PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
International Nuclear Information System (INIS)
JOHNSTON GA
2008-01-01
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D and D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D and D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D and D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and Liability Act of 1980
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
Energy Technology Data Exchange (ETDEWEB)
JOHNSTON GA
2008-01-15
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D&D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D&D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D&D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and
Tank 241-Z-361 Sludge Retrieval and Treatment Alternatives
International Nuclear Information System (INIS)
HAMPTON, B.K.
2000-01-01
The Plutonium Finishing Plant (PFP) Tank 241-Z-361 (Z-361) contains legacy sludge resulting from waste discharges from past missions at PFP. A sketch of the tank is shown in Figure 1. In this view various risers and penetrations are shown along with the sludge level depicted by the horizontal line halfway up the tank, and the ground level depicted by the horizontal line above the tank. The HEPA filter installed for breathing is also shown on one of the risers
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Plutonium Finishing Plant (PFP) hazards assessment
International Nuclear Information System (INIS)
Campbell, L.R.
1998-01-01
This report documents the hazards assessment for the Plutonium Finishing Plant (PFP) located on the US Department of Energy (DOE) Hanford Site. This hazards assessment was conducted to provide the emergency planning technical basis for the PFP. DOE Orders require an emergency planning hazards assessment for each facility that has the potential to reach or exceed the lowest level emergency classification
International Nuclear Information System (INIS)
HIRZEL, D.R.
2000-01-01
The 241-2 waste tanks are used to store, treat, and transfer waste to Tank Farms. The sampling requirements are established to identify the composition of the tank waste. The primary goal is to meet the Tank Farms acceptance criteria. Tank Farms will not accept waste without extensive characterization sample data. Process and lab wastes are sampled for suitability prior to routing to Tk-D8. The samples are helpful in tracking the amount of chemical constituents to determine treatment and are required to maintain Pu inventory and criticality prevention limitations. Likewise, the waste is sampled prior to inter-tank transfers. The revised Waste Analysis Plan for 241-2 (WAP) contains current facility, process and waste descriptions. The WAP lists the Double Shell Tank (DST) system acceptance criteria, sampling parameters and required analyses. The characterization data on historical process wastes was deleted. A section on the Tank Farms waste approval procedural process was added to describe the steps necessary and documentation required to transfer waste to the DST system. Failure to collect proper samples will result in Tank Farms' refusal to accept PFP waste until proper sampling conditions are met. This will use up unnecessary time and resources but not place the plant in a hazardous position
International Nuclear Information System (INIS)
Keck, R.D.
1995-01-01
The Plutonium Finishing Plant (PFP) is currently stabilizing about 25 kg of Pu sludge; upon completion of this task, PFP will be maintained in a safe standby condition to await decision from the PFP NEPA review. It can take about 10 years to initiate and complete terminal cleanout after this; the facility will then be decommissioned and decontaminated. The 234-5Z ventilation system must continue to operate until terminal cleanout. Part of the ventilation system is the seismic fan shutdown system which shuts down the ventilation supply fans in case of strong earthquake. This document presents criteria for installing solid state, reduced voltage motor starters and isolation contactors for the 8 main ventilation supply fans. The isolation contactors will shutdown the supply fans in event of earthquake
Plutonium Finishing Plant (PFP) Treatment and Storage Unit Waste Analysis Plan
International Nuclear Information System (INIS)
PRIGNANO, A.L.
2000-01-01
The purpose of this waste analysis plan (WAP) is to document waste analysis activities associated with the Plutonium Finishing Plant Treatment and Storage Unit (PFP Treatment and Storage Unit) to comply with Washington Administrative Code (WAC) 173-303-300(1), (2), (4)(a) and (5). The PFP Treatment and Storage Unit is an interim status container management unit for plutonium bearing mixed waste radiologically managed as transuranic (TRU) waste. TRU mixed (TRUM) waste managed at the PFP Treatment and Storage Unit is destined for the Waste Isolation Pilot Plant (WIPP) and therefore is not subject to land disposal restrictions [WAC 173-303-140 and 40 CFR 268]. The PFP Treatment and Storage Unit is located in the 200 West Area of the Hanford Facility, Richland Washington (Figure 1). Because dangerous waste does not include source, special nuclear, and by-product material components of mixed waste, radionuclides are not within the scope of this documentation. The information on radionuclides is provided only for general knowledge
History and stabilization of the Plutonium Finishing Plant (PFP) complex, Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Gerber, M.S., Fluor Daniel Hanford
1997-02-18
The 231-Z Isolation Building or Plutonium Metallurgy Building is located in the Hanford Site`s 200 West Area, approximately 300 yards north of the Plutonium Finishing Plant (PFP) (234-5 Building). When the Hanford Engineer Works (HEW) built it in 1944 to contain the final step for processing plutonium, it was called the Isolation Building. At that time, HEW used a bismuth phosphate radiochemical separations process to make `AT solution,` which was then dried and shipped to Los Alamos, New Mexico. (AT solution is a code name used during World War II for the final HEW product.) The process was carried out first in T Plant and the 224-T Bulk Reduction Building and B Plant and the 224-B Bulk Reduction Building. The 224-T and -B processes produced a concentrated plutonium nitrate stream, which then was sent in 8-gallon batches to the 231-Z Building for final purification. In the 231-Z Building, the plutonium nitrate solution underwent peroxide `strikes` (additions of hydrogen peroxide to further separate the plutonium from its carrier solutions), to form the AT solution. The AT solution was dried and shipped to the Los Alamos Site, where it was made into metallic plutonium and then into weapons hemispheres.` The 231-Z Building began `hot` operations (operations using radioactive materials) with regular runs of plutonium nitrate on January 16, 1945.
Plutonium Finishing Plant safety evaluation report
International Nuclear Information System (INIS)
1995-01-01
The Plutonium Finishing Plant (PFP) previously known as the Plutonium Process and Storage Facility, or Z-Plant, was built and put into operation in 1949. Since 1949 PFP has been used for various processing missions, including plutonium purification, oxide production, metal production, parts fabrication, plutonium recovery, and the recovery of americium (Am-241). The PFP has also been used for receipt and large scale storage of plutonium scrap and product materials. The PFP Final Safety Analysis Report (FSAR) was prepared by WHC to document the hazards associated with the facility, present safety analyses of potential accident scenarios, and demonstrate the adequacy of safety class structures, systems, and components (SSCs) and operational safety requirements (OSRs) necessary to eliminate, control, or mitigate the identified hazards. Documented in this Safety Evaluation Report (SER) is DOE's independent review and evaluation of the PFP FSAR and the basis for approval of the PFP FSAR. The evaluation is presented in a format that parallels the format of the PFP FSAR. As an aid to the reactor, a list of acronyms has been included at the beginning of this report. The DOE review concluded that the risks associated with conducting plutonium handling, processing, and storage operations within PFP facilities, as described in the PFP FSAR, are acceptable, since the accident safety analyses associated with these activities meet the WHC risk acceptance guidelines and DOE safety goals in SEN-35-91
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1997-01-01
This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of 20 plus years ago. Records of transfers into the tank, past characterization efforts, and speculation will be used to estimate the current condition of Tank 241-Z-361 and its contents
Project plan remove special nuclear material from PFP project plutonium finishing plant
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove Special Nuclear Material (SNM) Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617, Rev. 0. This project plan is the top-level definitive project management document for PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Remove SNM Materials project. Any deviations to the document must be authorized through the appropriate change control process
PFP Wastewater Sampling Facility
International Nuclear Information System (INIS)
Hirzel, D.R.
1995-01-01
This test report documents the results obtained while conducting operational testing of the sampling equipment in the 225-WC building, the PFP Wastewater Sampling Facility. The Wastewater Sampling Facility houses equipment to sample and monitor the PFP's liquid effluents before discharging the stream to the 200 Area Treated Effluent Disposal Facility (TEDF). The majority of the streams are not radioactive and discharges from the PFP Heating, Ventilation, and Air Conditioning (HVAC). The streams that might be contaminated are processed through the Low Level Waste Treatment Facility (LLWTF) before discharging to TEDF. The sampling equipment consists of two flow-proportional composite samplers, an ultrasonic flowmeter, pH and conductivity monitors, chart recorder, and associated relays and current isolators to interconnect the equipment to allow proper operation. Data signals from the monitors are received in the 234-5Z Shift Office which contains a chart recorder and alarm annunciator panel. The data signals are also duplicated and sent to the TEDF control room through the Local Control Unit (LCU). Performing the OTP has verified the operability of the PFP wastewater sampling system. This Operability Test Report documents the acceptance of the sampling system for use
Plutonium Finishing Plant (PFP) Waste Composition and High Efficiency Particulate Air Filter Loading
Energy Technology Data Exchange (ETDEWEB)
ZIMMERMAN, B.D.
2000-12-11
This analysis evaluates the effect of the Plutonium Finishing Plant (PFP) waste isotopic composition on Tank Farms Final Safety Analysis Report (FSAR) accidents involving high-efficiency particulate air (HEPA) filter failure in Double-Contained Receiver Tanks (DCRTs). The HEPA Filter Failure--Exposure to High Temperature or Pressure, and Steam Intrusion From Interfacing Systems accidents are considered. The analysis concludes that dose consequences based on the PFP waste isotopic composition are bounded by previous FSAR analyses. This supports USQD TF-00-0768.
PFP requirements development planning guide
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The PFP Requirements Development Planning Guide presents the strategy and process used for the identification, allocation, and maintenance of requirements within the Plutonium Finishing Plant (PFP) integrated project baseline. Future revisions to this document will be included as attachments (e.g., results of the PFP Requirements Analysis attributable to this approach). This document is intended be a Project-owned management tool. As such, this document will periodically require revisions resulting from improvements of the information, processes, and techniques as now described. Future updates may be made to this document by PFP management and final approval of the content will be accomplished in a Baseline Change Request as it impacts the Multi-Year Work Plan, or baseline information managed in the Hanford Site Systems Engineering Baseline
International Nuclear Information System (INIS)
Hopkins, A.M.; Heineman, R.; Norton, S.; Miller, M.; Oates, L.
2003-01-01
Maintaining compliance with environmental regulatory requirements is a significant priority in successful completion of the Plutonium Finishing Plant (PFP) Nuclear Material Stabilization (NMS) Project. To ensure regulatory compliance throughout the deactivation and decommissioning of the PFP complex, an environmental regulatory strategy was developed. The overall goal of this strategy is to comply with all applicable environmental laws and regulations and/or compliance agreements during PFP stabilization, deactivation, and eventual dismantlement. Significant environmental drivers for the PFP Nuclear Material Stabilization Project include the Tri-Party Agreement; the Resource Conservation and Recovery Act of 1976 (RCRA); the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA); the National Environmental Policy Act of 1969 (NEPA); the National Historic Preservation Act (NHPA); the Clean Air Act (CAA), and the Clean Water Act (CWA). Recent TPA negotiation s with Ecology and EPA have resulted in milestones that support the use of CERCLA as the primary statutory framework for decommissioning PFP. Milestones have been negotiated to support the preparation of Engineering Evaluations/Cost Analyses for decommissioning major PFP buildings. Specifically, CERCLA EE/CA(s) are anticipated for the following scopes of work: Settling Tank 241-Z-361, the 232-Z Incinerator, , the process facilities (eg, 234-5Z, 242, 236) and the process facility support buildings. These CERCLA EE/CA(s) are for the purpose of analyzing the appropriateness of the slab-on-grade endpoint Additionally, agreement was reached on performing an evaluation of actions necessary to address below-grade structures or other structures remaining after completion of the decommissioning of PFP. Remaining CERCLA actions will be integrated with other Central Plateau activities at the Hanford site
Project Plan For Remove Special Nuclear Material (SNM) from Plutonium Finishing Plant (PFP) Project
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove SNM Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617. This project plan is the top-level definitive project management document for the PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baseline to manage the execution of the Remove SNM Materials project. Any deviation to the document must be authorized through the appropriate change control process. The Remove SNM Materials project provides the necessary support and controls required for DOE-HQ, DOE-RL, BWHC, and other DOE Complex Contractors the path forward to negotiate shipped/receiver agreements, schedule shipments, and transfer material out of PFP to enable final deactivation
Project plan remove special nuclear material from PFP project plutonium finishing plant; TOPICAL
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove Special Nuclear Material (SNM) Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617,Rev. 0. This project plan is the top-level definitive project management document for PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Remove SNM Materials project. Any deviations to the document must be authorized through the appropriate change control process
PFP functional development planning guide
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The PFP Functional Development Planning Guide presents the strategy and process used for the identification, development, and analysis of functions (activities) necessary to satisfy the requirements within the Plutonium Finishing Plant (PFP) integrated project baseline. The functional analysis will provide the basis for the development of a function driven work breakdown structure. Future revisions to this document will include as attachments the results of the PFP Functional Analysis resulting from this approach. This document is intended be a Project-owned management tool. As such, the guide will periodically require revisions resulting from improvements of the information, processes, and techniques as now described
Plutonium Finishing Plant (PFP) Standards/Requirements Identification Document (S/RID)
Energy Technology Data Exchange (ETDEWEB)
Maddox, B.S.
1996-01-01
This Standards/Requirements Identification Document (S/RID) sets forth the Environmental Safety and Health (ESH) standards/requirements for the Plutonium Finishing Plant (PFP). This S/RID is applicable to the appropriate life cycle phases of design, construction, operation, and preparation for decommissioning. These standards/requirements are adequate to ensure the protection of the health and safety of workers, the public, and the environment.
Plutonium Finishing Plant (PFP) Standards/Requirements Identification Document (S/RID)
International Nuclear Information System (INIS)
Maddox, B.S.
1996-01-01
This Standards/Requirements Identification Document (S/RID) sets forth the Environmental Safety and Health (ESH) standards/requirements for the Plutonium Finishing Plant (PFP). This S/RID is applicable to the appropriate life cycle phases of design, construction, operation, and preparation for decommissioning. These standards/requirements are adequate to ensure the protection of the health and safety of workers, the public, and the environment
Plutonium Finishing Plant (PFP) Final Safety Analysis Report (FSAR) [SEC 1 THRU 11
Energy Technology Data Exchange (ETDEWEB)
ULLAH, M K
2001-02-26
The Plutonium Finishing Plant (PFP) is located on the US Department of Energy (DOE) Hanford Site in south central Washington State. The DOE Richland Operations (DOE-RL) Project Hanford Management Contract (PHMC) is with Fluor Hanford Inc. (FH). Westinghouse Safety Management Systems (WSMS) provides management support to the PFP facility. Since 1991, the mission of the PFP has changed from plutonium material processing to preparation for decontamination and decommissioning (D and D). The PFP is in transition between its previous mission and the proposed D and D mission. The objective of the transition is to place the facility into a stable state for long-term storage of plutonium materials before final disposition of the facility. Accordingly, this update of the Final Safety Analysis Report (FSAR) reflects the current status of the buildings, equipment, and operations during this transition. The primary product of the PFP was plutonium metal in the form of 2.2-kg, cylindrical ingots called buttoms. Plutonium nitrate was one of several chemical compounds containing plutonium that were produced as an intermediate processing product. Plutonium recovery was performed at the Plutonium Reclamation Facility (PRF) and plutonium conversion (from a nitrate form to a metal form) was performed at the Remote Mechanical C (RMC) Line as the primary processes. Plutonium oxide was also produced at the Remote Mechanical A (RMA) Line. Plutonium processed at the PFP contained both weapons-grade and fuels-grade plutonium materials. The capability existed to process both weapons-grade and fuels-grade material through the PRF and only weapons-grade material through the RMC Line although fuels-grade material was processed through the line before 1984. Amounts of these materials exist in storage throughout the facility in various residual forms left from previous years of operations.
International Nuclear Information System (INIS)
Ocoma, E.C.
1995-01-01
Seismic evaluation of existing safety class (SC) 3 and non-SC 4 commodities at the Plutonium Finishing Plant (PFP) is integrated into an area walkdown program. Field walkdowns of potential PFP seismic deficiencies associated with structural failure and falling will be performed using the DOE SQUG/EPRI methodology. Potential proximity interactions are also addressed. Objective of the walkdown is to qualify as much of the equipment as practical and to identify candidates for further evaluation
PFP dangerous waste training plan
International Nuclear Information System (INIS)
Khojandi, J.
1996-01-01
This document establishes the minimum training requirements for the Plutonium Finishing Plant (PFP) personnel who are responsible for management of dangerous waste. The training plan outlines training requirements for handling of solid dangerous waste during generator accumulation and liquid dangerous waste during treatment and storage operations. The implementation of this training plan will ensure the PFP facility compliance with the training plan requirements of Dangerous Waste Regulation. Chapter 173-303-330. Washington Administrative Code (WAC). The requirements for such compliance is described in Section 11.0 of WHC-CM-7-5 Environmental Compliance Manual
International Nuclear Information System (INIS)
MAY, T.H.
1999-01-01
This document identifies the requirements and responsibilities for all parties to support waste transfer from the Plutonium Finishing Plant (PFP) facility to the Double-Shell Tank (DST) System of the River Protection Project (RPP). This Interface Control Document (ICD) will not attempt to control the physical portion of this interface because the physical equipment making up this interface, and any associated interface requirements, are already in place, operational and governed by existing operating specifications and other documentation. The PFP and DST Systems have a direct physical interface (the waste transfer pipeline) that travels between the 241-2 Building (TK-D5) and DST SY-102 via 244-TX double-contained receiver tank (DCRT). The purpose of the ICD process is to formalize working agreements between the RPP DST System and organization/companies internal and external to RPP. This ICD has been developed as part of the requirements basis for design of the DST System to support the Phase I Privatization effort
PFP deactivation project management plan
International Nuclear Information System (INIS)
Bogen, D.M.
1997-01-01
This document identifies the overall approach for deactivation of the Plutonium Finishing Plant (PFP) Complex, excluding the vaults, and includes a draft set of End Point Criteria for all buildings being deactivated
PFP total operating efficiency calculation and basis of estimate
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The purpose of the Plutonium Finishing Plant (PFP) Total Operating Efficiency Calculation and Basis of Estimate document is to provide the calculated value and basis of estimate for the Total Operating Efficiency (TOE) for the material stabilization operations to be conducted in 234-52 Building. This information will be used to support both the planning and execution of the Plutonium Finishing Plant (PFP) Stabilization and Deactivation Project's (hereafter called the Project) resource-loaded, integrated schedule
PFP issues/assumptions development and management planning guide
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The PFP Issues/Assumptions Development and Management Planning Guide presents the strategy and process used for the identification, allocation, and maintenance of an Issues/Assumptions Management List for the Plutonium Finishing Plant (PFP) integrated project baseline. Revisions to this document will include, as attachments, the most recent version of the Issues/Assumptions Management List, both open and current issues/assumptions (Appendix A), and closed or historical issues/assumptions (Appendix B). This document is intended be a Project-owned management tool. As such, this document will periodically require revisions resulting from improvements of the information, processes, and techniques as now described. Revisions that suggest improved processes will only require PFP management approval
International Nuclear Information System (INIS)
BUSCH, M.S.
2000-01-01
NFPA 101, section 5-9 mandates that, where required by building classification, all designated emergency egress routes be provided with adequate emergency lighting in the event of a normal lighting outage. Emergency lighting is to be arranged so that egress routes are illuminated to an average of 1.0 footcandle with a minimum at any point of 0.1 footcandle, as measured at floor level. These levels are permitted to drop to 60% of their original value over the required 90 minute emergency lighting duration after a power outage. The Plutonium Finishing Plant (PFP) has two designations for battery powered egress lights ''Emergency Lights'' are those battery powered lights required by NFPA 101 to provide lighting along officially designated egress routes in those buildings meeting the correct occupancy requirements. Emergency Lights are maintained on a monthly basis by procedure ZSR-12N-001. ''Backup Lights'' are battery powered lights not required by NFPA, but installed in areas where additional light may be needed. The Backup Light locations were identified by PFP Safety and Engineering based on several factors. (1) General occupancy and type of work in the area. Areas occupied briefly during a shiftly surveillance do not require backup lighting while a room occupied fairly frequently or for significant lengths of time will need one or two Backup lights to provide general illumination of the egress points. (2) Complexity of the egress routes. Office spaces with a standard hallway/room configuration will not require Backup Lights while a large room with several subdivisions or irregularly placed rooms, doors, and equipment will require Backup Lights to make egress safer. (3) Reasonable balance between the safety benefits of additional lighting and the man-hours/exposure required for periodic light maintenance. In some plant areas such as building 236-Z, the additional maintenance time and risk of contamination do not warrant having Backup Lights installed in all rooms
International Nuclear Information System (INIS)
Aftanas, B.L.
1996-01-01
This Functional Design Criteria (FDC) addresses remediation of the plutonium-bearing solutions currently in inventory at the Plutonium Finishing Plant (PFP). The recommendation from the Environmental Impact Statement (EIS) is that the solutions be treated thermally and stabilized as a solid for long term storage. For solutions which are not discardable, the baseline plan is to utilize a denitration process to stabilize the solutions prior to packaging for storage
System Design Description PFP Thermal Stabilization
International Nuclear Information System (INIS)
RISENMAY, H.R.
