... publication of statutory invention registration. 1.296 Section 1.296 Patents, Trademarks, and Copyrights... for publication of statutory invention registration. A request for a statutory invention registration... statutory invention registration issued pursuant to § 1.294(c) by filing a request to withdraw the request...

  5. 7 CFR 1212.62 - Patents, copyrights, inventions, product formulations, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, product formulations... Information Order Promotion, Research, and Information § 1212.62 Patents, copyrights, inventions, product... invention, any patents, copyrights, inventions, product formulations, or publications developed through...

  6. EST Table: AV400562 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400562 br--1452X 10/09/28 59 %/160 aa ref|XP_001843664.1| neuroendocrine protein ...7b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 41 ...47 %/159 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  7. EST Table: AV400244 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400244 br--1010 10/09/28 53 %/100 aa ref|XP_001654557.1| neuroendocrine protein 7...b2 [Aedes aegypti] gb|EAT46754.1| neuroendocrine protein 7b2 [Aedes aegypti] 10/08/28 n.h 10/08/27 n.h 10/09/10 low homology 10/09/10 n.h 10/09/10 n.h BP115163 br-- ...

  8. EST Table: AV398380 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398380 NV021745 10/09/28 70 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV02 ...

  9. EST Table: AV399091 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399091 NV060650 10/09/28 71 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV06 ...

  10. EST Table: AV399252 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399252 NV060970 10/09/28 62 %/104 aa ref|NP_001119705.1| transformer 2 isoform A ...[Bombyx mori] gb|AAT42220.2| transformer-2 protein A [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 low homology 10/09/10 low homology NM_001126237 NV06 ...

  11. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  12. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  13. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  14. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  15. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  16. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  17. EST Table: AV398139 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398139 NV021172 10/09/28 46 %/243 aa ref|XP_001661901.1| DNA mismatch repair protein muts... [Aedes aegypti] gb|EAT36110.1| DNA mismatch repair protein muts [Aedes aegypti] 10/08/28 43 %/238 a...el|GB10970-PA 10/09/10 42 %/247 aa gi|91082687|ref|XP_971522.1| PREDICTED: similar to DNA mismatch repair protein muts [Tribolium castaneum] BY922838 NV02 ...

  18. Effekter av endringer i finansieringsansvaret for TNF-hemmere

    OpenAIRE

    Hagen, Terje P.; Bjarkum, Irina; Hobbel, Silje; Orderdalen, Karianne

    2009-01-01

    Tumor necreosis factor alfa (TNF-a) - hemmere, og andre biologiske inflammatoriske modifiserende legemidler blir brukt innen reumatologi, gastroenterologi og dermatologi. I denne rapporten analyseres effekter av endringer i finansieringssystemet for seks legemidler som faller innenfor disse legemiddelgruppene og som langt på vei er substitutter: Humira, Enbrel og Remicade som er TNF-hemmere, Raptiva og Orencia som er registrert under kategorien selektive immunsuppressiver og MabThera som er r...

  19. EST Table: AV401797 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401797 heS00172 10/09/28 94 %/235 aa ref|NP_001036831.1| saposin-related [Bombyx ...9/10 low homology 10/09/10 low homology 10/09/10 41 %/191 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 heS0 ...

  20. EST Table: AV401078 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401078 e96h0200 10/09/28 42 %/112 aa ref|XP_001648294.1| Juvenile hormone-inducib...le protein, putative [Aedes aegypti] gb|EAT44634.1| Juvenile hormone-inducible protein, putative [Aedes aegy... 10/09/10 36 %/106 aa gi|91080979|ref|XP_974925.1| PREDICTED: similar to Juvenile hormone-inducible protein, putative [Tribolium castaneum] FS808716 e96h ...