2000-01-01
The purpose of this document is to provide a system design description (SDD) and design basis for the Plutonium Finishing Plant (PFP) Thermal Stabilization project. The chief objective of the SDD is to document the Structures, Systems, and Components (SSCs) that establish and maintain the facility Safety Envelope necessary for normal safe operation of the facility; as identified in the FSAR, the OSRs, and Safety Assessment Documents (SADs). This safety equipment documentation should satisfy guidelines for the SDD given in WHC-SD-CP-TI-18 1, Criteria for Identification and Control of Equipment Necessary for Preservation of the Safety Envelope and Safe Operation of PFP. The basis for operational, alarm response, maintenance, and surveillance procedures are also identified and justified in this document. This document and its appendices address the following elements of the PFP Thermal Stabilization project: Functional and design requirements; Design description; Safety Envelope Analysis; Safety Equipment Class; and Operational, maintenance and surveillance procedures
Plant uptake and transport of 241Am
International Nuclear Information System (INIS)
Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.
1981-01-01
We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers
Technical Basis Document for PFP Area Monitoring Dosimetry Program
Cooper, J R
2000-01-01
This document describes the phantom dosimetry used for the PFP Area Monitoring program and establishes the basis for the Plutonium Finishing Plant's (PFP) area monitoring dosimetry program in accordance with the following requirements: Title 10, Code of Federal Regulations (CFR), part 835, ''Occupational Radiation Protection'' Part 835.403; Hanford Site Radiological Control Manual (HSRCM-1), Part 514; HNF-PRO-382, Area Dosimetry Program; and PNL-MA-842, Hanford External Dosimetry Technical Basis Manual.
Technical Basis Document for PFP Area Monitoring Dosimetry Program
International Nuclear Information System (INIS)
COOPER, J.R.
2000-01-01
This document describes the phantom dosimetry used for the PFP Area Monitoring program and establishes the basis for the Plutonium Finishing Plant's (PFP) area monitoring dosimetry program in accordance with the following requirements: Title 10, Code of Federal Regulations (CFR), part 835, ''Occupational Radiation Protection'' Part 835.403; Hanford Site Radiological Control Manual (HSRCM-1), Part 514; HNF-PRO-382, Area Dosimetry Program; and PNL-MA-842, Hanford External Dosimetry Technical Basis Manual
Technical Basis Document for PFP Area Monitoring Dosimetry Program
Energy Technology Data Exchange (ETDEWEB)
COOPER, J.R.
2000-04-17
This document describes the phantom dosimetry used for the PFP Area Monitoring program and establishes the basis for the Plutonium Finishing Plant's (PFP) area monitoring dosimetry program in accordance with the following requirements: Title 10, Code of Federal Regulations (CFR), part 835, ''Occupational Radiation Protection'' Part 835.403; Hanford Site Radiological Control Manual (HSRCM-1), Part 514; HNF-PRO-382, Area Dosimetry Program; and PNL-MA-842, Hanford External Dosimetry Technical Basis Manual.
PFP total process throughput calculation and basis of estimate
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The PFP Process Throughput Calculation and Basis of Estimate document provides the calculated value and basis of estimate for process throughput associated with material stabilization operations conducted in 234-52 Building. The process throughput data provided reflects the best estimates of material processing rates consistent with experience at the Plutonium Finishing Plant (PFP) and other U.S. Department of Energy (DOE) sites. The rates shown reflect demonstrated capacity during ''full'' operation. They do not reflect impacts of building down time. Therefore, these throughput rates need to have a Total Operating Efficiency (TOE) factor applied
Literature review supporting assessment of potential radionuclides in the 291-Z exhaust ventilation
International Nuclear Information System (INIS)
Mahoney, L.A.; Ballinger, M.Y.; Jette, S.J.; Thomas, L.M. Glissmeyer, J.A.; Davis, W.E.
1994-08-01
This literature review was prepared to support a study conducted by Pacific Northwest Laboratory to assess the potential deposition and resuspension of radionuclides in the 291-Z ventilation exhaust building located in the 200 West Area of the US Department of Energy's Hanford Project near Richland, Washington. The filtered ventilation air from three of the facilities at the Plutonium Finishing Plant (PFP) complex are combined together in the 291-Z building before discharge through a common stack. These three facilities contributing filtered exhaust air to the discharge stream are (1) the PFP, also known as the Z-Plant or 234-5Z, (2) the Plutonium Reclamation Facility (PRF or 236-Z), and (3), the Waste Incinerator Building (WIB or 232-Z). The 291-Z building houses the exhaust fans that pull air from the 291-Z central collection plenum and exhausts the air to the stack. Section 2.0 of this report is a description of the physical characteristic of the ventilation system from the High Efficiency Particulate Air (HEPA) filters to the exhaust stack. A description of the processes performed in the facilities that are vented through 291-Z is given in Section 3.0. The description focuses on the chemical and physical forms of potential aerosols given off from the unit operations. A timeline of the operations and events that may have affected the deposition of material in the ventilation system is shown. Aerosol and radiation measurements taken in previous studies are also discussed. Section 4.0 discusses the factors that influence particle deposition and adhesion. Mechanisms of attachment and resuspension are covered with specific attention to the PFP ducts. Conclusions and recommendations are given in Section 5.0
International Nuclear Information System (INIS)
WEISS, E.V.
2000-01-01
This report provides estimates of the expected whole body and extremity radiological dose, expressed as dose equivalent (DE), to workers conducting planned plutonium (Pu) stabilization processes at the Hanford Site Plutonium Finishing Plant (PFP). The report is based on a time and motion dose study commissioned for Project W-460, Plutonium Stabilization and Handling, to provide personnel exposure estimates for construction work in the PFP storage vault area plus operation of stabilization and packaging equipment at PFP
Weiss, E V
2000-01-01
This report provides estimates of the expected whole body and extremity radiological dose, expressed as dose equivalent (DE), to workers conducting planned plutonium (Pu) stabilization processes at the Hanford Site Plutonium Finishing Plant (PFP). The report is based on a time and motion dose study commissioned for Project W-460, Plutonium Stabilization and Handling, to provide personnel exposure estimates for construction work in the PFP storage vault area plus operation of stabilization and packaging equipment at PFP.
International Nuclear Information System (INIS)
WHITE, W.F.
1999-01-01
This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for PFP's criticality alarm system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to properly perform its safety function. There may be several manufacturers or models that meet the critical characteristics for any one item. PFP's Criticality Alarm System includes the nine criticality alarm system panels and their associated hardware. This includes all parts up to the first breaker in the electrical distribution system. Specific system boundaries and justifications are contained in HNF-SD-CP-SDD-003, ''Definition and Means of Maintaining the Criticality Detectors and Alarms Portion of the PFP Safety Envelope.'' The procurement requirements associated with the system necessitates procurement of some system equipment as Commercial Grade Items in accordance with HNF-PRO-268, ''Control of Purchased Items and Services.''
Tank 241-Z-361 vapor sampling and analysis plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-02-23
Tank 241-Z-361 is identified in the Hanford Federal Facility Agreement and Consent Order (commonly referred to as the Tri-Party Agreement), Appendix C, (Ecology et al. 1994) as a unit to be remediated under the authority of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). As such, the U.S. Environmental Protection Agency will serve as the lead regulatory agency for remediation of this tank under the CERCLA process. At the time this unit was identified as a CERCLA site under the Tri-Party Agreement, it was placed within the 200-ZP-2 Operable Unit. In 1997, The Tri-parties redefined 200 Area Operable Units into waste groupings (Waste Site Grouping for 200 Areas Soils Investigations [DOE-RL 1992 and 1997]). A waste group contains waste sites that share similarities in geological conditions, function, and types of waste received. Tank 241-Z-361 is identified within the CERCLA Plutonium/Organic-rich Process Condensate/Process Waste Group (DOE-RL 1992). The Plutonium/Organic-rich Process Condensate/Process Waste Group has been prioritized for remediation beginning in the year 2004. Results of Tank 216-Z-361 sampling and analysis described in this Sampling and Analysis Plan (SAP) and in the SAP for sludge sampling (to be developed) will determine whether expedited response actions are required before 2004 because of the hazards associated with tank contents. Should data conclude that remediation of this tank should occur earlier than is planned for the other sites in the waste group, it is likely that removal alternatives will be analyzed in a separate Engineering Evaluation/Cost Analysis (EE/CA). Removal actions would proceed after the U.S. Environmental Protection Agency (EPA) signs an Action Memorandum describing the selected removal alternative for Tank 216-Z-361. If the data conclude that there is no immediate threat to human health and the environment from this tank, remedial actions for the tank will be defined in a
Engineering work plan for PFP criticality alarm panel first unit re-build
International Nuclear Information System (INIS)
Clem, W.E.
1994-01-01
This document describes the first step in increasing the quality, reliability, and ease of maintenance of the nine Criticality Alarm Panels (CAP) at PFP. Development control practices and guidelines of WHC-CM-6-1, EP-2.4 and WHC-IP-1026, EPG-2.4 are applied to develop a prototype of a replacement Criticality Alarm Panel (CAP) with facility-use potential. During the development of the prototype CAP, the design requirements of all of PFP's nine CAPs are considered to develop standardized hardware and detailed design drawings that are tailored to PFP maintenance needs. Increased quality and reliability is achieved through quality hardware, proven technology and design techniques, and the use of the Class 1E workmanship standards of WHC-CM-8-1. The end result of the work described by this work plan is a verified/read-to-install replacement for CAP Z4 and verified/released H-2 drawings that are formatted such that they can easily be replicated when producing design drawings for the other eight CAPs
CSER 99-001: PFP LAB Dentirating calciner
International Nuclear Information System (INIS)
MILLER, E.M.; DOBBIN, K.D.
1999-01-01
A criticality safety evaluation report was prepared for the Plutonium Finishing Plant (PFP) laboratory denigrating calciner, located in Glovebox 188-1, that converts Pu(NO 3 ) 4 solutions to the high fired stable oxide PuO 2 . Fissile mass limits and volume limits are set for the glovebox for testing operations and training operators using only nitric acid feed to a plutonium oxide bed in the calciner
International Nuclear Information System (INIS)
WELSH, T.L.
2003-01-01
The purpose of this paper is to present qualification data generated from water and air-bath calorimeters measuring radioactive decay heat from plutonium oxide in DOE STD-3013-2000 (3013) containers at the Hanford Plutonium Finishing Plant (PFP). Published data concerning air and water bath calorimeters and especially 3013-qualified calorimeters is minimal at best. This paper will address the data from the measurement/qualification test plan, the heat standards used, and the calorimeter precision and accuracy results. The 3013 package is physically larger than earlier plutonium oxide storage containers, thereby necessitating a larger measurement chamber. To accommodate the measurements of the 3013 containers at PFP, Los Alamos National Laboratory (LANL) supplied a water bath dual-chambered unit and the Savannah River Technology Center (SRTC) provided two air-bath calorimeters. Both types of Calorimeters were installed in the analytical laboratory at PFP. The larger 3013 containers presented a new set of potential measurement problems: longer counting times, heat conductivity through a much larger container mass and wall thickness, and larger amounts of copper shot to assist sample thermal conductivity. These potential problems were addressed and included in the measurement/qualification test plan
Engineering report (conceptual design) PFP solution stabilization
Energy Technology Data Exchange (ETDEWEB)
Witt, J.B.
1997-07-17
This Engineering Report (Conceptual Design) addresses remediation of the plutonium-bearing solutions currently in inventory at the Plutonium Finishing Plant (PFP). The recommendation from the Environmental Impact Statement (EIS) is that the solutions be treated thermally and stabilized as a solid for long term storage. For solutions which are not discardable, the baseline plan is to utilize a denitration process to stabilize the solutions prior to packaging for storage.
Engineering report (conceptual design) PFP solution stabilization
International Nuclear Information System (INIS)
Witt, J.B.
1997-01-01
This Engineering Report (Conceptual Design) addresses remediation of the plutonium-bearing solutions currently in inventory at the Plutonium Finishing Plant (PFP). The recommendation from the Environmental Impact Statement (EIS) is that the solutions be treated thermally and stabilized as a solid for long term storage. For solutions which are not discardable, the baseline plan is to utilize a denitration process to stabilize the solutions prior to packaging for storage
CSER 00-006 Storage of Plutonium Residue Containers in 55 Gallon Drums at the PFP
Energy Technology Data Exchange (ETDEWEB)
DOBBIN, K.D.
2000-05-24
This criticality safety evaluation report (CSER) provides the required limit set and controls for safe transit and storage of these drums in the 234-5Z Building at the PFP. A mass limit of 200 g of plutonium or fissile equivalent per drum is acceptable
Characterization of past and present solid waste streams from the plutonium finishing plant
Energy Technology Data Exchange (ETDEWEB)
Duncan, D.R.; Mayancsik, B.A. [Westinghouse Hanford Co., Richland, WA (United States); Pottmeyer, J.A.; Vejvoda, E.J.; Reddick, J.A.; Sheldon, K.M.; Weyns, M.I. [Los Alamos Technical Associates, Kennewick, WA (United States)
1993-02-01
During the next two decades the transuranic (TRU) wastes now stored in the burial trenches and storage facilities at the Hanford Site are to be retrieved, processed at the Waste Receiving and Processing (WRAP) Facility, and shipped to the Waste Isolation Pilot Plant (WIPP) near Carlsbad, New Mexico for final disposal. Over 50% of the TRU waste to be retrieved for shipment to the WIPP has been generated at the Plutonium Finishing Plant (PFP), also known as the Plutonium Processing and Storage Facility and Z Plant. The purpose of this report is to characterize the radioactive solid wastes generated by the PFP since its construction in 1947 using process knowledge, existing records, and history-obtained from interviews. The PFP is currently operated by Westinghouse Hanford Company (WHC) for the US Department of Energy (DOE).
Characterization of past and present solid waste streams from the plutonium finishing plant
International Nuclear Information System (INIS)
Duncan, D.R.; Mayancsik, B.A.; Pottmeyer, J.A.; Vejvoda, E.J.; Reddick, J.A.; Sheldon, K.M.; Weyns, M.I.
1993-02-01
During the next two decades the transuranic (TRU) wastes now stored in the burial trenches and storage facilities at the Hanford Site are to be retrieved, processed at the Waste Receiving and Processing (WRAP) Facility, and shipped to the Waste Isolation Pilot Plant (WIPP) near Carlsbad, New Mexico for final disposal. Over 50% of the TRU waste to be retrieved for shipment to the WIPP has been generated at the Plutonium Finishing Plant (PFP), also known as the Plutonium Processing and Storage Facility and Z Plant. The purpose of this report is to characterize the radioactive solid wastes generated by the PFP since its construction in 1947 using process knowledge, existing records, and history-obtained from interviews. The PFP is currently operated by Westinghouse Hanford Company (WHC) for the US Department of Energy (DOE)
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2
PLUTONIUM FINISHING PLANT (PFP) SUB-GRADE EE/CA EVALUATION OF ALTERNATIVES: A NEW MODEL
International Nuclear Information System (INIS)
HOPKINS, A.M.
2007-01-01
An engineering evaluation/cost analysis (EE/CA) was performed at the Hanford Site's Plutonium Finishing Plant (PFP). The purpose of the EVCA was to identify the sub-grade items to be evaluated; determine the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) hazardous substances through process history and available data; evaluate these hazards; and as necessary, identify the available alternatives to reduce the risk associated with the contaminants. The sub-grade EWCA considered four alternatives for an interim removal action: (1) No Action; (2) Surveillance and Maintenance (S and M); (3) Stabilize and Leave in Place (Stabilization); and (4) Remove, Treat and Dispose (RTD). Each alternative was evaluated against the CERCLA criteria for effectiveness, implementability, and cost
PFP vault operations containers for Plutonium Handling and Storage Critical Characteristics
International Nuclear Information System (INIS)
BONADIE, E.P.
2000-01-01
This document specifies the critical characteristics for containers procured for Plutonium Finishing Plant's (PFP's) Vault Operations system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to perform its safety function
Operability test procedure for PFP wastewater sampling facility
International Nuclear Information System (INIS)
Hirzel, D.R.
1995-01-01
Document provides instructions for performing the Operability Test of the 225-WC Wastewater Sampling Station which monitors the discharge to the Treated Effluent Disposal Facility from the Plutonium Finishing Plant. This Operability Test Procedure (OTP) has been prepared to verify correct configuration and performance of the PFP Wastewater sampling system installed in Building 225-WC located outside the perimeter fence southeast of the Plutonium Finishing Plant (PFP). The objective of this test is to ensure the equipment in the sampling facility operates in a safe and reliable manner. The sampler consists of two Manning Model S-5000 units which are rate controlled by the Milltronics Ultrasonic flowmeter at manhole No.C4 and from a pH measuring system with the sensor in the stream adjacent to the sample point. The intent of the dual sampling system is to utilize one unit to sample continuously at a rate proportional to the wastewater flow rate so that the aggregate tests are related to the overall flow and thereby eliminate isolated analyses. The second unit will only operate during a high or low pH excursion of the stream (hence the need for a pH control). The major items in this OTP include testing of the Manning Sampler System and associated equipment including the pH measuring and control system, the conductivity monitor, and the flow meter
Plutonium Finishing Plan (PFP) Treatment and Storage Unit Interim Status Closure Plan
International Nuclear Information System (INIS)
PRIGNANO, A.L.
2000-01-01
This document describes the planned activities and performance standards for closing the Plutonium Finishing Plant (PFP) Treatment and Storage Unit. The PFP Treatment and Storage Unit is located within the 234-52 Building in the 200 West Area of the Hanford Facility. Although this document is prepared based upon Title 40 Code of Federal Regulations (CFR), Part 265, Subpart G requirements, closure of the unit will comply with Washington Administrative Code (WAC) 173-303-610 regulations pursuant to Section 5.3 of the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Action Plan (Ecology et al. 1996). Because the PFP Treatment and Storage Unit manages transuranic mixed (TRUM) waste, there are many controls placed on management of the waste. Based on the many controls placed on management of TRUM waste, releases of TRUM waste are not anticipated to occur in the PFP Treatment and Storage Unit. Because the intention is to clean close the PFP Treatment and Storage Unit, postclosure activities are not applicable to this closure plan. To clean close the unit, it will be demonstrated that dangerous waste has not been left onsite at levels above the closure performance standard for removal and decontamination. If it is determined that clean closure is not possible or is environmentally impractical, the closure plan will be modified to address required postclosure activities. The PFP Treatment and Storage Unit will be operated to immobilize and/or repackage plutonium-bearing waste in a glovebox process. The waste to be processed is in a solid physical state (chunks and coarse powder) and will be sealed into and out of the glovebox in closed containers. The containers of immobilized waste will be stored in the glovebox and in additional permitted storage locations at PFP. The waste will be managed to minimize the potential for spills outside the glovebox, and to preclude spills from reaching soil. Containment surfaces will be maintained to ensure
Yu, Xiaoli; Tang, Junli; Wang, Qunqing; Ye, Wenwu; Tao, Kai; Duan, Shuyi; Lu, Chenchen; Yang, Xinyu; Dong, Suomeng; Zheng, Xiaobo; Wang, Yuanchao
2012-10-01
• The Phytophthora sojae genome encodes hundreds of RxLR effectors predicted to manipulate various plant defense responses, but the molecular mechanisms involved are largely unknown. Here we have characterized in detail the P. sojae RxLR effector Avh241. • To determine the function and localization of Avh241, we transiently expressed it on different plants. Silencing of Avh241 in P. sojae, we determined its virulence during infection. Through the assay of promoting infection by Phytophthora capsici to Nicotiana benthamiana, we further confirmed this virulence role. • Avh241 induced cell death in several different plants and localized to the plant plasma membrane. An N-terminal motif within Avh241 was important for membrane localization and cell death-inducing activity. Two mitogen-activated protein kinases, NbMEK2 and NbWIPK, were required for the cell death triggered by Avh241 in N. benthamiana. Avh241 was important for the pathogen's full virulence on soybean. Avh241 could also promote infection by P. capsici and the membrane localization motif was not required to promote infection. • This work suggests that Avh241 interacts with the plant immune system via at least two different mechanisms, one recognized by plants dependent on subcellular localization and one promoting infection independent on membrane localization. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.
International Nuclear Information System (INIS)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G.
2004-01-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including 241 Am). 241 Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of 241 Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of 241 Am from the biomass. The content of 241 Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of 241 Am in the plants were in inverse proportion to their biomass. We obtained new data on release of 241 Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial 241 Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of 241 Am and retain americium for long periods of time in biomass. (author)
27 CFR 19.241 - Operations bond-distilled spirits plant and adjacent bonded wine cellar.
2010-04-01
... spirits plant and adjacent bonded wine cellar. 19.241 Section 19.241 Alcohol, Tobacco Products and... wine cellar. (a) General. A wine cellar under the provisions of 27 CFR part 24 shall be treated as... subpart G for the production of distilled spirits; and (2) Such wine cellar and distilled spirits plant...
Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils
International Nuclear Information System (INIS)
Rashydov, N.M.
2002-01-01
Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from
Energy Technology Data Exchange (ETDEWEB)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)
2004-07-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)
Fazzari, D M
2001-01-01
This report presents the results of an evaluation of the Total Measurement Uncertainty (TMU) for the Canberra manufactured Segmented Gamma Scanner Assay System (SGSAS) as employed at the Hanford Plutonium Finishing Plant (PFP). In this document, TMU embodies the combined uncertainties due to all of the individual random and systematic sources of measurement uncertainty. It includes uncertainties arising from corrections and factors applied to the analysis of transuranic waste to compensate for inhomogeneities and interferences from the waste matrix and radioactive components. These include uncertainty components for any assumptions contained in the calibration of the system or computation of the data. Uncertainties are propagated at 1 sigma. The final total measurement uncertainty value is reported at the 95% confidence level. The SGSAS is a gamma assay system that is used to assay plutonium and uranium waste. The SGSAS system can be used in a stand-alone mode to perform the NDA characterization of a containe...
International Nuclear Information System (INIS)
HOPKINS, A.M.
2003-01-01
The new approach to negotiations was termed collaborative (win-win) rather than positional (win-lose). Collaborative negotiations were conducted to establish milestones for the decommissioning of the Plutonium Finishing Plant, PFP
Myer, Gregory D; Ford, Kevin R; Di Stasi, Stephanie L; Foss, Kim D Barber; Micheli, Lyle J; Hewett, Timothy E
2015-01-01
Identifying risk factors for knee pain and anterior cruciate ligament (ACL) injury can be an important step in the injury prevention cycle. We evaluated two unique prospective cohorts with similar populations and methodologies to compare the incidence rates and risk factors associated with patellofemoral pain (PFP) and ACL injury. The 'PFP cohort' consisted of 240 middle and high school female athletes. They were evaluated by a physician and underwent anthropometric assessment, strength testing and three-dimensional landing biomechanical analyses prior to their basketball season. 145 of these athletes met inclusion for surveillance of incident (new) PFP by certified athletic trainers during their competitive season. The 'ACL cohort' included 205 high school female volleyball, soccer and basketball athletes who underwent the same anthropometric, strength and biomechanical assessment prior to their competitive season and were subsequently followed up for incidence of ACL injury. A one-way analysis of variance was used to evaluate potential group (incident PFP vs ACL injured) differences in anthropometrics, strength and landing biomechanics. Knee abduction moment (KAM) cut-scores that provided the maximal sensitivity and specificity for prediction of PFP or ACL injury risk were also compared between the cohorts. KAM during landing above 15.4 Nm was associated with a 6.8% risk to develop PFP compared to a 2.9% risk if below the PFP risk threshold in our sample. Likewise, a KAM above 25.3 Nm was associated with a 6.8% risk for subsequent ACL injury compared to a 0.4% risk if below the established ACL risk threshold. The ACL-injured athletes initiated landing with a greater knee abduction angle and a reduced hamstrings-to-quadriceps strength ratio relative to the incident PFP group. Also, when comparing across cohorts, the athletes who suffered ACL injury also had lower hamstring/quadriceps ratio than the players in the PFP sample (p15 Nm of knee abduction load
International Nuclear Information System (INIS)
RASMUSSEN, O.R.
2000-01-01
This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies
PFP Interface identification and management planning guide
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The purpose of-this planning guide is to present the process used to identify, document, and control PFP Stabilization and Deactivation Project interfaces. Revisions to this document will include, as attachments, the most recent version of the Project Interface Management List. A preliminary Interface Management List is included in Appendix A. This document is intended be a Project owned management tool. As such, this document will periodically require revisions resulting from improvements of the information, processes, and techniques as now described. For most revisions that suggest improved processes, PFP management approval is all that will be required
HANFORD PLUTONIUM FINISHG PLAN (PFP) COMPLETES PLUTONIUM STABILIZATION KEY SAFETY ISSUES CLOSED
International Nuclear Information System (INIS)
GERBER, M.S.
2004-01-01
A long and intense effort to stabilize and repackage nearly 18 metric tons (MT) of plutonium-bearing leftovers from defense production and nuclear experiments concluded successfully in February, bringing universal congratulations to the Department of Energy's Hanford Site in southeast Washington State. The victorious stabilization and packaging endeavor at the Plutonium Finishing Plant (PFP), managed and operated by prime contractor Fluor Hanford, Inc., finished ahead of all milestones in Hanford's cleanup agreement with regulators, and before deadlines set by the Defense Nuclear Facilities Safety Board (DNFSB), a part of the federal Executive Branch that oversees special nuclear materials. The PFP stabilization and packaging project also completed under budget for its four-year tenure, and has been nominated for a DOE Secretarial Award. It won the Project of the Year Award in the local chapter competition of the Project Management Institute, and is being considered for awards at the regional and national level
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-08-05
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-07-29
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
Federal Laboratory Consortium — The Plutonium Finishing Plant, also known as PFP, represented the end of the line (the final procedure) associated with plutonium production at Hanford.PFP was also...
Hawkins, Troy; Chitale, Meghana; Luban, Stanislav; Kihara, Daisuke
2009-02-15
Protein function prediction is a central problem in bioinformatics, increasing in importance recently due to the rapid accumulation of biological data awaiting interpretation. Sequence data represents the bulk of this new stock and is the obvious target for consideration as input, as newly sequenced organisms often lack any other type of biological characterization. We have previously introduced PFP (Protein Function Prediction) as our sequence-based predictor of Gene Ontology (GO) functional terms. PFP interprets the results of a PSI-BLAST search by extracting and scoring individual functional attributes, searching a wide range of E-value sequence matches, and utilizing conventional data mining techniques to fill in missing information. We have shown it to be effective in predicting both specific and low-resolution functional attributes when sufficient data is unavailable. Here we describe (1) significant improvements to the PFP infrastructure, including the addition of prediction significance and confidence scores, (2) a thorough benchmark of performance and comparisons to other related prediction methods, and (3) applications of PFP predictions to genome-scale data. We applied PFP predictions to uncharacterized protein sequences from 15 organisms. Among these sequences, 60-90% could be annotated with a GO molecular function term at high confidence (>or=80%). We also applied our predictions to the protein-protein interaction network of the Malaria plasmodium (Plasmodium falciparum). High confidence GO biological process predictions (>or=90%) from PFP increased the number of fully enriched interactions in this dataset from 23% of interactions to 94%. Our benchmark comparison shows significant performance improvement of PFP relative to GOtcha, InterProScan, and PSI-BLAST predictions. This is consistent with the performance of PFP as the overall best predictor in both the AFP-SIG '05 and CASP7 function (FN) assessments. PFP is available as a web service at http://dragon.bio.purdue.edu/pfp
PFP Interface identification and management planning guide; TOPICAL
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
The purpose of-this planning guide is to present the process used to identify, document, and control PFP Stabilization and Deactivation Project interfaces. Revisions to this document will include, as attachments, the most recent version of the Project Interface Management List. A preliminary Interface Management List is included in Appendix A. This document is intended be a Project owned management tool. As such, this document will periodically require revisions resulting from improvements of the information, processes, and techniques as now described. For most revisions that suggest improved processes, PFP management approval is all that will be required
International Nuclear Information System (INIS)
BRIGGS, C.R.
2000-01-01
The primary purpose of the verification enhancement review was for the DOE Richland Operations Office (RL) to verify contractor readiness for the independent DOE Integrated Safety Management System Verification (ISMSV) on the Plutonium Finishing Plant (PFP). Secondary objectives included: (1) to reinforce the engagement of management and to gauge management commitment and accountability; (2) to evaluate the ''value added'' benefit of direct public involvement; (3) to evaluate the ''value added'' benefit of direct worker involvement; (4) to evaluate the ''value added'' benefit of the panel-to-panel review approach; and, (5) to evaluate the utility of the review's methodology/adaptability to periodic assessments of ISM status. The review was conducted on December 6-8, 1999, and involved the conduct of two-hour interviews with five separate panels of individuals with various management and operations responsibilities related to PFP. A semi-structured interview process was employed by a team of five ''reviewers'' who directed open-ended questions to the panels which focused on: (1) evidence of management commitment, accountability, and involvement; and, (2) consideration and demonstration of stakeholder (including worker) information and involvement opportunities. The purpose of a panel-to-panel dialogue approach was to better spotlight: (1) areas of mutual reinforcement and alignment that could serve as good examples of the management commitment and accountability aspects of ISMS implementation, and, (2) areas of potential discrepancy that could provide opportunities for improvement. In summary, the Review Team found major strengths to include: (1) the use of multi-disciplinary project work teams to plan and do work; (2) the availability and broad usage of multiple tools to help with planning and integrating work; (3) senior management presence and accessibility; (4) the institutionalization of worker involvement; (5) encouragement of self-reporting and self
Plutonium-239 and americium-241 uptake by plants from soil. Final report
International Nuclear Information System (INIS)
Brown, K.W.
1979-03-01
Alfalfa was grown in soil contaminated with plutonium-239 dioxide (239PuO2) at a concentration of 29.7 nanocuries per gram (nCi/g). In addition to alfalfa, radishes, wheat, rye, and tomatoes were grown in soils contaminated with americium-241 nitrate (241Am(NO3)3) at a concentration of 189 nCi/g. The length of exposure varied from 52 days for the radishes to 237 days for the alfalfa. The magnitude of plutonium incorporation by the alfalfa as indicated by the concentration ratio, 0.0000025, was similar to previously reported data using other chemical forms of plutonium. The results did indicate, however, that differences in the biological availability of plutonium isotopes do exist. All of the species exposed to americium-241 assimilated and translocated this radioisotope to the stem, leaf, and fruiting structures. The magnitude of incorporation as signified by the concentration ratios varied from 0.00001 for the wheat grass to 0.0152 for the radishes. An increase in the uptake of americium also occurred as a function of time for four of the five plant species. Evidence indicates that the predominant factor in plutonium and americium uptake by plants may involve the chelation of these elements in soils by the action of compounds such as citric acid and/or other similar chelating agents released from plant roots
Plan for the Startup of HA-21I Furnace Operations at the Plutonium Finishing Plant (PFP)
International Nuclear Information System (INIS)
WILLIS, H.T.
2000-01-01
Achievement of Thermal Stabilization mission elements require the installation and startup of three additional muffle furnaces for the thermal stabilization of plutonium and plutonium bearing materials at the Plutonium Finishing Plant (PFP). The release to operate these additional furnaces will require an Activity Based Startup Review. The conduct of the Activity Based Startup Review (ABSR) was approved by Fluor Daniel Hanford on October 15, 1999. This plan has been developed with the objective of identifying those activities needed to guide the controlled startup of five furnaces from authorization to unrestricted operations by adding the HA-211 furnaces in an orderly and safe manner after the approval to Startup has been given. The Startup Plan provides a phased approach that bridges the activities between the completion of the Activity Based Startup Review authorizing the use of the three additional furnaces and the unrestricted operation of the five thermal stabilization muffle furnaces. The four phases are: (1) the initiation of five furnace operations using three empty (simulated full) boat charges from HA-211 and two full charges from HC-21C; (2) three furnace operations (one full charge from HA-211 and two full charges from HC-21C); (3) four furnace operations (two full charges from HA-211 and two full charges from HC-21C); and (4) integrated five furnace operations and unrestricted operations. Phase 1 of the Plan will be considered as the cold runs. This Plan also provides management oversight and administrative controls that are to be implemented until unrestricted operations are authorized. It also provides a formal review process for ensuring that all preparations needed for full five furnace operations are completed and formally reviewed prior to proceeding to the increased activity levels associated with five furnace operations. Specific objectives include: (1) To ensure that activities are conducted in a safe manner. (2) To provide supplemental
Picard, Christine; Bosco, Marco
2008-01-01
Several soil microorganisms colonizing roots are known to naturally promote the health of plants by controlling a range of plant pathogens, including bacteria, fungi, and nematodes. The use of theses antagonistic microorganisms, recently named plant-probiotics, to control plant-pathogenic fungi is receiving increasing attention, as they may represent a sustainable alternative to chemical pesticides. Many years of research on plant-probiotic microorganisms (PPM) have indicated that fluorescent pseudomonads producing antimicrobial compounds are largely involved in the suppression of the most widespread soilborne pathogens. Phenotype and genotype analysis of plant-probiotic fluorescent pseudomonads (PFP) have shown considerable genetic variation among these types of strains. Such variability plays an important role in the rhizosphere competence and the biocontrol ability of PFP strains. Understanding the mechanisms by which genotypic and phenotypic diversity occurs in natural populations of PFP could be exploited to choose those agricultural practices which best exploit the indigenous PFP populations, or to isolate new plant-probiotic strains for using them as inoculants. A number of different methods have been used to study diversity within PFP populations. Because different resolutions of the existing microbial diversity can be revealed depending on the approach used, this review first describes the most important methods used for the assessment of fluorescent Pseudomonas diversity. Then, we focus on recent data relating how differences in genotypic and phenotypic diversity within PFP communities can be attributed to geographic location, climate, soil type, soil management regime, and interactions with other soil microorganisms and host plants. It becomes evident that plant-related parameters exert the strongest influence on the genotypic and phenotypic variations in PFP populations.
Acceptance test report 2721-Z upgrades
International Nuclear Information System (INIS)
Keck, R.D.
1998-01-01
This test procedure provides instructions for acceptance testing of modifications to the 2721-Z diesel-generator system made by Project C-189. The modifications include (1) replacing the generator NUMA-LOGIC controller with connection to the PFP distributed control system (DCS), (2) replacing ATSI with a breaker switching scheme for 2736-ZB backup power and (3) providing a method for generator load and system testing
International Nuclear Information System (INIS)
WILLIS, H.T.
2000-01-01
This plan provides an analysis for locating a TGA to support PFP Thermal Stabilization processes. The scope of this document is to evaluate the need for, and location for, installation of a TGA system as a supplement to the SFE equipment for moisture measurement in pure oxides. A location assessment for the SFE equipment was previously performed (HNF 1999). Based on that assessment, co-location of the TGA system with the SFE system is the preferred option. This would enable thermally stabilized material to be analyzed for residual moisture by either the TGA system or SFE system or both This evaluation considers glovebox locations in the PFP 234-52 Building Analytical Laboratory or operating areas for the installation of the TGA system and it's supporting equipment. This evaluation considers using existing gloveboxes along with an alternative of adding a new glovebox to existing process lines. The location evaluation criteria focuses mainly on glovebox size, with qualitative consideration of relative cost and schedule impacts associated with system implementation, radiological control, and interaction with other laboratory operations and processes. In addition, the possible co-location of a TGA furnace system with the SFE system was considered
Time and Temperature Test Results for PFP Thermal Stabilization Furnaces
International Nuclear Information System (INIS)
COMPTON, J.A.
2000-01-01
The national standard for plutonium storage acceptability (standard DOE-STD-3013-99, generally known as ''the 3013 standard'') has been revised to clarify the requirement for processes that will produce acceptable storage materials. The 3013 standard (Reference 1) now states that ''Oxides shall be stabilized by heating the material in an oxidizing atmosphere to a Material Temperature of at least 950 C (1742 F) for not less than 2 hours.'' The process currently in use for producing stable oxides for storage at the Plutonium Finishing Plant (PFP) heats a furnace atmosphere to 1000 C and holds it there for 2 hours. The temperature of the material being stabilized is not measured directly during this process. The Plutonium Process Support Laboratories (PPSL) were requested to demonstrate that the process currently in use at PFP is an acceptable method of producing stable plutonium dioxide consistently. A spare furnace identical to the production furnaces was set up and tested under varying conditions with non-radioactive surrogate materials. Reference 2 was issued to guide the testing program. The process currently in use at the PFP for stabilizing plutonium-bearing powders was shown to heat all the material in the furnace to at least 950 C for at least 2 hours. The current process will work for (1) relatively pure plutonium dioxide, (2) dioxide powders mixed with up to 20 weight percent magnesium oxide, and (3) dioxide powders with up to 11 weight percent magnesium oxide and 20 weight percent magnesium nitrate hexahydrate. Time and temperature data were also consistent with a successful demonstration for a mixture containing 10 weight percent each of sodium and potassium chloride; however, the molten chloride salts destroyed the thermocouples in the powder and temperature data were unavailable for part of that run. These results assume that the current operating limits of no more than 2500 grams per furnace charge and a powder height of no more than 1.5 inches remain
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
International Nuclear Information System (INIS)
White, W.F.
1997-01-01
The Criticality Alarm System (CAS) provides continuous detection for high radiation (criticality) events and automatically initiates an evacuation signal to affected personnel. The Safety Envelope (SE) for PFP includes the necessary equipment and the required procedures to ensure the CAS is capable of performing its intended function. This document provides the definition and means of maintaining the SE for PFP related to the CAS. This document also identifies and provides a justification for those portions of the CAS excluded from the PFP Safety Envelope
Directory of Open Access Journals (Sweden)
Chitale Meghana
2013-02-01
Full Text Available Abstract Background Many Automatic Function Prediction (AFP methods were developed to cope with an increasing growth of the number of gene sequences that are available from high throughput sequencing experiments. To support the development of AFP methods, it is essential to have community wide experiments for evaluating performance of existing AFP methods. Critical Assessment of Function Annotation (CAFA is one such community experiment. The meeting of CAFA was held as a Special Interest Group (SIG meeting at the Intelligent Systems in Molecular Biology (ISMB conference in 2011. Here, we perform a detailed analysis of two sequence-based function prediction methods, PFP and ESG, which were developed in our lab, using the predictions submitted to CAFA. Results We evaluate PFP and ESG using four different measures in comparison with BLAST, Prior, and GOtcha. In addition to the predictions submitted to CAFA, we further investigate performance of a different scoring function to rank order predictions by PFP as well as PFP/ESG predictions enriched with Priors that simply adds frequently occurring Gene Ontology terms as a part of predictions. Prediction accuracies of each method were also evaluated separately for different functional categories. Successful and unsuccessful predictions by PFP and ESG are also discussed in comparison with BLAST. Conclusion The in-depth analysis discussed here will complement the overall assessment by the CAFA organizers. Since PFP and ESG are based on sequence database search results, our analyses are not only useful for PFP and ESG users but will also shed light on the relationship of the sequence similarity space and functions that can be inferred from the sequences.
Plutonium Finishing Plant Treatment and Storage Unit Dangerous Waste Training Plan
International Nuclear Information System (INIS)
ENTROP, G.E.
2000-01-01
The training program for personnel performing waste management duties pertaining to the Plutonium Finishing Plant (PFP) Treatment and Storage Unit is governed by the general requirements established in the Plutonium Finishing Plant Dangerous Waste Training Plan (PFP DWTP). The PFP Treatment and Storage Unit DWTP presented below incorporates all of the components of the PFP DWTP by reference. The discussion presented in this document identifies aspects of the training program specific to the PFP Treatment and Storage Unit. The training program includes specifications for personnel instruction through both classroom and on-the-job training. Training is developed specific to waste management duties. Hanford Facility personnel directly involved with the PFP Treatment and Storage Unit will receive training to container management practices, spill response, and emergency response. These will include, for example, training in the cementation process and training pertaining to applicable elements of WAC 173-303-330(1)(d). Applicable elements from WAC 173-303-330(1)(d) for the PFP Treatment and Storage Unit include: procedures for inspecting, repairing, and replacing facility emergency and monitoring equipment; communications and alarm systems; response to fires or explosions; and shutdown of operations
Maintenance implementation plan for the Plutonium Finishing Plant. Revision 3
International Nuclear Information System (INIS)
Meldrom, C.A.
1996-03-01
This document outlines the Maintenance Implementation Plan (MIP) for the Plutonium Finishing Plant (PFP) located at the Hanford site at Richland, Washington. This MIP describes the PFP maintenance program relative to DOE order 4330.4B. The MIP defines the key actions needed to meet the guidelines of the Order to produce a cost-effective and efficient maintenance program. A previous report identified the presence of significant quantities of Pu-bearing materials within PFP that pose risks to workers. PFP's current mission is to develop, install and operate processes which will mitigate these risks. The PFP Maintenance strategy is to equip the facility with systems and equipment able to sustain scheduled PFP operations. The current operating run is scheduled to last seven years. Activities following the stabilization operation will involve an Environmental Impact Statement (EIS) to determine future plant activities. This strategy includes long-term maintenance of the facility for safe occupancy and material storage. The PFP maintenance staff used the graded approach to dictate the priorities of the improvement and upgrade actions identified in Chapter 2 of this document. The MIP documents PFP compliance to the DOE 4330.4B Order. Chapter 2 of the MIP follows the format of the Order in addressing the eighteen elements. As this revision is a total rewrite, no sidebars are included to highlight changes
International Nuclear Information System (INIS)
LINTHO, J.E.
2003-01-01
The purpose of this document is to record the technical evaluation of the Technical Safety Requirements described in the Plutonium Finishing Plant (PFP) Safety Technical Requirements, HNF-SD-CP-OSR-010/Rev.1, Section 3.1.1, ''Criticality Prevention System.'' This document also defines the Safety Envelope (SE) for the liquid detection interlock system in the Process Vacuum System. The SE is derived FR-om information in the Plutonium Finishing Plant Final Safety Analysis Report (PFP FSAR), HNF-SD-CP-SAR-021, Rev 4, and the Criticality Safety Analysis Report (CSAR) for the 26-inch Hg Vacuum System, WHC-SD-SQA-CSA-20159, Rev 0-A. This document, with its appendices, provides the following: (1) The system functional requirements for determining system operability (Section 3). (2) Evaluations of equipment to determine the safety envelope boundary for the system (Section 4 list of SE boundary drawings). (3) A list of the safety envelope equipment (Appendix B). (4) Functional requirements for the individual safety envelope equipment, including appropriate set points and process parameters (Section 4). (5) A list of the operational and surveillance procedures necessary to operate and maintain the system equipment within the safety envelope (Sections 5 and 6 and Appendix A)
A New Property of Conjugated Polymer PFP: Catalytic Degradation of Methylene Blue Aqueous Solution
Institute of Scientific and Technical Information of China (English)
无
2005-01-01
A new property of conjugated polymer poly(furancarbinol-co-phenol)(PFP) was studied.The target copolymer was used as a catalyst after proper heating treatment. And dye methylene blue (MB) could be fully degraded and largely mineralized on PFP, under natural light or even in dark, in a few minutes. Furthermore, the catalytic activity could be preserved after several runs and the catalyst was readily separated. The effect of calcination temperature was also observed.
System design description PFP thermal stabilization
International Nuclear Information System (INIS)
RISENMAY, H.R.
1998-01-01
The purpose of this document is to provide a system design description and design basis for the Plutonium Finishing P1ant (PFP) Thermal Stabilization project. The sources of material for this project are residues scraped from glovebox floors and materials already stored in vault storage that need further stabilizing to meet the 3013 storage requirements. Stabilizing this material will promote long term storage and reduced worker exposure. This document addresses: function design, equipment, and safety requirements for thermal stabilization of plutonium residues and oxides
Project Management Plan to Maintain Safe and Compliant Conditions at the Plutonium Finishing Plant
International Nuclear Information System (INIS)
COX, G.J.
1999-01-01
This Project Management Plan presents the overall plan, description, mission, and workscope for the Plutonium Finishing Plant (PFP) maintain safe and compliant conditions project at PFP. This plan presents the overall description, mission, work scope, and planning for the Plutonium Finishing Plant (PFP) Maintain Safe and Compliant Conditions Project at PFP. This project includes all tasks required to maintain the safety boundary for the PFP Complex, except for the 2736-2 Vault Complex and the 234-52 vaults and vault-type rooms. The intent of this plan is to describe how this project will be managed and integrated with the stabilization, and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617, Rev. 0. This is the top-level definitive project management document that specifies the technical (work scope), schedule, and cost baselines that will manage the execution of this project. It describes the organizational approach and roles/responsibilities implemented to execute the project. This plan is under configuration management and any deviations must be authorized by appropriate change control action
Results of dilution studies with waste from tank 241-AN-104
International Nuclear Information System (INIS)
HERTING, D.L.
1999-01-01
This report documents the completion of the B and W Hanford Company functional and Safety Review Board reviews and the Fluor Daniel Hanford review for the Plutonium Finishing Plant (PFP) Final Safety Analysis Report (FSAR), HNF-SD-CP-SAR-021, Revision 1. The reviews for the FSAR were conducted during the period from December 9, 1998 to January 14, 1999
Test plan for N2 HEPA filters assembly shop stock used on PFP E4 exhaust system
International Nuclear Information System (INIS)
DICK, J.D.
1999-01-01
At Plutonium Finishing Plant (PFP) and Plutonium Reclamation Facility (PRF) Self-contained HEPA filters, encased in wooden frames and boxes, are installed in the E4 Exhaust Ventilation System to provide confinement of radioactive releases to the environment and confinement of radioactive contamination within designated zones inside the facility. Recently during the routine testing in-leakage was discovered downstream of the Self-contained HEPA filters boxes. This Test Plan describes the approach to conduct investigation of the root causes for the in-leakage of HEPA filters
Justification for Continued Operation for Tank 241-Z-361
Energy Technology Data Exchange (ETDEWEB)
BOGEN, D.M.
1999-09-01
This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford.
Justification for Continued Operation for Tank 241-Z-361
International Nuclear Information System (INIS)
BOGEN, D.M.
1999-01-01
This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford
Effects of Organic Acids and Sylvite on Phytoextraction of 241Am Contaminated Soil.
Wang, Ping; Du, Liang; Tan, Zhaoyi; Su, Rongbo; Li, Taowen
2017-03-01
Contamination of soil with Americium ( 241 Am) at nuclear sites in China poses a serious problem. We screened six plants, from five families, for their 241 Am-enrichment potential. Europium (Eu), which is morphologically and chemically similar to the highly toxic 241 Am, was used in its place. Moreover, the effects of sylvite, citric acid (CA), malic acid (MA), and humic acid (HA) on the absorption of 241 Am by the plants, and its transport within them, were evaluated along with their effect on plant biomass and 241 Am extraction volume. Barley and cabbage showed relatively stronger Eu accumulation capacities. Citric acid promoted the absorption of 241 Am by barley roots and its transport within the plants. The effects of sylvite were not obvious and those of HA were the weakest in case of sunflower; HA, however, maximally increased the biomass of the plants. Our results could provide the basis for future radionuclide phytoremediation of contaminated soils.
International Nuclear Information System (INIS)
STUBBS, A.M.
2001-01-01
The purpose of this Computer Software Document (CSWD) is to provide configuration control of the Honeywell Modular Automation System (MAS) in use at the Plutonium Finishing Plant (PFP) for the Magnesium Hydroxide Precipitation Process in Rm 230C/234-5Z. The magnesium hydroxide process control software Rev 0 is being updated to include control programming for a second hot plate. The process control programming was performed by the system administrator. Software testing for the additional hot plate was performed per PFP Job Control Work Package 2Z-00-1703. The software testing was verified by Quality Control to comply with OSD-Z-184-00044, Magnesium Hydroxide Precipitation Process
Plutonium vulnerability issues at Hanford's Plutonium Finishing Plant
International Nuclear Information System (INIS)
Feldt, E.; Templeton, D.W.; Tholen, E.
1995-01-01
The Plutonium Finishing Plant (PFP) at the Hanford, Washington Site was operated to produce plutonium (Pu) metal and oxide for national defense purposes. Due to the production requirements and methods utilized to meet national needs and the abrupt shutdown of the plant in the late 1980s, the plant was left in a condition that poses a risk of radiation exposure to plant workers, of accidental radioactive material release to the environment, and of radiation exposure to the public. In early 1994, an Environmental Impact Statement (EIS) to determine the best methods for cleaning out and stabilizing Pu materials in the PFP was started. While the EIS is being prepared, a number of immediate actions have been completed or are underway to significantly reduce the greatest hazards in the PFP. Recently, increased attention his been paid to Pu risks at Department of Energy (DOE) facilities resulting in the Department-wide Plutonium Vulnerability Assessment and a recommendation by the Defense Nuclear Facilities Safety Board (DNFSB) for DOE to develop integrated plans for managing its nuclear materials
1999 Annual Cathodic Protection Survey Report for PFP
International Nuclear Information System (INIS)
BOWMAN, T.J.
2000-01-01
This cathodic protection (CP) report documents the results of the 1999 annual CP survey of the underground piping within PFP property. An annual survey of CP systems is required by Washington Administrative Code (WAC). A spreadsheet to document the 1999 annual survey polarization data is included in this report. Graphs are included to trend the cathodic voltages and the polarization voltages at each test station on PFP property. The trending spans from 1994 to 1999. Graphs are also included to trend voltage and amperage outputs of each rectifier during the annual surveys. During the annual survey, resistance testing between the underground piping was conducted at each test station. The testing showed that all piping (with test leads into the test stations) was continuous with every pipe represented in the test stations. The resistance data is not documented in this report but can be accessed in work package 22-99-01003. During the annual survey, the wiring configurations of anode junction boxes AJB(R45-1) and AJB(45-1) were documented. The sketches can be accessed from the JCS work record of work package 22-99-01003. Analysis, conclusions, and recommendations of the 1999 annual CP survey results are included in this report
Z-inertial fusion energy: power plant final report FY 2006.
Energy Technology Data Exchange (ETDEWEB)
Anderson, Mark (University of Wisconsin, Madison, WI); Kulcinski, Gerald (University of Wisconsin, Madison, WI); Zhao, Haihua (University of California, Berkeley, CA); Cipiti, Benjamin B.; Olson, Craig Lee; Sierra, Dannelle P.; Meier, Wayne (Lawrence Livermore National Laboratories); McConnell, Paul E.; Ghiaasiaan, M. (Georgia Institute of Technology, Atlanta, GA); Kern, Brian (Georgia Institute of Technology, Atlanta, GA); Tajima, Yu (University of California, Los Angeles, CA); Campen, Chistopher (University of California, Berkeley, CA); Sketchley, Tomas (University of California, Los Angeles, CA); Moir, R (Lawrence Livermore National Laboratories); Bardet, Philippe M. (University of California, Berkeley, CA); Durbin, Samuel; Morrow, Charles W.; Vigil, Virginia L (University of Wisconsin, Madison, WI); Modesto-Beato, Marcos A.; Franklin, James Kenneth (University of California, Berkeley, CA); Smith, James Dean; Ying, Alice (University of California, Los Angeles, CA); Cook, Jason T.; Schmitz, Lothar (University of California, Los Angeles, CA); Abdel-Khalik, S. (Georgia Institute of Technology, Atlanta, GA); Farnum, Cathy Ottinger; Abdou, Mohamed A. (University of California, Los Angeles, CA); Bonazza, Riccardo (University of Wisconsin, Madison, WI); Rodriguez, Salvador B.; Sridharan, Kumar (University of Wisconsin, Madison, WI); Rochau, Gary Eugene; Gudmundson, Jesse (University of Wisconsin, Madison, WI); Peterson, Per F. (University of California, Berkeley, CA); Marriott, Ed (University of Wisconsin, Madison, WI); Oakley, Jason (University of Wisconsin, Madison, WI)
2006-10-01
This report summarizes the work conducted for the Z-inertial fusion energy (Z-IFE) late start Laboratory Directed Research Project. A major area of focus was on creating a roadmap to a z-pinch driven fusion power plant. The roadmap ties ZIFE into the Global Nuclear Energy Partnership (GNEP) initiative through the use of high energy fusion neutrons to burn the actinides of spent fuel waste. Transmutation presents a near term use for Z-IFE technology and will aid in paving the path to fusion energy. The work this year continued to develop the science and engineering needed to support the Z-IFE roadmap. This included plant system and driver cost estimates, recyclable transmission line studies, flibe characterization, reaction chamber design, and shock mitigation techniques.
Z-inertial fusion energy: power plant final report FY 2006
International Nuclear Information System (INIS)
Anderson, Mark; Kulcinski, Gerald; Zhao, Haihua; Cipiti, Benjamin B.; Olson, Craig Lee; Sierra, Dannelle P.; Meier, Wayne; McConnell, Paul E.; Ghiaasiaan, M.; Kern, Brian; Tajima, Yu; Campen, Chistopher; Sketchley, Tomas; Moir, R; Bardet, Philippe M.; Durbin, Samuel; Morrow, Charles W.; Vigil, Virginia L.; Modesto-Beato, Marcos A.; Franklin, James Kenneth; Smith, James Dean; Ying, Alice; Cook, Jason T.; Schmitz, Lothar; Abdel-Khalik, S.; Farnum, Cathy Ottinger; Abdou, Mohamed A.; Bonazza, Riccardo; Rodriguez, Salvador B.; Sridharan, Kumar; Rochau, Gary Eugene; Gudmundson, Jesse; Peterson, Per F.; Marriott, Ed; Oakley, Jason
2006-01-01
This report summarizes the work conducted for the Z-inertial fusion energy (Z-IFE) late start Laboratory Directed Research Project. A major area of focus was on creating a roadmap to a z-pinch driven fusion power plant. The roadmap ties ZIFE into the Global Nuclear Energy Partnership (GNEP) initiative through the use of high energy fusion neutrons to burn the actinides of spent fuel waste. Transmutation presents a near term use for Z-IFE technology and will aid in paving the path to fusion energy. The work this year continued to develop the science and engineering needed to support the Z-IFE roadmap. This included plant system and driver cost estimates, recyclable transmission line studies, flibe characterization, reaction chamber design, and shock mitigation techniques
International Nuclear Information System (INIS)
HOPKINS, A.M.
2003-01-01
The Department of Energy is responsible for the safe management and cleanup of the DOE complex. As part of the cleanup and closure of the Plutonium Finishing Plant (PFP) located on the Hanford site, the nuclear material inventory was reviewed to determine the appropriate disposition path. Based on the nuclear material characteristics, the material was designated for stabilization and packaging for long term storage and transfer to the Savannah River Site, or a decision for discard was made. The discarded material was designated as waste material and slated for disposal to the Waste Isolation Pilot Plant (WIPP). Prior to preparing any residue wastes for disposal at the WIPP, several major activities need to be completed. As detailed a processing history as possible of the material including origin of the waste must be researched and documented. A technical basis for termination of safeguards on the material must be prepared and approved. Utilizing process knowledge and processing history, the material must be characterized, sampling requirements determined, acceptable knowledge package and waste designation completed prior to disposal. All of these activities involve several organizations including the contractor, DOE, state representatives and other regulators such as EPA. At PFP, a process has been developed for meeting the many, varied requirements and successfully used to prepare several residue waste streams including Rocky Flats incinerator ash, hanford incinerator ash and Sand, Slag and Crucible (SS and C) material for disposal. These waste residues are packed into Pipe Overpack Containers for shipment to the WIPP
System requirement specifications for the Z-plant materials information tracking system (ZMITS)
International Nuclear Information System (INIS)
NEGIN, C.A.
1999-01-01
This is a system requirement specification for a database which will be developed to track classified information related to nuclear materials stored at PFP. The system will supplement existing databases to support both processing and disposition information needs
Cost/risk/benefit analysis report on the decontamination and decommissioning of Z-plant
International Nuclear Information System (INIS)
Melvin, J.P.; Sexton, R.A.; Fort, M.L.; Nunn, S.E.
1979-01-01
This study was performed to estimate the cost of decontaminating and decommissioning Z-Plant. All of the buildings in the Z-Plant exclusion area except Building 2736-Z, the plutonium storage vault, are included in the study. The study also excludes all underground facilities within the exclusion area which are not contained within a building and all Z-Plant related facilities outside the perimeter fence. The contamination in Z-Plant is primarily 239 Pu which has a half-life of 24,360 years. Because of the long half-life of 239 Pu, it is not practical to consider the isolation of the facility to await reduction of the contamination level by natural decay. Therefore, this study analyzes the costs, risk and benefit of decontaminating Z-Plant to four different levels of residual contamination. The three principle criteria used in the analysis are cost, the risk of offsite dose to the public, and the occupational exposure to onsite personnel
Cost/risk/benefit analysis report on the decontamination and decommissioning of Z-plant
Energy Technology Data Exchange (ETDEWEB)
Melvin, J. P.; Sexton, R. A.; Fort, M. L.; Nunn, S. E.
1979-09-28
This study was performed to estimate the cost of decontaminating and decommissioning Z-Plant. All of the buildings in the Z-Plant exclusion area except Building 2736-Z, the plutonium storage vault, are included in the study. The study also excludes all underground facilities within the exclusion area which are not contained within a building and all Z-Plant related facilities outside the perimeter fence. The contamination in Z-Plant is primarily /sup 239/Pu which has a half-life of 24,360 years. Because of the long half-life of /sup 239/Pu, it is not practical to consider the isolation of the facility to await reduction of the contamination level by natural decay. Therefore, this study analyzes the costs, risk and benefit of decontaminating Z-Plant to four different levels of residual contamination. The three principle criteria used in the analysis are cost, the risk of offsite dose to the public, and the occupational exposure to onsite personnel.
Energy Technology Data Exchange (ETDEWEB)
Gerber, Mark A.; Schmidt, Andrew J.; Delegard, Calvin H.; Silvers, Kurt L.; Baker, Aaron B.; Gano, Susan R.; Thornton, Brenda M.
2000-09-28
This document summarizes an evaluation of the magnesium hydroxide [Mg(OH)2] process to be used at the Hanford Plutonium Finishing Plant (PFP) for stabilizing plutonium/nitric acid solutions to meet the goal of stabilizing the plutonium in an oxide form suitable for storage under DOE-STD-3013-99. During the treatment process, nitric acid solutions bearing plutonium nitrate are neutralized with Mg(OH)2 in an air sparge reactor. The resulting slurry, containing plutonium hydroxide, is filtered and calcined. The process evaluation included a literature review and extensive laboratory- and bench-scale testing. The testing was conducted using cerium as a surrogate for plutonium to identify and quantify the effects of key processing variables on processing time (primarily neutralization and filtration time) and calcined product properties.
International Nuclear Information System (INIS)
Bondareva, L.; Vlasova, I.; Mogilnaya, O.; Bolsunovsky, A.; Kalmykov, S.
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide 241 Am among different components of the plant. The total amount of 241 Am added to the experimental system was 1850 ± 31 Bq/L. The total amount of 241 Am accumulated by the plants was 182 Bq per sample, or 758,333 ± 385 Bq/kg dry mass. It has been found that the major portion of 241 Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of 241 Am within different components of the submerged plant E. canadensis was not uniform. 241 Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Bondareva, L; Vlasova, I; Mogilnaya, O; Bolsunovsky, A; Kalmykov, S
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide (241)Am among different components of the plant. The total amount of (241)Am added to the experimental system was 1850+/-31 Bq/L. The total amount of (241)Am accumulated by the plants was 182 Bq per sample, or 758,333+/-385 Bq/kg dry mass. It has been found that the major portion of (241)Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of (241)Am within different components of the submerged plant E. canadensis was not uniform. (241)Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
International Nuclear Information System (INIS)
Hebdon, J.; Yerxa, J.; Romine, L.; Hopkins, AM; Piippo, R.; Cusack, L.; Bond, R.; Wang, Oliver; Willis, D.
2003-01-01
The Hanford Nuclear Reservation is a former U. S. Department of Energy Defense Production Site. The site is currently listed on the National Priorities List of the Comprehensive Environmental Response Compensation and Liability Act of 1980 (CERCLA) and is undergoing cleanup and environmental restoration. The PFP is a former Plutonium metal production facility. The operating mission of the PFP ended with a DOE Headquarters shutdown letter in October of 1996. Generally, the receipt of a shutdown letter initiates the start of Transition (as the first step of Decommissioning) of a facility. The Hanford site is subject to the Hanford Federal Facilities Compliance Act and Consent Order (HFFCCO), an order on consent signed by the DOE, the U. S. Environmental Protection Agency, (EPA) and the Washington Department of Ecology (WDOE). Under the HFFCCO, negotiations for transition milestones begin within six months after the issuance of a shutdown order. In the case of the PFP, the Nuclear Materials disposition and stabilization activities, a DOE responsibility, were necessary as precursor activities to Transition. This situation precipitated a crisis in the negotiations between the agencies, and formal negotiations initiated in 1997 ended in failure. The negotiations reached impasse on several key regulatory and operational issues. The 1997 negotiation was characterized by a strongly positional style. DOE and the regulatory personnel took hard lines early in the negotiations and were unable to move to resolution of key issues after a year and a half. This resulted in unhappy stakeholders, poor publicity and work delays as well as wounded relationships between DOE and the regulatory community. In the 2000-2001 PFP negotiations, a completely different approach was suggested and eventually initiated: Collaborative Negotiations. The collaborative negotiation style resulted in agreement between the agencies on all key issues within 6 months of initiation. All parties were very
Energy Technology Data Exchange (ETDEWEB)
Hebdon, J.; Yerxa, J.; Romine, L.; Hopkins, AM; Piippo, R.; Cusack, L.; Bond, R.; Wang, Oliver; Willis, D.
2003-02-27
The Hanford Nuclear Reservation is a former U. S. Department of Energy Defense Production Site. The site is currently listed on the National Priorities List of the Comprehensive Environmental Response Compensation and Liability Act of 1980 (CERCLA) and is undergoing cleanup and environmental restoration. The PFP is a former Plutonium metal production facility. The operating mission of the PFP ended with a DOE Headquarters shutdown letter in October of 1996. Generally, the receipt of a shutdown letter initiates the start of Transition (as the first step of Decommissioning) of a facility. The Hanford site is subject to the Hanford Federal Facilities Compliance Act and Consent Order (HFFCCO), an order on consent signed by the DOE, the U. S. Environmental Protection Agency, (EPA) and the Washington Department of Ecology (WDOE). Under the HFFCCO, negotiations for transition milestones begin within six months after the issuance of a shutdown order. In the case of the PFP, the Nuclear Materials disposition and stabilization activities, a DOE responsibility, were necessary as precursor activities to Transition. This situation precipitated a crisis in the negotiations between the agencies, and formal negotiations initiated in 1997 ended in failure. The negotiations reached impasse on several key regulatory and operational issues. The 1997 negotiation was characterized by a strongly positional style. DOE and the regulatory personnel took hard lines early in the negotiations and were unable to move to resolution of key issues after a year and a half. This resulted in unhappy stakeholders, poor publicity and work delays as well as wounded relationships between DOE and the regulatory community. In the 2000-2001 PFP negotiations, a completely different approach was suggested and eventually initiated: Collaborative Negotiations. The collaborative negotiation style resulted in agreement between the agencies on all key issues within 6 months of initiation. All parties were very
International Nuclear Information System (INIS)
HOPKINS, A.M.; KLOS, D.B.; MINETT, M.J.
2007-01-01
This paper documents the fiscal year (FY) 2006 assessment to evaluate potential chemical and radiological hazards associated with vessels and piping in the former plutonium process areas at Hanford's Plutonium Finishing Plant (PFP). Evaluations by PFP engineers as design authorities for specific systems and other subject-matter experts were conducted to identify the chemical hazards associated with transitioning the process areas for the long-term layup of PFP before its eventual final decontamination and decommissioning (D and D). D and D activities in the main process facilities were suspended in September 2005 for a period of between 5 and 10 years. A previous assessment conducted in FY 2003 found that certain activities to mitigate chemical hazards could be deferred safely until the D and D of PFP, which had been scheduled to result in a slab-on-grade condition by 2009. As a result of necessary planning changes, however, D and D activities at PFP will be delayed until after the 2009 time frame. Given the extended project and plant life, it was determined that a review of the plant chemical hazards should be conducted. This review to determine the extended life impact of chemicals is called the ''Plutonium Finishing Plant Chemical Hazards Assessment, FY 2006''. This FY 2006 assessment addresses potential chemical and radiological hazard areas identified by facility personnel and subject-matter experts who reevaluated all the chemical systems (items) from the FY 2003 assessment. This paper provides the results of the FY 2006 chemical hazards assessment and describes the methodology used to assign a hazard ranking to the items reviewed
Energy Technology Data Exchange (ETDEWEB)
Bondareva, L., E-mail: lydiabondareva@gmail.co [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Vlasova, I. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation); Mogilnaya, O.; Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Kalmykov, S. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation)
2010-01-15
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide {sup 241}Am among different components of the plant. The total amount of {sup 241}Am added to the experimental system was 1850 +- 31 Bq/L. The total amount of {sup 241}Am accumulated by the plants was 182 Bq per sample, or 758,333 +- 385 Bq/kg dry mass. It has been found that the major portion of {sup 241}Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of {sup 241}Am within different components of the submerged plant E. canadensis was not uniform. {sup 241}Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
Dayley, L
2000-01-01
The requirements for the performance of radiological design reviews are codified in 10CFR835, Occupational Radiation Protection. The basic requirements for the performance of ALARA design reviews are presented in the Hanford Site Radiological Control Manual (HSRCM). The HSRCM has established trigger levels requiring radiological reviews of non-routine or complex work activities. These requirements are implemented in site procedures HNF-PRO-1622 and 1623. HNF-PRO-1622 Radiological Design Review Process requires that ''radiological design reviews [be performed] of new facilities and equipment and modifications of existing facilities and equipment''. In addition, HNF-PRO-1623 Radiological Work Planning Process requires a formal ALARA Review for planned activities that are estimated to exceed 1 person-rem total Dose Equivalent (DE). The purpose of this review is to validate that the original design for the PFP Cementation Process ensures that the principles of ALARA (As Low As Reasonably Achievable) were included...
Plan for the Initiation of HA-211 Furnace Operations at the Plutonium Finishing Plan (PFP)
International Nuclear Information System (INIS)
WILLIS, H.T.
2000-01-01
This plan provides a phased approach authorizing the use of three additional muffle furnaces for thermal stabilization. Achievement of Thermal Stabilization mission elements require the installation and startup of three additional muffle furnaces for the thermal stabilization of plutonium and plutonium bearing materials at the Plutonium Finishing Plant (PFP). The release to operate these additional furnaces will require an Activity Based Startup Review. The conduct of the Activity Based Startup Review (ABSR) was approved by Fluor Daniel Hanford on October 15, 1999. This plan has been developed with the objective of identifying those activities needed to guide the controlled startup of five furnaces from authorization to unrestricted operations by adding the HA-211 furnaces in an orderly and safe manner after the approval to Startup has been given
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
International Nuclear Information System (INIS)
Dean, L.N.
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D ampersand D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project
Energy Technology Data Exchange (ETDEWEB)
Dean, L.N. [Advanced Sciences, Inc., (United States)
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D&D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project.
PFP Commercial Grade Food Pack Cans for Plutonium Handling and Storage Critical Characteristics
International Nuclear Information System (INIS)
BONADIE, E.P.
1999-01-01
This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for PFP's Vault Operations system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to perform its safety function
Czech Academy of Sciences Publication Activity Database
Adamec, Lubomír
2010-01-01
Roč. 49, č. 2 (2010), s. 241-251 ISSN 0079-2047 Institutional research plan: CEZ:AV0Z60050516 Keywords : aquatic carnivorous plant s * Lentibulariaceae * dystrophic water Subject RIV: EF - Botanics Impact factor: 0.462, year: 2010
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Plutonium finishing plant dangerous waste training plan
International Nuclear Information System (INIS)
ENTROP, G.E.
1999-01-01
This training plan describes general requirements, worker categories, and provides course descriptions for operation of the Plutonium Finish Plant (PFP) waste generation facilities, permitted treatment, storage and disposal (TSD) units, and the 90-Day Accumulation Areas
Preliminary safety evaluation for the plutonium stabilization and packaging system
International Nuclear Information System (INIS)
Shapley, J.E.
1997-01-01
This Preliminary Safety Evaluation (PSE) describes and analyzes the installation and operation of the Plutonium Stabilization and Packaging System (SPS) at the Plutonium Finishing Plant (PFP). The SPS is a combination of components required to expedite the safe and timely storage of Plutonium (Pu) oxide. The SPS program will receive site Pu packages, process the Pu for storage, package the Pu into metallic containers, and safely store the containers in a specially modified storage vault. The location of the SPS will be in the 2736- ZB building and the storage vaults will be in the 2736-Z building of the PFP, as shown in Figure 1-1. The SPS will produce storage canisters that are larger than those currently used for Pu storage at the PFP. Therefore, the existing storage areas within the PFP secure vaults will require modification. Other modifications will be performed on the 2736-ZB building complex to facilitate the installation and operation of the SPS
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis)
International Nuclear Information System (INIS)
Bolsunovsky, A.; Zotina, T.; Bondareva, L.
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241 Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241 Am is accumulated by Elodea biomass: the activity concentration of 241 Am can reach 3280 ± 240 Bq/g, with the concentration factor for 241 Am 16 600 ± 2200 l/kg. Results of chemical fractionation have proved that in the course of 241 Am accumulation by Elodea biomass, 241 Am tightly bound to biomass increases from 11% to 27% of the total 241 Am in the biomass. Release of 241 Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241 Am activity and the rate of 241 Am release into the water environment reached 23 Bq/day
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis).
Bolsunovsky, A; Zotina, T; Bondareva, L
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241Am is accumulated by Elodea biomass: the activity concentration of 241Am can reach 3280+/-240 Bq/g, with the concentration factor for 241Am 16 600+/-2200l/kg. Results of chemical fractionation have proved that in the course of 241Am accumulation by Elodea biomass, 241Am tightly bound to biomass increases from 11% to 27% of the total 241Am in the biomass. Release of 241Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241Am activity and the rate of 241Am release into the water environment reached 23 Bq/day.
International Nuclear Information System (INIS)
JANSKY, M.T.
1999-01-01
The following description and any attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste (WAC) 246-247, Radiation Protection-Air Emissions. The WAC 246-247-060, ''Applications, registration, and licensing'', states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of information listed in Appendix A.'' Appendix A (WAC 246-247-1 10) lists the requirements that must be addressed. Additionally, the following description, attachments and references are provided to the US Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40, Code of Federal Regulations (CFR), Part 61, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide greater than 0.1 millirem per year total effective dose equivalent (TEDE) to the hypothetical offsite maximally exposed individual (MEI), and commencement is needed within a short time. Therefore, this application also is intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(1), and it is requested that approval of this application also will constitute EPA acceptance of this initial startup notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2) will be provided at a later date. This NOC covers the activities associated with the Construction and operation activities involving the magnesium hydroxide precipitation process of plutonium solutions within the Plutonium Finishing Plant (PFP)
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Geisy, J P; Paine, D
1978-01-01
Algae and bacteria are important factors in the transport and mobilization of elements in the biosphere. These factors may be involved in trophic biomagnification, resulting in a potential human hazard or environmental degradation. Although americium, one of the most toxic elements known, is not required for plant growth, it may be concentrated by algae and bacteria. Therefore, the availability of americium-241 to algae and bacteria was studied to determine their role in the ultimate fate of this element released into the environment. Both algae and bacteria concentrated americium-241 to a high degree, making them important parts of the biomagnification process. The ability to concentrate americium-241 makes algae and bacteria potentially significant factors in cycling this element in the water column. (4 graphs, numerous references, 3 tables)
Sludge stabilization at the Plutonium Finishing Plant, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
1994-10-01
This Environmental Assessment evaluates the proposed action to operate two laboratory-size muffle furnaces in glovebox HC-21C, located in the Plutonium Finishing Plant (PFP), Hanford Site, Richland, Washington. The muffle furnaces would be used to stabilize chemically reactive sludges that contain approximately 25 kilograms (55 pounds) of plutonium by heating to approximately 500 to 1000 degrees C (900 to 1800 degrees F). The resulting stable powder, mostly plutonium oxide with impurities, would be stored in the PFP vaults. The presence of chemically reactive plutonium-bearing sludges in the process gloveboxes poses a risk to workers from radiation exposure and limits the availability of storage space for future plant cleanup. Therefore, there is a need to stabilize the material into a form suitable for long-term storage. This proposed action would be an interim action, which would take place prior to completion of an Environmental Impact Statement for the PFP which would evaluate stabilization of all plutonium-bearing materials and cleanout of the facility. However, only 10 percent of the total quantity of plutonium in reactive materials is in the sludges, so this action will not limit the choice of reasonable alternatives or prejudice the Record of Decision of the Plutonium Finishing Plant Environmental Impact Statement
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system
International Nuclear Information System (INIS)
Hill, L.F.
1997-01-01
This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors
Gamma ray spectrum of Am 241 in a backscattering geometry using a high purity germanium detector
International Nuclear Information System (INIS)
Chong Chon Sing; Ibrahim Salih Elyaseery; Ahmad Shukri Mustapa Kamal; Abdul Aziz Tajuddin
1997-01-01
In back scattering geometry using an annular Am-241 source and a HPGE detector has been set up to study both the coherent and incoherent scattering of photon emissions of Am-241 from medium-Z and high-Z elements. Besides the coherent and incoherent scattered peaks of the emissions from the source, the gamma ray spectrum from the different target elements obtained using a microcomputer based multichannel analyser showed the presence of several other peaks. These peaks have been identified to arise from the fluorescence of the targets, the fluorescence of the shielding material Pb, and also as fluorescence sum peaks and X-ray escape peaks of the detector material Ge. The spectra are presented for three target elements viz. Mo, Zn and W
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Reference: 241 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 241 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i Calderon-V...development of Arabidopsis thaliana. 9 2473-85 16024589 2005 Sep The Plant cell Bevan Mike|Calderon-Villalobos Luz I A|Dohmann Esther M N|Kuhnle Carola|Li Hanbing|Schwechheimer Claus
Artificial intelligence and distance learning philosophy in support of PfP mandate
Antoliš, Krunoslav
2003-01-01
Computers have long been utilised in the legal environment. The main use of computers however, has merely been to automate office tasks. More exciting is the prospect of using artificial intelligence (AI) technology to create computers that can emulate the substantive legal jobs performed by lawyers, to create computers that can autonomously reason with the law to determine legal solutions, for example: structuring and support of Partnership for Peace (PfP) mandate. Such attempts have not bee...
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HUBER HJ
2011-04-21
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2014-09-04
This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Accumulation and release of {sup 241}Am by a macrophyte of the Yenisei River (Elodea canadensis)
Energy Technology Data Exchange (ETDEWEB)
Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)]. E-mail: radecol@ibp.ru; Zotina, T. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation); Bondareva, L. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)
2005-07-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of {sup 241}Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that {sup 241}Am is accumulated by Elodea biomass: the activity concentration of {sup 241}Am can reach 3280 {+-} 240 Bq/g, with the concentration factor for {sup 241}Am 16 600 {+-} 2200 l/kg. Results of chemical fractionation have proved that in the course of {sup 241}Am accumulation by Elodea biomass, {sup 241}Am tightly bound to biomass increases from 11% to 27% of the total {sup 241}Am in the biomass. Release of {sup 241}Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial {sup 241}Am activity and the rate of {sup 241}Am release into the water environment reached 23 Bq/day.
Properties of the malarial proteins Pf2, Pf9 and PfP0, which support ...
Indian Academy of Sciences (India)
Properties of the malarial proteins Pf2, Pf9 and PfP0, which support their roles as immune targets. Antibodies raised to each of these proteins (or purified from immune adults) inhibit the growth of Plasmodium falciparum at the red cell invasion step. The proteins are localized on the parasite cell surface. Each protein is ...
INERT Atmosphere confinement operability test procedure
International Nuclear Information System (INIS)
RISENMAY, H.R.
1999-01-01
This Operability Test Procedure (OTP) provides instructions for testing operability of the Inert Atmosphere Confinement (IAC). The Inert Atmosphere Confinement was designed and built for opening cans of metal items that might have hydrided surfaces. Unreviewed Safety Question (USQ) PFP-97-005 addresses the discovery of suspected plutonium hydride forming on plutonium metal currently stored in the Plutonium Finishing Plant vaults. Plutonium hydride reacts quickly with air, liberating energy. The Inert Atmosphere Confinement was designed to prevent this sudden liberation of energy by opening the material in an inert argon atmosphere instead of the normal glovebox atmosphere. The IAC is located in glovebox HC-21A, room 230B of the 234-5Z Building at the Plutonium Finishing Plant (PFP) in the 200-West Area of the Hanford Site
241Am, 137Cs, Sr and Pb uptake by tobacco as influenced by application of Fe chelators to soil
International Nuclear Information System (INIS)
Fuhrmann, Mark; Lanzirotti, Antonio
2005-01-01
To determine the potential for phytoextraction of 241 Am and other contaminants from soil, accumulation of 241 Am, 137 Cs, Sr, Fe, Al, Pb, and Mg by tobacco was determined for soil applications of two concentrations of ethylenediaminetetraacetic acid (EDTA), citric acid, and ascorbic acid. In tobacco receiving EDTA at 3.1 mmol/kg of soil, 241 Am content of plants averaged 15 Bq/kg (ranging up to 26 Bq/kg) while Fe concentrations became constant at 4.5 mmol/kg. Soil treatment with 18.8 mmol/kg EDTA resulted in average 241 Am concentrations of 29 Bq/kg (19 times higher than controls). Uptake of Pb was similar to 241 Am. In these samples, Fe increased to a maximum of almost 18 mmol/kg and 241 Am content increased linearly with both Fe and Al. Plants receiving ascorbic and citric acids took up smaller quantities of 241 Am, Pb, and Fe, even though these reagents were able to elute about as much Fe from the soil as EDTA. Synchrotron microbeam X-ray fluorescence (SXRF) was used to determine radial distributions of elements in roots and stems with and without EDTA treatment. SXRF maps indicate differences in behavior between Fe and Pb that are consistent with the bulk plant observations and provide insight into changes in metal content of the roots in the presence of EDTA
Acceptance test procedure, 241-SY-101/241-C-106 shot loading system
International Nuclear Information System (INIS)
Ostrom, M.J.
1994-01-01
This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations
Resolution of USQ regarding source term in the 232-Z Waste Incinerator Building
International Nuclear Information System (INIS)
Westsik, G.A.
1995-09-01
The 232-Z Waste Incinerator at the Hanford Plutonium Finishing Plant (PFP) was used to incinerate plutonium-bearing combustible materials generated during normal plant operations. Nondestructive (NDA) measurements performed after the incinerator ceased operations indicated high plutonium loadings in exhaust ductwork near the incinerator glovebox, while the incinerator was found to have only low quantities. Measurements, following a campaign to remove some of the ductwork, resulted in markedly higher assay value for the incinerator glovebox itself. Subsequent assays confirmed the most recent results and pointed to a potential further underestimation of the holdup, in part because of attenuation due to fire brick, which could not be seen easily and which had been reported to not be present. NaI detector based measurements were used to map the deposits. Extended count times, using high resolution Ge detectors helped estimate the isotopic composition of the plutonium and quantify the deposits. Experiments were performed using a Ge detector to obtain adequate corrections for the high attenuation of the incinerator glovebox. Several neutron detectors and detector configurations were employed to understand and quantify the neutron flux. Due to the disparity that was anticipated to occur between the gamma ray and neutron assay results, radiation modeling was used to try to reconcile the divergent results. This was a third aspect of the team's effort, utilizing computer modeling to resolve discrepancies between measurement methods
International Nuclear Information System (INIS)
Duncan, J.B.; Huber, H.J.
2011-01-01
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code
International Nuclear Information System (INIS)
Antoniak, Z.I.; Recknagle, K.P.
1995-07-01
The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations
Addendum 2 to CSER 79-002: Extension of the 150 gram fissile limit used in room 187 of PFP
International Nuclear Information System (INIS)
Friar, D.E.
1994-01-01
The PFP operating organization requests that the limit set permitting 150 grams fissile be extended to the Hoods 4 and 5 of Room 187. The request for the limit change is explained in the attached request for analysis
24 CFR 241.1005 - Definitions.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
Energy Technology Data Exchange (ETDEWEB)
White, W.F.
1997-05-13
The purpose of this document is to provide the definition and means of maintaining the Safety Envelope (SE) related to the Criticality Alarm System (CAS). This document provides amplification of the Limiting Condition for Operation (LCO) described in the Plutonium Finishing Plant (PFP) Operational Safety Requirements (OSR), WHC-SD-CP-OSR-010, Rev. 0, 1994, Section 3.1.2, Criticality Detectors and Alarms. This document, with its appendices, provides the following: (1) System functional requirements for determining system operability (Section 3); (2) A list of annotated system block diagrams which indicate the safety envelope boundaries (Appendix C); (3) A list of the Safety Class 1 and 2 Safety Envelope (SC-1/2 SE) equipment for input into the Master Component Index (Appendix B); (4) Functional requirements for individual SC-1/2 SE components, including appropriate setpoints and process parameters (Section 6 and Appendix A); (5) A list of the operational, maintenance and surveillance procedures necessary to operate and maintain the SC-1/2 SE components as required by the LCO (Section 6 and Appendix A).
International Nuclear Information System (INIS)
RAMBLE, A.L.
2000-01-01
The purpose of this document is to record the technical evaluation of the Operational Safety Requirements described in the Plutonium Finishing Plant Final (PFP) Operational Safety Requirements, WHC-SD-CP-OSR-010. Rev. 0-N , Section 3.1.1, ''Criticality Prevention System.'' This document, with its appendices, provides the following: (1) The results of a review of Criticality Safety Analysis Reports (CSAR), later called Criticality Safety Evaluation Reports (CSER), and Criticality Prevention Specifications (CPS) to determine which equipment or components analyzed in the CSER or CPS are considered as one of the two unlikely, independent, and concurrent changes before a criticality accident is possible. (2) Evaluations of equipment or components to determine the safety boundary for the system (Section 4). (3) A list of essential drawings that show the safety system or component (Appendix A). (4) A list of the safety envelope (SE) equipment (Appendix B). (5) Functional requirements for the individual safety envelope equipment (Sections 3 and 4). (6) A list of the operational and surveillance procedures necessary to maintain the system equipment within the safety envelope (Section 5)
International Nuclear Information System (INIS)
White, W.F.
1997-01-01
The purpose of this document is to provide the definition and means of maintaining the Safety Envelope (SE) related to the Criticality Alarm System (CAS). This document provides amplification of the Limiting Condition for Operation (LCO) described in the Plutonium Finishing Plant (PFP) Operational Safety Requirements (OSR), WHC-SD-CP-OSR-010, Rev. 0, 1994, Section 3.1.2, Criticality Detectors and Alarms. This document, with its appendices, provides the following: (1) System functional requirements for determining system operability (Section 3); (2) A list of annotated system block diagrams which indicate the safety envelope boundaries (Appendix C); (3) A list of the Safety Class 1 and 2 Safety Envelope (SC-1/2 SE) equipment for input into the Master Component Index (Appendix B); (4) Functional requirements for individual SC-1/2 SE components, including appropriate setpoints and process parameters (Section 6 and Appendix A); (5) A list of the operational, maintenance and surveillance procedures necessary to operate and maintain the SC-1/2 SE components as required by the LCO (Section 6 and Appendix A)
Multimode approach to Am-241 and Np-237 fission induced by 660-MeV protons
Czech Academy of Sciences Publication Activity Database
Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.; Adam, Jindřich
2009-01-01
Roč. 72, č. 6 (2009), s. 911-916 ISSN 1063-7788 R&D Projects: GA MŠk(CZ) LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : FISSION * Am-241 * Np-237 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.539, year: 2009
Fire hazard analysis for Plutonium Finishing Plant complex
International Nuclear Information System (INIS)
MCKINNIS, D.L.
1999-01-01
A fire hazards analysis (FHA) was performed for the Plutonium Finishing Plant (PFP) Complex at the Department of Energy (DOE) Hanford site. The scope of the FHA focuses on the nuclear facilities/structures in the Complex. The analysis was conducted in accordance with RLID 5480.7, [DOE Directive RLID 5480.7, 1/17/94] and DOE Order 5480.7A, ''Fire Protection'' [DOE Order 5480.7A, 2/17/93] and addresses each of the sixteen principle elements outlined in paragraph 9.a(3) of the Order. The elements are addressed in terms of the fire protection objectives stated in paragraph 4 of DOE 5480.7A. In addition, the FHA also complies with WHC-CM-4-41, Fire Protection Program Manual, Section 3.4 [1994] and WHC-SD-GN-FHA-30001, Rev. 0 [WHC, 1994]. Objectives of the FHA are to determine: (1) the fire hazards that expose the PFP facilities, or that are inherent in the building operations, (2) the adequacy of the fire safety features currently located in the PFP Complex, and (3) the degree of compliance of the facility with specific fire safety provisions in DOE orders, related engineering codes, and standards
International Nuclear Information System (INIS)
HILL, J.S.
2000-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product
Radioactive waste management plan for the PBMR (Pty) Ltd fuel plant
International Nuclear Information System (INIS)
Makgae, Mosidi E.
2009-01-01
The Pebble Bed Modular Reactor (Pty) Ltd Fuel Plant (PFP) radioactive waste management plan caters for waste from generation, processing through storage and possible disposal. Generally, the amount of waste that will be generated from the PFP is Low and Intermediate Level Waste. The waste management plan outlines all waste streams and the management options for each stream. It also discusses how the Plant has been designed to ensure radioactive waste minimisation through recycling, recovery, reuse, treatment before considering disposal. Compliance to the proposed plan will ensure compliance with national legislative requirements and international good practice. The national and the overall waste management objective is to ensure that all PFP wastes are managed appropriately by utilising processes that minimize, reduce, recover and recycle without exposing employees, the public and the environment to unacceptable impacts. Both International Atomic Energy Agency (IAEA) and Department of Minerals and Energy (DME) principles act as a guide in the development of the strategy in order to ensure international best practice, legal compliance and ensuring that the impact of waste on employees, environment and the public is as low as reasonably achievable. The radioactive waste classification system stipulated in the Radioactive Waste Management Policy and Strategy 2005 will play an important role in classifying radioactive waste and ensuring that effective management is implemented for all waste streams, for example gaseous, liquid or solid wastes.
Peak pressures from hydrogen deflagrations in the PFP thermal stabilization glovebox
International Nuclear Information System (INIS)
Van Keuren, J.C.
1998-01-01
This document describes the calculations of the peak pressures due to hydrogen deflagrations in the glovebox used for thermal stabilization (glovebox HC-21A) in PFP. Two calculations were performed. The first considered the burning of hydrogen released from a 7 inch Pu can in the Inert Atmosphere Confinement (IAC) section of the glovebox. The peak pressure increase was 12400 Pa (1.8 psi). The second calculation considered burning of the hydrogen from 25 g of plutonium hydride in the airlock leading to the main portion of the glovebox. Since the glovebox door exposes most of the airlock when open, the deflagration was assumed to pressurize the entire glovebox. The peak pressure increase was 3860 Pa (0.56 psi)
The PBMR fuel plant: Proven technology in an advanced safety environment
International Nuclear Information System (INIS)
Braehler, G.; Froschauer, K.; Welbers, P.; Boyes, D.
2008-01-01
The PBMR Fuel Plant (PFP), to be constructed at the Pelindaba site near Johannesburg will fuel the first South African Pebble Bed Modular Reactor. The qualification of the PBMR fuel shall be based on past experience with fuel which was produced in the German NUKEM/HOBEG plant and irradiated in the German AVR reactor. Accordingly, the PFP must produce the same fuel as the German plant did, and consequently, the design of the PFP has in essence to be a copy of the NUKEM/HOBEG plant. As a reminder this plant had been operated in accordance with the German regulatory rules which were defined in the years 1970/80. Since then, the requirements with regard to radiological protection, criticality safety and emission control have been significantly tightened, and of course the PFP must be designed in accordance with the most advanced international norms and standards. The implications which follow from these two potentially conflicting requirements, as defined above, are highlighted, and technical solutions are presented. Hence, the change from administrative criticality safety control to technical control, i.e. the application of safe geometry as far as possible. and the introduction of technical solutions for the remaining safe mass regime will be described. A lot of equipment in the Kernel area and in the recycling areas needed to be redesigned in safe geometry. The sensitive processes for Kernel Calcining, for the Coating and the Over-coating remain under safe mass regime, but the safety against criticality is completely independent from staff activities and based on technical measures. A new concept for safe storage of large volumes of Uranium-containing liquids has been developed. Also, the change from relatively open handling of Uranium to the application of containment enclosures wherever release of radioactivity into the room atmosphere is possible, will be addressed. This change required redesign of all process steps requiring the handling of dry Uranium oxides
Directory of Open Access Journals (Sweden)
Kihara Daisuke
2010-05-01
Full Text Available Abstract Background A new paradigm of biological investigation takes advantage of technologies that produce large high throughput datasets, including genome sequences, interactions of proteins, and gene expression. The ability of biologists to analyze and interpret such data relies on functional annotation of the included proteins, but even in highly characterized organisms many proteins can lack the functional evidence necessary to infer their biological relevance. Results Here we have applied high confidence function predictions from our automated prediction system, PFP, to three genome sequences, Escherichia coli, Saccharomyces cerevisiae, and Plasmodium falciparum (malaria. The number of annotated genes is increased by PFP to over 90% for all of the genomes. Using the large coverage of the function annotation, we introduced the functional similarity networks which represent the functional space of the proteomes. Four different functional similarity networks are constructed for each proteome, one each by considering similarity in a single Gene Ontology (GO category, i.e. Biological Process, Cellular Component, and Molecular Function, and another one by considering overall similarity with the funSim score. The functional similarity networks are shown to have higher modularity than the protein-protein interaction network. Moreover, the funSim score network is distinct from the single GO-score networks by showing a higher clustering degree exponent value and thus has a higher tendency to be hierarchical. In addition, examining function assignments to the protein-protein interaction network and local regions of genomes has identified numerous cases where subnetworks or local regions have functionally coherent proteins. These results will help interpreting interactions of proteins and gene orders in a genome. Several examples of both analyses are highlighted. Conclusion The analyses demonstrate that applying high confidence predictions from PFP
Wang, Xiao; Peng, Jian
2016-01-01
Benevolent leadership, a traditional Chinese leadership style generated under the influence of Confucianism, has been under growing discussion since its proposal. However, existing research has focused mainly on the consequences of benevolent leadership, and research probing into its antecedents is scarce. To fill such research gap, the current study aims to explore the effect of the congruence between implicit positive followership prototype (PFP) and explicit positive followership trait (PFT) on benevolent leadership. Polynomial regression combined with the response surface methodology was used to test the hypotheses herein. The results, based on a sample of 241 leader-follower dyads from four Chinese family firms, indicated the following: (1) benevolent leadership is higher when leader PFP is congruent with follower PFT than when they are incongruent; (2) in cases of congruence, benevolent leadership is higher when leader PFP and follower PFT are both high rather than low; (3) in the case of incongruence, there is no significant difference for the level of benevolent leadership in two scenarios: "low leader PFP - high follower PFT" and "high leader PFP - low follower PFT".
Sugimoto, Koichi; Matsui, Kenji; Iijima, Yoko; Akakabe, Yoshihiko; Muramoto, Shoko; Ozawa, Rika; Uefune, Masayoshi; Sasaki, Ryosuke; Alamgir, Kabir Md.; Akitake, Shota; Nobuke, Tatsunori; Galis, Ivan; Aoki, Koh; Shibata, Daisuke; Takabayashi, Junji
2014-01-01
Plants receive volatile compounds emitted by neighboring plants that are infested by herbivores, and consequently the receiver plants begin to defend against forthcoming herbivory. However, to date, how plants receive volatiles and, consequently, how they fortify their defenses, is largely unknown. In this study, we found that undamaged tomato plants exposed to volatiles emitted by conspecifics infested with common cutworms (exposed plants) became more defensive against the larvae than those exposed to volatiles from uninfested conspecifics (control plants) in a constant airflow system under laboratory conditions. Comprehensive metabolite analyses showed that only the amount of (Z)-3-hexenylvicianoside (HexVic) was higher in exposed than control plants. This compound negatively affected the performance of common cutworms when added to an artificial diet. The aglycon of HexVic, (Z)-3-hexenol, was obtained from neighboring infested plants via the air. The amount of jasmonates (JAs) was not higher in exposed plants, and HexVic biosynthesis was independent of JA signaling. The use of (Z)-3-hexenol from neighboring damaged conspecifics for HexVic biosynthesis in exposed plants was also observed in an experimental field, indicating that (Z)-3-hexenol intake occurred even under fluctuating environmental conditions. Specific use of airborne (Z)-3-hexenol to form HexVic in undamaged tomato plants reveals a previously unidentified mechanism of plant defense. PMID:24778218
International Nuclear Information System (INIS)
Biermans, Geert; Horemans, Nele; Vanhoudt, Nathalie; Vandenhove, Hildegarde; Saenen, Eline; Van Hees, May; Wannijn, Jean; Vangronsveld, Jaco; Cuypers, Ann
2015-01-01
Human activity has led to an increasing amount of radionuclides in the environment and subsequently to an increased risk of exposure of the biosphere to ionising radiation. Due to their high linear energy transfer, α-emitters form a threat to biota when absorbed or integrated in living tissue. Among these, 241 Am is of major concern due to high affinity for organic matter and high specific activity. This study examines the dose-dependent biological effects of α-radiation delivered by 241 Am at the morphological, physiological and molecular level in 14-day old seedlings of Arabidopsis thaliana after hydroponic exposure for 4 or 7 days. Our results show that 241 Am has high transfer to the roots but low translocation to the shoots. In the roots, we observed a transcriptional response of reactive oxygen species scavenging and DNA repair pathways. At the physiological and morphological level this resulted in a response which evolved from redox balance control and stable biomass at low dose rates to growth reduction, reduced transfer and redox balance decline at higher dose rates. This situation was also reflected in the shoots where, despite the absence of a transcriptional response, the control of photosynthesis performance and redox balance declined with increasing dose rate. The data further suggest that the effects in both organs were initiated in the roots, where the highest dose rates occurred, ultimately affecting photosynthesis performance and carbon assimilation. Though further detailed study of nutrient balance and 241 Am localisation is necessary, it is clear that radionuclide uptake and distribution is a major parameter in the global exposure effects on plant performance and health. - Highlights: • Arabidopsis thaliana was exposed hydroponically to a range of 241 Am concentrations. • Effects at molecular, morphological and physiological level were observed. • Effects were dependent on both dose rate and 241 Am distribution.
Recovery of americium-241 from aged plutonium metal
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.
1980-12-01
About 5 kg of ingrown 241 Am was recovered from 850 kg of aged plutonium using a process developed specifically for Savannah River Plant application. The aged plutonium metal was first dissolved in sulfamic acid. Sodium nitrite was added to oxidize the plutonium to Pu(IV) and the residual sulfamate ion was oxidized to nitrogen gas and sulfate. The plutonium and americium were separated by one cycle of solvent extraction. The recovered products were subsequently purified by cation exchange chromatography, precipitated as oxalates, and calcined to the oxides. Plutonium processng was routine. Before cation exchange purification, the aqueous americium solution from solvent extraction was concentrated and stripped of nitric acid. More than 98% of the 241 Am was then recovered from the cation exchange column where it was effectively decontaminated from all major impurities except nickel and chromium. This partially purified product solution was concentrated further by evaporation and then denitrated by reaction with formic acid. Individual batches of americium oxalate were then precipitated, filtered, washed, and calcined. About 98.5% of the americium was recovered. The final product purity averaged 98% 241 AmO 2 ; residual impurities were primarily lead and nickel
International Nuclear Information System (INIS)
1985-03-01
The second Sub-Committee on Zircaloy Analysis was organized in April 1978, under the Committee on Analytical Chemistry on Nuclear Fuels and Reactor Materials, JAERI, for the renewal of zirconium and zirconium base alloy certified reference materials (CRMs). The Sub-Committee carried out collaborative analysis among 13 participating laboratories for the certification of the CRMs, JAERI-Z11 to Z18, after development, improvement and evaluation of analytical methods during the period of May 1978 to June 1982. As the result of the collaborative analysis, the certified value was given for 18 elements (Sn, Fe, Ni, Cr, B, Cd, U, Cu, Co, Mn, Pb, Al, Ti, Si, Mo, W, Hf, C) in the CRMs. The first part of this report includes general discussion, the second part principles of certification, the third part development and verification of analytical methods, and the fourth part evaluation of analytical results on 17 elements. Preparation of Z11 to Z18, and certification for carbon in JAERI-Z17 and Z18 were reported separately in JAERI-M 83-241 and M 83-035, respectively. (author)
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...
International Nuclear Information System (INIS)
Mangeng, C.A.; Thayer, G.R.
1984-05-01
This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues
Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
PFP Commercial Grade Food Pack Cans for Plutonium Handling and Storage Critical Characteristics
International Nuclear Information System (INIS)
BONADIE, E.P.
1999-01-01
This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for PFP's Vault Operations system as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to perform its safety function. The changes in these specifications have no detrimental effect on the descriptions and parameters related to handling plutonium solids in the authorization basis. Because no parameters or sequences exceed the limits described in the authorization bases, no accident or abnormal conditions are affected. The specifications prescribed in this critical characteristics document do not represent an unreviewed safety question
In situ measurement of low-Z material coating thickness on high Z substrate for tokamaks
Energy Technology Data Exchange (ETDEWEB)
Mueller, D., E-mail: dmueller@pppl.gov; Roquemore, A. L.; Jaworski, M.; Skinner, C. H.; Miller, J.; Creely, A. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States); Raman, P.; Ruzic, D. [Department of Nuclear, Plasma, and Radiological Engineering, Center for Plasma Material Interaction, University of Illinois, Urbana, Illinois 61801 (United States)
2014-11-15
Rutherford backscattering of energetic particles can be used to determine the thickness of a coating of a low-Z material over a heavier substrate. Simulations indicate that 5 MeV alpha particles from an {sup 241}Am source can be used to measure the thickness of a Li coating on Mo tiles between 0.5 and 15 μm thick. Using a 0.1 mCi source, a thickness measurement can be accomplished in 2 h of counting. This technique could be used to measure any thin, low-Z material coating (up to 1 mg/cm{sup 2} thick) on a high-Z substrate, such as Be on W, B on Mo, or Li on Mo. By inserting a source and detector on a moveable probe, this technique could be used to provide an in situ measurement of the thickness of Li coating on NSTX-U Mo tiles. A test stand with an alpha source and an annular solid-state detector was used to investigate the measurable range of low-Z material thicknesses on Mo tiles.
International Nuclear Information System (INIS)
CHARBONEAU, S.L.
2006-01-01
The Plutonium Finishing Plant (PFP) was constructed as part of the Manhattan Project during World War II. The Manhattan Project was developed to usher in the use of nuclear weapons to end the war. The primary mission of the PFP was to provide plutonium used as special nuclear material (SNM) for fabrication of nuclear devices for the war effort. Subsequent to the end of World War II, the PFP's mission expanded to support the Cold War effort through plutonium production during the nuclear arms race and later the processing of fuel grade mixed plutonium-uranium oxide to support DOE's breeder reactor program. In October 1990, at the close of the production mission for PFP, a shutdown order was prepared by the Department of Energy (DOE) in Washington,; DC--and issued to the Richland DOE field office. Subsequent to the shutdown order, a team from the Defense Nuclear Facilities Safety Board (DNFSB) analyzed the hazards at PFP associated with the continued storage of certain forms of plutonium solutions and solids. The assessment identified many discrete actions that were required to stabilize the different plutonium forms into stable form and repackage the material in high integrity containers. These actions were technically complicated and completed as part of the PFP nuclear material stabilization project between 1995 and early 2005. The completion of the stabilization project was a necessary first step in deactivating PFP. During stabilization, DOE entered into negotiations with the U.S. Environmental Protection Agency (EPA) and the State of Washington and established milestones for the Deactivation and Decommissioning (DandD) of the PFP. The DOE and its contractor, Fluor Hanford (Fluor), have made great progress in deactivating, decontaminating and decommissioning the PFP at the Hanford Site as detailed in this paper. Background information covering the PFP DandD effort includes descriptions of negotiations with the State of Washington concerning consent
Fire hazard analysis for Plutonium Finishing Plant complex
Energy Technology Data Exchange (ETDEWEB)
MCKINNIS, D.L.
1999-02-23
A fire hazards analysis (FHA) was performed for the Plutonium Finishing Plant (PFP) Complex at the Department of Energy (DOE) Hanford site. The scope of the FHA focuses on the nuclear facilities/structures in the Complex. The analysis was conducted in accordance with RLID 5480.7, [DOE Directive RLID 5480.7, 1/17/94] and DOE Order 5480.7A, ''Fire Protection'' [DOE Order 5480.7A, 2/17/93] and addresses each of the sixteen principle elements outlined in paragraph 9.a(3) of the Order. The elements are addressed in terms of the fire protection objectives stated in paragraph 4 of DOE 5480.7A. In addition, the FHA also complies with WHC-CM-4-41, Fire Protection Program Manual, Section 3.4 [1994] and WHC-SD-GN-FHA-30001, Rev. 0 [WHC, 1994]. Objectives of the FHA are to determine: (1) the fire hazards that expose the PFP facilities, or that are inherent in the building operations, (2) the adequacy of the fire safety features currently located in the PFP Complex, and (3) the degree of compliance of the facility with specific fire safety provisions in DOE orders, related engineering codes, and standards.
Auto-acetylation on K289 is not essential for HopZ1a-mediated plant defense suppression
Directory of Open Access Journals (Sweden)
Jose Sebastian Rufian
2015-07-01
Full Text Available The Pseudomonas syringae type III-secreted effector HopZ1a is a member of the HopZ / YopJ superfamily of effectors that triggers immunity in Arabidopsis. We have previously shown that HopZ1a suppresses both local (effector-triggered immunity, ETI and systemic immunity (systemic acquired resistance, SAR triggered by the heterologous effector AvrRpt2. HopZ1a has been shown to possess acetyltransferase activity, and this activity is essential to trigger immunity in Arabidopsis. HopZ1a acetyltransferase activity has been reported to require the auto-acetylation of the effector on a specific lysine (K289 residue. In this paper we analyze the relevance of autoacetylation of lysine residue 289 in HopZ1a ability to suppress plant defenses, and on the light of the results obtained, we also revise its relevance for HopZ1a avirulence activity. Our results indicate that, while the HopZ1aK289R mutant is impaired to some degree in its virulence and avirulence activities, is by no means phenotypically equivalent to the catalytically inactive HopZ1aC216A, since it is still able to trigger a defense response that induces detectable macroscopic HR and effectively protects Arabidopsis from infection, reducing growth of P. syringae within the plant. We also present evidence that the HopZ1aK289R mutant still displays virulence activities, partially suppressing both ETI and SAR.
System Description for Tank 241-AZ-101 Waste Retrieval Data Acquisition System
International Nuclear Information System (INIS)
ROMERO, S.G.
2000-01-01
The proposed activity provides the description of the Data Acquisition System for Tank 241-AZ-101. This description is documented in HNF-5572, Tank 241-AZ-101 Waste Retrieval Data Acquisition System (DAS). This activity supports the planned mixer pump tests for Tank 241-AZ-101. Tank 241-AZ-101 has been selected for the first full-scale demonstration of a mixer pump system. The tank currently holds over 960,000 gallons of neutralized current acid waste, including approximately 12.7 inches of settling solids (sludge) at the bottom of the tank. As described in Addendum 4 of the FSAR (LMHC 2000a), two 300 HP mixer pumps with associated measurement and monitoring equipment have been installed in Tank 241-AZ-101. The purpose of the Tank 241-AZ-101 retrieval system Data Acquisition System (DAS) is to provide monitoring and data acquisition of key parameters in order to confirm the effectiveness of the mixer pumps utilized for suspending solids in the tank. The suspension of solids in Tank 241-AZ-101 is necessary for pretreatment of the neutralized current acid waste and eventual disposal as glass via the Hanford Waste Vitrification Plant. HNF-5572 provides a basic description of the Tank 241-AZ-101 retrieval system DAS, including the field instrumentation and application software. The DAS is provided to fulfill requirements for data collection and monitoring. This document is not an operations procedure or is it intended to describe the mixing operation. This USQ screening provides evaluation of HNF-5572 (Revision 1) including the changes as documented on ECN 654001. The changes include (1) add information on historical trending and data backup, (2) modify DAS I/O list in Appendix E to reflect actual conditions in the field, and (3) delete IP address in Appendix F per Lockheed Martin Services, Inc. request
International Nuclear Information System (INIS)
Lee, Ki-Man; Kim, Eun-Hee
2015-01-01
The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV
Wang, Xiao; Peng, Jian
2016-01-01
Benevolent leadership, a traditional Chinese leadership style generated under the influence of Confucianism, has been under growing discussion since its proposal. However, existing research has focused mainly on the consequences of benevolent leadership, and research probing into its antecedents is scarce. To fill such research gap, the current study aims to explore the effect of the congruence between implicit positive followership prototype (PFP) and explicit positive followership trait (PFT) on benevolent leadership. Polynomial regression combined with the response surface methodology was used to test the hypotheses herein. The results, based on a sample of 241 leader–follower dyads from four Chinese family firms, indicated the following: (1) benevolent leadership is higher when leader PFP is congruent with follower PFT than when they are incongruent; (2) in cases of congruence, benevolent leadership is higher when leader PFP and follower PFT are both high rather than low; (3) in the case of incongruence, there is no significant difference for the level of benevolent leadership in two scenarios: “low leader PFP – high follower PFT” and “high leader PFP – low follower PFT”. PMID:27375514
40 CFR 436.241 - Specialized definitions.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...
Energy Technology Data Exchange (ETDEWEB)
Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)
1965-10-15
The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author
International Nuclear Information System (INIS)
Ingle, S.J.
1996-03-01
This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility
Americium-241 in bile and feces
International Nuclear Information System (INIS)
LoSasso, T.; Cohen, N.; Wrenn, M.E.
1977-01-01
In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route
49 CFR 241.17 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...
10 CFR 600.241 - Financial reporting.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...
12 CFR 335.241 - Unlisted trading.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...
42 CFR 413.241 - Pharmacy arrangements.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
Am-241 buildup in nematode organisms
International Nuclear Information System (INIS)
Martyushov, V.Z.; Tarasov, O.V.
1990-01-01
The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped
International Nuclear Information System (INIS)
Miller, E.M.
1994-01-01
The Plutonium Finishing Plant (PFP) is installing security bars on plutonium storage racks in Room 3 in 2736-Z Building to meet International Atomic Energy Agency (IAEA) material control requirements. Figures show the existing arrangement and design of the security bars. The security bars are to be fabricated of aluminum or carbon steel. The detailed fabrication sketches are reproduced in Appendix C. The security bars are to be installed close to the chains of plutonium so a determination of their effect on criticality safety needs to be made. The addition of security bars to the storage array of 2.5 kg plutonium buttons in Room 3 can effect reactivity by reflecting neutrons back into the plutonium in the storage cans, by absorbing neutrons, and by moderating neutrons between stored plutonium buttons. The small amount of metal added by the storage bars in comparison to the amount of concrete in the walls and aluminum in the shelf monitors already in place would not significantly increase the k eff of the storage array. Several computer calculations in previous analyses show that the security bars will have a negligible affect on reactivity
Monitoring plan for borehole logging at 216-Z-1A Tile Field, 216-Z-9 Trench, and 216-Z-12 Crib
International Nuclear Information System (INIS)
Horton, D.G.
1998-04-01
This plan describes the fiscal year 1998 vadose monitoring of three inactive, liquid waste disposal facilities associated with the Plutonium Finishing Plant (Z-Plant): the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib. Monitoring will consist of spectral gamma ray logging of 21 boreholes. This plan describes the physical characteristics of the facilities, their operational histories, the subsurface geology and known contamination distribution at each facility. The plan then describes the specific monitoring to be done including the boreholes to be logged, the methods of data acquisition, data reduction, and data evaluation, and finally, the quality control, data management and data reporting for this effort. The three liquid waste disposal facilities at the Z Plant were chosen to be monitored because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford vadose zone. Johnson's analysis was based on the relative hazard obtained by combining curie quantities disposed to the facilities with appropriate health risk standards. The basic question to be addressed by this logging activity addresses the configuration of subsurface contamination since it was last measured. Historical data from the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib form the baseline for comparisons to answer this question
Determination of 241Am in reindeer bone
International Nuclear Information System (INIS)
Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.
1978-01-01
The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden
Biosorption of americium-241 by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali
2003-01-01
As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
International Nuclear Information System (INIS)
BLACKER, S.M.
2000-01-01
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
Energy Technology Data Exchange (ETDEWEB)
BLACKER, S.M.
2000-04-13
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.
International Nuclear Information System (INIS)
Crawford, B.A.
1996-01-01
This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined
Effects of the herbicide glyphosate on the uptake of 239Pu and 241Am to vegetation
International Nuclear Information System (INIS)
Nisbet, A.F.; Shaw, S.
1990-01-01
Glyphosate (n-phosphonomethyl glycine) is a broad spectrum herbicide widely used in lowland agriculture, forestry and improved upland pastures. Although its metal chelating properties are well established, its interaction with radionuclides remains unknown. A pot experiment was conducted to determine the effect of soil applications of glyphosate on the uptake of 239 Pu and 241 Am to peas and carrots grown in loam, peat and sand soils. Soil-to-plant transfer factors were calculated for treated and untreated soils at harvest. The most marked effect was an increase in 241 Am uptake to crops grown in loam soil. Supplementary laboratory batch experiments were conducted by shaking radiolabelled soil and its associated soil solution with glyphosate. The activity concentration of 241 Am increased ten fold in the liquid phase of loam soils treated with glyphosate. It is postulated that this 241 Am desorption could have been mediated by the formation of a stable Am-glyphosate complex which was subsequently more available for crop uptake than Am alone. (author)
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
Kalytczak, Marcelo Martins; Lucareli, Paulo Roberto Garcia; Dos Reis, Amir Curcio; Bley, André Serra; Biasotto-Gonzalez, Daniela Aparecida; Correa, João Carlos Ferrari; Politti, Fabiano
2018-04-07
This study aimed to compare the concentric and eccentric activity and the temporal order of peak activity of the hip and knee muscles between women with patellofemoral pain (PFP) and healthy women during the single leg triple hop test (SLTHT). Electromyographic (EMG) and Kinematic data were collected from 14 healthy women (CG) and 14 women diagnosed with PFP (PFG) during a single session of the single leg triple hop test. Integral surface electromyography (iEMG) data of the hip and knee muscles in eccentric and concentric phases and the length of time that each muscle needed to reach the maximal peak of muscle activity were calculated. The iEMG in the eccentric phase was significantly higher (p < 0.05) than the concentric phase, for the gluteus maximus and gluteus medius muscles (CG and PFG) and for the vastus lateralis muscle (PFG). The vastus lateralis muscle was the first muscle to reach the highest peak of activity in the PFG, and the third to reach this peak in the CG. In the present study, the activity of the vastus lateralis muscle during the eccentric phase of the jump was greater than concentric phase, as a temporal anticipation of its peak in activity among women with PFP. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Charboneau, S.; Klos, B.; Heineman, R.; Skeels, B.; Hopkins, A.
2006-01-01
The Plutonium Finishing Plant (PFP) consists of a number of process and support buildings for handling plutonium. Building construction began in the late 1940's to meet national priorities and became operational in 1950 producing refined plutonium salts and metal for the United States nuclear weapons program The primary mission of the PFP was to provide plutonium used as special nuclear material for fabrication into a nuclear device for the war effort. Subsequent to the end of World War II, the PFP's mission expanded to support the Cold War effort through plutonium production during the nuclear arms race. PFP has now completed its mission and is fully engaged in deactivation, decontamination and decommissioning (D and D). At this time the PFP buildings are planned to be reduced to ground level (slab-on-grade) and the site remediated to satisfy national, Department of Energy (DOE) and Washington state requirements. The D and D of a highly contaminated plutonium processing facility presents a plethora of challenges. PFP personnel approached the D and D mission with a can-do attitude. They went into D and D knowing they were facing a lot of challenges and unknowns. There were concerns about the configuration control associated with drawings of these old process facilities. There were unknowns regarding the location of electrical lines and the condition and contents of process piping containing chemical residues such as strong acids and caustics. The gloveboxes were highly contaminated with plutonium and chemical residues. Most of the glovebox windows were opaque with splashed process chemicals that coated the windows or etched them, reducing visibility to near zero. Visibility into the glovebox was a serious worker concern. Additionally, all the gloves in the gloveboxes were degraded and unusable. Replacing gloves in gloveboxes was necessary to even begin glovebox clean-out. The sheer volume of breathing air needed was also an issue. These and other challenges and PFP
International Nuclear Information System (INIS)
McDowell, M.W.
1995-01-01
A historical discussion of the technology used in South Africa for the enrichment of uranium, as well as other technological spin-offs for the country that followed from the construction of the Z-plant. The national energy strategy and objectives of the government during the Apartheid years resulted in the development of several large-scale energy projects. The pressure of sanctions forced the Z-plant to be rushed into operation at an uneconomical capacity of 250 000 SWU per annum. In 1994 this implied that enriched uranium was produced at a cost of $200 per SWU while the world market price was below $90. While the production of enriched uranium at the Z-plant ceased early in 1995, the expertise gained will not be lost entirely. As a result of the high energy and financial capital intensive current methods of producing enriched uranium, research started in the early 1970's into alternative production processes making use of lasers. South Africa has opted for the MLIS (molecular laser isotope separation) process, as a result of its vast experience gained from the Z-plant in the handling of the molecular input gas UF6 (uranium hexafluoride), and this has been under development since the early 1980's. During 1994 significant progress was made with MLIS, in particular with single-step enrichment from natural uranium to better than 4% uranium 235 on a macro scale. The Atomic Energy Corporation of South Africa's strategy is to licence the process internationally. 3 tabs., 3 figs
Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong
2018-02-01
Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which
Biosorption of americium-241 by immobilized Rhizopus arrihizus
International Nuclear Information System (INIS)
Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji
2004-01-01
Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2014-01-01
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)
2014-01-08
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Z plant aggregate area management study technical baseline report
International Nuclear Information System (INIS)
DeFord, D.H.; Carpenter, R.W.
1995-05-01
This document was prepared in support of the development of a Aggregate Area Management Study of Z Plant, 200 West Area, at the US Department of Energy (DOE) Hanford Site near Richland, Washington. It provides a technical description and operational history of the aggregate area and results from an environmental investigation undertaken by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (WHC) which is currently the Waste Site and Facility Research Office, Natural Resources, Bechtel Hanford, Inc. (BHI). It is based upon review and evaluation of numerous Hanford Site current and historical reports, drawings and photographs, supplemented with site inspections and employee interviews. No intrusive field investigations or sampling were conducted in support of this report
Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204
International Nuclear Information System (INIS)
Simpson, B.C.
1998-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center
Investigation of Tank 241-AN-101 Floating Solids
Energy Technology Data Exchange (ETDEWEB)
Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)
2017-10-30
Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.
Factors influencing the chemical extractability of 241Am from a contaminated soil
International Nuclear Information System (INIS)
Nishita, H.; Hamilton, M.
1976-01-01
Factors influencing the extractability of 241 Am from an artificially contaminated soil were investigated. This was done with an equilibrium batch technique using CH 3 COOH-NH 4 OH and HNO 3 -NaOH extracting systems. The influence of several soil components was determined indirectly by selectively removing them from the soil. The effect of water- and HCl-soluble salts and organic matter on 241 Am extractability was small. The most marked effect was due to the soil organic fraction that was not water- or HCl-soluble. This organic fraction was influential under both low and high pH conditions, but its influence was particularly marked under low pH conditions. The free iron-oxides had an appreciable effect under low pH conditions, but no observable effect in the high pH range. Though to a lesser extent, the free silica and alumina, amorphous alumino-silicate, and possibly residual organic matter also showed some influence. These results provide some implications on the conditions that influence the movement of 241 Am in soils and its availability to plants. A review of the literature on the behavior of Am in soils is included
24 CFR 241.1245 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.1245... Rights and Obligations § 241.1245 Insurance endorsement. (a) Endorsement. The Commissioner shall indicate his insurance of the equity loan or acquisition loan by endorsing the original credit instrument and...
Standardization of method to determine 241Pu in urine samples by liquid scintillation analyzer
International Nuclear Information System (INIS)
Raveendran, Nanda; Rao, D.D.; Yadav, J.R.; Baburajan, A.
2015-01-01
As a part of radiation protection programme, occupational workers of fuel reprocessing plant are checked for internal contamination by analyzing urine samples periodically. Urine samples are analyzed to determine 239+240 Pu and 238 Pu by using standard conventional method and are counted by alpha spectrometry. 241 Pu is also one of the contaminant present in the urine sample of radiation workers. It is a low beta emitter with E max 21 keV. A methodology for the determination of this nuclide was standardized by using radiochemical analysis followed by Liquid Scintillation Counting. The method was tested and found suitable for the determination of 241 Pu in urine sample for the assessment of Committed Effective Dose (CED). (author)
Energy Technology Data Exchange (ETDEWEB)
Henner, P. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)]. E-mail: pascale.henner@irsn.fr; Colle, C. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France); Morello, M. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)
2005-07-01
Foliar transfer of {sup 241}Am, {sup 239,240}Pu, {sup 137}Cs and {sup 85}Sr was evaluated after contamination of bean plants (Phaseolus vulgaris) at the flowering development stage, by soaking their first two trifoliate leaves into contaminated solutions. Initial retentions of {sup 241}Am (27%) and {sup 239,240}Pu (37%) were higher than those of {sup 137}Cs and {sup 85}Sr (10-15%). Mean fraction of retained activity redistributed among bean organs was higher for {sup 137}Cs (20.3%) than for {sup 239,240}Pu (2.2%), {sup 241}Am (1%) or {sup 85}Sr (0.1%). Mean leaf-to-pod translocation factors (Bq kg{sup -1}dry weight pod/Bq kg{sup -1}dry weight contaminated leaves) were 5.0 x 10{sup -4} for {sup 241}Am, 2.7 x 10{sup -6} for {sup 239,240}Pu, 5.4 x 10{sup -2} for {sup 137}Cs and 3.6 x 10{sup -4} for {sup 85}Sr. Caesium was mainly recovered in pods (12.8%). Americium and strontium were uniformly redistributed among leaves, stems and pods. Plutonium showed preferential redistribution in oldest bean organs, leaves and stems, and very little redistribution in forming pods. Results for americium and plutonium were compared to those of strontium and caesium to evaluate the consistency of the attribution of behaviour of strontium to transuranium elements towards foliar transfer, based on translocation factors, as stated in two radioecological models, ECOSYS-87 and ASTRAL.
24 CFR 241.570 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.570... § 241.570 Insurance endorsement. (a) Initial endorsement. The Commissioner shall indicate his/her insurance of the mortgage by endorsing the original credit instrument and identifying the section of the Act...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
CSER 94-014: Storage of metal-fuel loaded EBR-II casks in concrete vault on PFP grounds
International Nuclear Information System (INIS)
Hess, A.L.
1994-01-01
A criticality safety evaluation is presented to permit EBR-2 spent fuel casks loaded with metallic fuel rods to be stored in an 8-ft diameter, cylindrical concrete vault inside the PFP security perimeter. The specific transfer of three casks with Pu alloy fuel from the Los Alamos Molten Plutonium Reactor Experiment from the burial grounds to the vault is thus covered. Up to seven casks may be emplaced in the casing with 30 inches center to center spacing. Criticality safety is assured by definitive packaging rules which keep the fissile medium dry and at a low effective volumetric density
Determination of plutonium-241 half-life by mass spectrometric measurement
International Nuclear Information System (INIS)
Hiyama, Takashi; Wada, Yukio; Onishi, Koichi
1982-01-01
Much data for Pu-241 half-life have been reported, but these values range from 13.8 years to 15.1 years depending on investigators. In order to define the half-life of Pu-241, the half-life was calculated by analyzing the mass spectrometry data obtained in the author's laboratory over the past six years on Plutonium Isotopic Standard Reference Materials prepared at the National Bureau of Standards (NBS). The sample used for this work consisted of SRM-947 and SRM-948 prepared at NBS. Before mass spectrometric analysis, the plutonium aliquot was separated from its Am-241 daughter by anion exchange chromatography, since Am-241 is not distinguished from Pu-241 in the mass spectrometer. 241 Pu/ 239 Pu and 241 Pu/ 240 Pu ratios were calculated from the values of mass spectrometric measurement. From the relation of log N to time, the half-life of Pu-241 was determined, based on the slope using a least squares fit. The half-life of Pu-241 was estimated to be 14.29+-0.15 years. (Yoshitake, I.)
Distribution and Excretion of Am-241 in Rats
International Nuclear Information System (INIS)
Alatas, Z; Nurhayati, S; Rahardjo, T
1996-01-01
Determination of the activity content of Am-241 administered oral y in several organs and tissues of white rats including the excretion had been carried out. The observation of Am-241 activity was carried out through surgery and for the excretion of the radionuclide by collecting urine and faces. The surgeries were conducted on the 0 (6 hours), 1, 2, 3, 4, 5, 15 and 30th day post administration of 2.965 kBq Am-241, whereas the urine and faces collections were done every other day for 30 days using metabolism cage. The result indicated that the distribution of Am-241 which found in all tested organs/tissues with various fraction is considered as the initial distribution of Am-241 in rats. The content of americium in gastrointestinal tract and lung is relatively high within the first week post contamination. And, americium activities in other organs/tissues are various with time. The excretion of Am-241 is higher via feces than that of urin, i.e up to 20% in 30 days
Progress on z-pinch inertial fusion energy
International Nuclear Information System (INIS)
Olson, C.; Rochau, G.; Matzen, M.K.
2005-01-01
The goal of z-pinch inertial fusion energy (IFE) is to extend the single-shot z-pinch inertial confinement fusion (ICF) results on Z to a repetitive-shot z-pinch power plant concept for the economical production of electricity. Z produces up to 1.8 MJ of x-rays at powers as high as 230 TW. Recent target experiments on Z have demonstrated capsule implosion convergence ratios of 14-21 with a double-pinch driven target, and DD neutron yields up to 8x10exp10 with a dynamic hohlraum target. For z-pinch IFE, a power plant concept is discussed that uses high-yield IFE targets (3 GJ) with a low rep-rate per chamber (0.1 Hz). The concept includes a repetitive driver at 0.1 Hz, a Recyclable Transmission Line (RTL) to connect the driver to the target, high-yield targets, and a thick-liquid wall chamber. Recent funding by a U.S. Congressional initiative for $4M for FY04 is supporting research on RTLs, repetitive pulsed power drivers, shock mitigation, full RTL cycle planned experiments, high-yield IFE targets, and z-pinch power plant technologies. Recent results of research in all of these areas are discussed, and a Road Map for Z-Pinch IFE is presented. (author)
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
24 CFR 241.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 241.885 Section... § 241.885 Insurance benefits. (a) Method of payment. Payment of claims shall be made in the following... acceptable assignment of the note and security instrument to the Commissioner, the insurance benefits shall...
Z Plant source aggregate area management study report
International Nuclear Information System (INIS)
1992-10-01
The US Department of Energy (DOE) Hanford Site in Washington State is or into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989, included the 200 Areas of the Hanford Site on the National Priorities List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) of 1980. Inclusion on the NPL initiates the Remedial Investigation (RI) and Feasibility Study (FS) process for characterizing the nature and extent of contamination, assessing risks to human health and the environment, and selection of remedial actions. This report presents the insults of an aggregate area management study (AAMS) for the Z Plant Aggregate Area located m the 200 Areas. The study provides the basis for initiating RIIFS under CERCLA or under the Resource Conservation and Recovery Act (RCRA) Facility Investigations (RFI) and Corrective Measures Studies (CMS). This report also integrates RCRA treatment, storage, or disposed (TSD) closure activities with CERCLA and RCRA past-practice investigations
Sorption of 241Am by Aspergillus niger spore and hyphae
International Nuclear Information System (INIS)
Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao
2004-01-01
Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)
International Nuclear Information System (INIS)
Godoy, J.M.; Schuettelkopf, H.
1983-03-01
Although the concentration of Pu-241 in nuclear fuel to be reprocessed is high, there are only few results published about the emission of Pu-241 with gaseous and liquid effluents. Nearly no information is available, too, about the environmental contamination of nuclear installations by Pu-241. Therefore a procedure was developed to measure Pu-241 by liquid scintillation counting. Sample preparation was performed by electroplating of plutonium on stainless steel planchets. To correct the selfabsorption the linear dependence of counting efficiency in the liquid scintillation counter and the resolution in the α-spectrometer was used. (orig./HP) [de
24 CFR 241.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 241.805 Section... Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
Ash Stabilization Campaign Blend Plan
International Nuclear Information System (INIS)
Winstead, M.L.
1995-01-01
This Stabilization Blend Plan documents the material to be processed and the processing order for the FY95 Ash Stabilization Campaign. The primary mission of this process is to reduce the inventory of unstable plutonium bearing ash. The source of the ash is from Rocky Flats and the 232-Z incinerator at the Plutonium Finishing Plant (PFP). The ash is currently being stored in Room 235B and Vault 174 in building 234-5Z. The sludge is to be thermally stabilized in a glovebox in room 230A of the 234-5Z building and material handling for the process will be done in room 230B of the same building. The campaign is scheduled for approximately 12--16 weeks. A total of roughly 4 kg of Pu will be processed
Effect of americium-241 on luminous bacteria. Role of peroxides
Energy Technology Data Exchange (ETDEWEB)
Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)
2011-04-15
The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.
Accumulation of {sup 241}Am by suspended matter, diatoms and aquatic weeds of the Yenisei River
Energy Technology Data Exchange (ETDEWEB)
Zotina, T.A., E-mail: t_zotina@ibp.r [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Bolsunovsky, A.Ya.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation)
2010-02-15
In this work we experimentally estimated the capacities of the key components of the Yenisei River (Russia): particulate suspended matter (seston), diatom microalgae, and submerged macrophytes for accumulating {sup 241}Am from water. In our experiments large particles of seston (>8 mum), comparable in size with diatoms, took up most of americium from water. The accumulation of americium by isolated diatom algae (Asterionella formosa and Diatoma vulgare) was lower than by total seston. The concentration factors (CFs) of {sup 241}Am for seston of the Yenisei River in our experiments were (2.8-6.9).10{sup 5}; for diatoms - (1.5-4.2).10{sup 4}. The CFs for aquatic plant Elodea canadensis were within the same order of magnitude as those for diatoms. Activity concentration and CFs of {sup 241}Am were nearly the same in experiments under dark and light conditions. This is indicative of an energy independent mechanism of americium uptake from the water by diatoms and submerged macrophytes.
International Nuclear Information System (INIS)
King, C.M.; Bryan, S.A.
1999-01-01
This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature
24 CFR 241.1070 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...
Acceptance for Beneficial Use (ABU) Update for 241-AW-104 Waste Transfer Project
International Nuclear Information System (INIS)
MEWES, B.S.
2001-01-01
In October of 2000 an Engineering Task Plan (ETP), RPP-6869, was drafted to define objectives, document requirements, and define organizational responsibilities for the purpose of design installation and turnover of the 241-AW-104 Pump Replacement Project The ETP included an Acceptance for Beneficial Use (ABU) checklist, which delineated all tasks necessary to turn the 241-AW-104 Replaced Transfer Pump over to Operations, Maintenance, and Plant Engineering Signature approval of the respective Engineering Data Transmittal (EDT 630501) signified agreement that the ABU checklist was all-inclusive. In January 2001 an additional EDT (EDT 624153) was drafted to define completed ABU items, provide corresponding supporting documentation, and status open items in need of completion. This supporting document is to serve two purposes: (1) update ABU checklist items completed since January 2001, and (2) define remaining ABU checklist items in need of completion
Effect of gavaged chemical form of 241Am on its retention in mice
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1987-01-01
The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate
24 CFR 241.890 - Characteristics of debentures.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...
Vertical distribution of 241Pu in the southern Baltic Sea sediments
International Nuclear Information System (INIS)
Strumińska-Parulska, Dagmara I.
2014-01-01
Highlights: • The unique study on 241 Pu in sediments from the southern Baltic Sea was presented. • 241 Pu was determined using alpha spectrometry by indirect method. • The biggest amount of 241 Pu existed in the surface layers of all analyzed sediments. • The highest 241 Pu amount comes from the Chernobyl accident. - Abstract: The vertical distribution of plutonium 241 Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, 241 Pu/ 239+240 Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of 241 Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of 241 Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
International Nuclear Information System (INIS)
Doll, Stephanie R.; Bolling, Stacie D.
2016-01-01
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, ''Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.'' The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
Energy Technology Data Exchange (ETDEWEB)
Doll, Stephanie R. [Washington River Protection Solutions, Richland, WA (United States); Bolling, Stacie D. [Washington River Protection Solutions, Richland, WA (United States)
2016-07-14
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, “Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.” The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
24 CFR 241.1030 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 241... Loans-Eligibility Requirements § 241.1030 Mortgage insurance premiums. The lender, upon endorsement of the note, shall pay the Commissioner a first mortgage insurance premium equal to 0.5 percent of the...
Opavané jako vychovatelé šlechty z českých zemí na prahu novověku (1550-1620)
Czech Academy of Sciences Publication Activity Database
Holý, Martin
2009-01-01
Roč. 107, č. 4 (2009), s. 241-255 ISSN 0037-6833 R&D Projects: GA AV ČR KJB800150801 Institutional research plan: CEZ:AV0Z80150510 Keywords : nobility * preceptors * private education Subject RIV: AB - History
241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-25
This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.
24 CFR 241.830 - Definition of default.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...
International Nuclear Information System (INIS)
Oikawa, S.; Takata, H.
2015-01-01
The concentrations of 239+240 Pu, 241 Pu and 241 Am in the sediments at the coast of Japanese islands from 2008 to 2011 varied widely from one sampling site to another and were generally lower in sandy sediments at shallower sites, and higher in clayey sediments at deeper sites. In contrast, there seemed to be no temporal variation in the concentrations during the survey period. The 241 Am/ 239+240 Pu activity ratio was relatively higher than the global fallout presumably owing to the ingrowth of 241 Am from the ancestor, 241 Pu originating mainly from the hydrogen bomb explosion tests in the Marshall Islands in the 1950s. (author)
Single-Shell Tank (SST) Retrieval Project Plan for Tank 241-C-104 Retrieval
International Nuclear Information System (INIS)
DEFIGH PRICE, C.
2000-01-01
In support of the SST Interim Closure Project, Project W-523 ''Tank 241-C-104 Waste Retrieval System'' will provide systems for retrieval and transfer of radioactive waste from tank 241-C-104 (C-104) to the DST staging tank 241-AY-101 (AY-101). At the conclusion of Project W-523, a retrieval system will have been designed and tested to meet the requirements for Acceptance of Beneficial Use and been turned over to operations. Completion of construction and operations of the C-104 retrieval system will meet the recently proposed near-term Tri-Party Agreement milestone, M-45-03F (Proposed Tri-Party Agreement change request M-45-00-01A, August, 30 2000) for demonstrating limits of retrieval technologies on sludge and hard heels in SSTs, reduce near-term storage risks associated with aging SSTs, and provide feed for the tank waste treatment plant. This Project Plan documents the methodology for managing Project W-523; formalizes responsibilities; identifies key interfaces required to complete the retrieval action; establishes the technical, cost, and schedule baselines; and identifies project organizational requirements pertaining to the engineering process such as environmental, safety, quality assurance, change control, design verification, testing, and operational turnover
24 CFR 241.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...
241-AY/AZ waste storage tanks: Supplemental gravity load analysis. Volume 1
International Nuclear Information System (INIS)
Baliga, R.
1994-01-01
An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AY/AZ tanks and therefore, an interim analysis of the 241AY/AZ tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AY and 241AZ tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AY/AZ tanks; and to evaluate the effect of additional dome load on the 241AY/AZ tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENTS's additional scope of work is to perform a qualitative evaluation of the 241AY/AZ tanks for seismic and thermal loadings (Vollert 1982 and Blume 1971). This qualitative evaluation does not include any detailed finite element analysis of the tanks. The following design-based gravity loading conditions are used in this interim analysis of the 241AY/AZ tanks to determine a baseline for the tank stresses or section loads
24 CFR 241.560 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...
Speciation and bioavailability of Americium-241 in the fresh water environment
International Nuclear Information System (INIS)
Bierkens, J.
1986-01-01
Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics
International Nuclear Information System (INIS)
WHITE, W.F.
1999-01-01
The Emergency Evacuation and Notification System provides information to the Plutonium Finishing Plant (PFP) Building Emergency Director to assist in determining appropriate emergency response, notifies personnel of the required response, and assists in their response. The report identifies the equipment in the Safety Envelope (SE) for this System and the Administrative, Maintenance, and Surveillance Procedures used to maintain the SE Equipment
Tank characterization data report: Tank 241-C-112
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.
Tank characterization data report: Tank 241-C-112
International Nuclear Information System (INIS)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable
24 CFR 241.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...
8 CFR 241.3 - Detention of aliens during removal period.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Detention of aliens during removal period. 241.3 Section 241.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.3 Detention of...
International Nuclear Information System (INIS)
Vukanac, I.; Novkovic, D.; Djurasevic, M.; Obradovic, Z.; Kandi, A.
2006-01-01
The surface air samples collected in the first half of May 1986 at Vinca- Belgrade site were prepared and measured at the end of the 1991 and beginning of the 1992. year. Activity concentrations of the 137 Cs immediately after the Chernobyl accident were determined by means of gamma spectrometry, while the air activity concentration of 238 Pu and 239,240 Pu were determined by alpha spectrometry, after the plutonium radiochemical separation. The 236 Pu was used as a tracer. The same samples were remeasured after 13 years, during the 2004. The surface air activity concentrations of 241 Pu were estimated by a 241 Am in-growth method. The built up activities of 236 Pu progenies were determined from the recorded spectra and also calculated using the Bateman equations. The 241 Am activity in the remeasured samples, obtained by complex spectral analysis was confirmed by gamma spectrometry. The 241 Pu activity concentration in measured air samples ranged from 240 μBq/m3 to 7800 μBq/m3. The average activity concentration ratio 241 Pu/ 239,240 Pu originated from Chernobyl accident was approximately 100. (authors)
Hanford Single Shell Tank Leak Causes and Locations - 241-TX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, C. L.; Harlow, D> G.
2014-07-22
This document identifies 241-TX Tank Farm (TX Farm) leak causes and locations for the 100 series leaking tanks (241-TX-107 and 241-TX-114) identified in RPP-RPT-50870, Rev. 0, Hanford 241-TX Farm Leak Inventory Assessment Report. This document satisfies the TX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Biotransformation of PCBs by plants and bacteria - consequences of plant-microbe interactions
Czech Academy of Sciences Publication Activity Database
Macková, M.; Vrchotová, B.; Frančová, K.; Sylvestre, M.; Tomaniová, M.; Lovecká, P.; Demnerová, K.; Macek, Tomáš
2007-01-01
Roč. 43, č. 4 (2007), s. 233-241 ISSN 1164-5563 R&D Projects: GA MŠk(CZ) 1M0520 Grant - others:GA MŠk(CZ) 1P05ME745; GA MŠk(CZ) OC 117 Institutional research plan: CEZ:AV0Z40550506 Keywords : polichlorinated biphenyls * bioremediation * phytoremediation * rhizosphere Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.500, year: 2007
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
Shultz, M.V.
1999-01-01
Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
International Nuclear Information System (INIS)
WHITE, W.F.
1999-01-01
The Emergency Evacuation and Notification System provides information to the Plutonium Finishing Plant (PFP) Building Emergency Director to assist in determining appropriate emergency response, notifies personnel of the required response, and assists in their response. The report identifies the equipment in the Safety Envelope (SE) for this System and the Administrative, Maintenance, and Surveillance Procedures used to maintain the SE Equipment
CSER 00-001 Criticality Safety Evaluation Report for Cementation Operations at the PFP
Energy Technology Data Exchange (ETDEWEB)
DOBBIN, K.D.
2000-04-18
Glovebox HA-20MB is located in Room 235B of the 234-5Z Building at the Plutonium Finishing Plant. This enclosure contains mixers, mixer bowls, a crusher unit, an isolated inoperable conveyor unit, plutonium residue feed cans, cemented cans, and a feedwater container. Plutonium residue, not conducive to other forms of stabilization, is prepared for storage and ultimate disposal by cementation. The feed residue material cans can have plutonium contents of only a few grams or up to 200 grams. This evaluation accommodates this wide range of container fissile concentrations.
Placental transfer and distribution of 241Am in the rat
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1983-01-01
The placental transfer and distribution of 241 Am in the feto-placental system were studied in pregnant rats. Rats were injected intravenously with 241 Am citrate at 15 or 18 days of gestation. Groups injected at 15 days of gestation were sacrificed 2, 24, 48, or 120 hr after injection, and the group injected at 18 days was sacrificed 24 hr after. The radioactivities of 241 Am in fetus, fetal membrane, and placenta were determined, and its distribution in the feto-placental system was investigated by high-speed autoradiography using a silver-activated zinc sulfide-coated membrane as an intensifying screen. The deposition of 241 Am in feto-placenta units increased with the number of days of gestation. Results of autoradiography revealed that major deposition sites of 241 Am in the fetus are the skeleton and liver. Heavy deposition of 241 Am in the yolksac splanchnopleure and its existence in the exocoelom strongly suggest that the yolk sac placenta plays an important role in the placental transfer of this nuclide
Determination of 241Pu by low level β-proportional counting
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1992-01-01
A chemical separation procedure is described which allows the direct determination of low 241 Pu activities in environmental samples with a windowless gas-flow proportional counter. While current separation schemes based on anion exchange yield counting sources of sufficient purity for subsequent α-spectrometry, for β-counting of 241 Pu additional purification steps are required. A combination of anion exchange from 9 mol/1 HCl, LaF 3 precipitation and TTA extraction was found to be suitable even for analysis of long-range Chernobyl fallout samples which contained interfering radionuclides with β-activities at least 3 to 4 orders of magnitude higher than usually encountered. No difference is detectable between the results of the present, direct procedure and the results of the conventional indirect method based on the build-up of 241 Am. Average 241 Pu/ 239+241 Pu ratios in air and deposition samples taken at Neuherberg near Munich were 70±6 with the present procedure and 66±9 from 241 Am build-up. (author) 29 refs.; 3 tabs
International Nuclear Information System (INIS)
Guilmette, R.A.; Cohen, N.; Wrenn, M.E.
1975-01-01
Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)
Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data
International Nuclear Information System (INIS)
Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.
2004-01-01
This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material
CSER 01-008 Canning of Thermally Stabilized Plutonium Oxide Powder in PFP Glovebox HC-21A
International Nuclear Information System (INIS)
ERICKSON, D.G.
2001-01-01
This document presents the analysis performed to support the canning operation in HC-21A. Most of the actual analysis was performed for the operation in HC-18M and HA-20MB, and is documented in HNF-2707 Rev I a (Erickson 2001a). This document will reference Erickson (2001a) as necessary to support the operation in HC-21A. The plutonium stabilization program at the Plutonium Finishing Plant (PFP) uses heat to convert plutonium-bearing materials into dry powder that is chemically stable for long term storage. The stabilized plutonium is transferred into one of several gloveboxes for the canning process, Gloveboxes HC-18M in Room 228'2, HA-20MB in Room 235B, and HC-21A in Room 230B are to be used for this process. This document presents the analysis performed to support the canning operation in HC-21A. Most of the actual analysis was performed for the operation in HC-I8M and HA-20MB, and is documented in HNF-2707 Rev l a (Erickson 2001a). This document will reference Erickson (2001a) as necessary to support the operation in HC-21A. Evaluation of this operation included normal, base cases, and contingencies. The base cases took the normal operations for each type of feed material and added the likely off-normal events. Each contingency is evaluated assuming the unlikely event happens to the conservative base case. Each contingency was shown to meet the double contingency requirement. That is, at least two unlikely, independent, and concurrent changes in process conditions are required before a criticality is possible
5 CFR 838.241 - Cost-of-living adjustments.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...
The study of the migration of the radionuclide Am-241 in unsaturated soil from in Saligny area
International Nuclear Information System (INIS)
Toma, Alexandru Dan
2005-01-01
The functioning of the Cernavoda Nuclear Power Plant will generate low and medium radioactive waste contaminated with long-lived fission products (from U, Pu, Np, Am fission or decay), radioactive carbon (C-14) and tritium (H-3), which by their radiochemical characteristics and their influence upon the environment and people, request special attention regarding their storage and disposal. Based on the geological and mineralogical researches regarding the location of a repository for low and medium active waste, Saligny area near the Cernavoda Nuclear Power Plant was chosen. The repository will be located in loess, seated on sedimentary formations with insertions of clay patches. The main target of the research is to obtain some experimental data necessary for the evaluation of the migration of the radionuclide Am-241 (resulted from Cernavoda Nuclear Power Plant) in unsaturated soils in Saligny area, which will be the host of the Final Repository for Low and Medium Active Waste. The analysis of the test data obtained in the laboratory for the determination of the migration parameters of the radionuclide Am-241 in the material of the geological formation of Saligny area showed that there is a direct correlation between the values of these parameters and the basic mineralogical component - clay - of the soil sample. (author)
Multilevel resonance parameters of 241Pu
International Nuclear Information System (INIS)
Weston, L.W.; Todd, J.H.
1978-01-01
The data previously reported by the authors on the neutron fission and capture cross sections of 241 Pu were simultaneously fit with the Adler formalism to obtain multilevel resonance parameters. The neutron energy range of the fit was 0.01 to 100 eV. The 241 Pu cross sections in the resonance region of neutron energies are complex, and the Adler parameters present an efficient method of representing these cross sections, which are important for plutonium-fueled reactors. The parameters represent the data to an accuracy within the quoted experimental errors. 5 figures, 2 tables
Biosorption of radionuclide Americium-241 by A. niger spore and hyphae
International Nuclear Information System (INIS)
Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling
2002-01-01
The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident
40 CFR 51.241 - Nonattainment areas for carbon monoxide and ozone.
2010-07-01
... Intergovernmental Consultation Agency Designation § 51.241 Nonattainment areas for carbon monoxide and ozone. (a... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Nonattainment areas for carbon monoxide and ozone. 51.241 Section 51.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
Tank 241-T-201, core 192 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-08-07
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.
Tank 241-T-204, core 188 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-07-24
TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.
Tank 241-T-201, core 192 analytical results for the final report
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report
8 CFR 241.9 - Notice to transportation line of alien's removal.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.9...
8 CFR 241.10 - Special care and attention of removable aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special care and attention of removable aliens. 241.10 Section 241.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.10...
Decorporation of 241Am in beagles by DTPA
International Nuclear Information System (INIS)
Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.
1975-01-01
Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)
8 CFR 241.15 - Countries to which aliens may be removed.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Countries to which aliens may be removed. 241.15 Section 241.15 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.15 Countries to...
241-AY-101 Tank Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.
2013-08-26
This report provides the results of an extent of condition construction history review for tank 241-AY-101. The construction history of tank 241-AY-101 has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In tank 241-AY-101, the second double-shell tank constructed, similar issues as those with tank 241-AY-102 construction reoccurred. The overall extent of similary and affect on tank 241-AY-101 integrity is described herein.
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1996-01-01
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1996-01-25
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.
Behaviour of transuranic radionuclides in soils, plants and soil-plant system
International Nuclear Information System (INIS)
Vyas, B.N.; Mistry, K.B.
1996-01-01
The present paper reviews the investigations undertaken to elucidate the physicochemical, edaphic and physiological aspects of the behaviour of long-lived transuranic radionuclides 239 Pu and 241 Am in typical Indian soils and soil-plant systems. 23 refs
241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.
2013-11-19
This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.
International Nuclear Information System (INIS)
Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.
2012-12-01
This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)
International Nuclear Information System (INIS)
LAN, J.S.
2000-01-01
This Criticality Safety Evaluation Report analyzes the stabilization of plutonium/uranium solutions in Glovebox 3 using the magnesium hydroxide precipitation process at PFP. The process covered are the receipt of diluted plutonium solutions into three precipitation tanks, the precipitation of plutonium from the solution, the filtering of the plutonium precipitate from the solution, the scraping of the precipitate from the filter into boats, and the initial drying of the precipitated slurry on a hot plate. A batch (up to 2.5 kg) is brought into the glovebox as plutonium nitrate, processed, and is then removed in boats for further processing. This CSER establishes limits for the magnesium hydroxide precipitation process in Glovebox 3 to maintain criticality safety while handling fissionable material
International Nuclear Information System (INIS)
Lan, J.S.; Miller, E.M.; Toffer, H.; Mo, B.S.
2001-01-01
The Hanford Plutonium Finishing Plant (PFP) is currently in a waste cleanup and plutonium stabilization mode. Plutonium-bearing materials are processed through thermal treatment, creating forms of oxides suitable for long-term storage. Stabilized materials at PFP are stored in a variety of cans such as the bag-less transfer cans (BTCs), which are ultimately contained in the U.S. Department of Energy (DOE) 3013 can; both cans are larger than previously used plutonium storage containers and hold more plutonium. To compensate for the increased plutonium loadings, added engineered safety features were considered in the storage facilities. The vaults in PFP, subdivided into concrete-walled cubicles, will contain both new and older cans. The DOE 3013 and BTC cans may be loaded with up to 4.4 kg of plutonium as a compound (mostly oxide). New racks that store cans horizontally are being constructed to hold both new and older containers. The loading objective is to accommodate 70 kg of plutonium per cubicle. Two design analysis approaches for the new racks were considered. The first approach incorporated neutron absorption provided by the structural materials of the rack and the cans in determining a safe configuration. A rack loading arrangement was determined as shown in Fig. 1 and specified in Table I. This approach provides compliance with criticality control requirements; however, added administrative controls were needed to accommodate a sufficient number of cans in specific locations to achieve 70 kg of plutonium per cubicle. The 4.4-kg plutonium container can be placed only in predetermined locations. The second approach evaluated the addition of a fixed neutron absorber plate along the back wall of the cubicle (Fig. 1). The location of the special plate facilitates installation of the racks and provides additional criticality safety margin beyond the first approach. Its presence permits loading of racks with up to 4.4-kg plutonium cans in any storage locations
National low-level waste management program radionuclide report series, Volume 14: Americium-241
International Nuclear Information System (INIS)
Winberg, M.R.; Garcia, R.S.
1995-09-01
This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ( 241 Am). This report also includes discussions about waste types and forms in which 241 Am can be found and 241 Am behavior in the environment and in the human body
International Nuclear Information System (INIS)
NIRIDER, L.T.
2002-01-01
At the request of the Assistant Manager for Safety and Engineering, the U.S. Department of Energy Richland Operations Office (RL) Engineering Support Division, performed an oversight review of the Plutonium Finishing Plant (PFP) nuclear Criticality Alarm System (CAS). The review was conducted to satisfy requirements and agreements associated with Defense Nuclear Facility Safety Board (DNFSB) Recommendation 2000-2, ''Vital Safety Systems.'' The PFP is managed by Fluor Hanford, Inc. for RL. The field assessment and staff interviews were conducted August 12 through August 19,2002. This was a limited scope assessment that consisted of a review of the nuclear CAS operations, maintenance, and compliance with National Consensus Standards Requirements. The main purpose of the assessment was to determine the adequacy of the existing alarm system and its associated infrastructure to support the PFP facility mission through the remaining facility lifetime. The Review Plan was modeled upon Criteria and Review Approach Documents (CRAD) developed for DNFSB Recommendation 2000-2 reviews conducted across the Hanford Site. Concerns regarding component degradation and failure, increasing numbers of occurrence reports associated with the alarm system, and reliability issues were addressed. Additionally, RL performed a review of the engineering aspects of the CAS including the functions of design authorities and aspects of systems engineering. However, the focus of the assessment was on operations, maintenance, and reliability of the CAS, associated procurement practices, adequacy of safety and engineering policies and procedures, safety documentation, and fundamental engineering practices including training, qualification, and systems engineering. This assessment revealed that the PFP CAS and its associated infrastructure, administrative procedures, and conduct of operations are generally effective. There are no imminent criticality safety issues associated with the operation of the
Americium-241 in surface soil associated with the Hanford site and vicinity
International Nuclear Information System (INIS)
Price, K.R.; Gilbert, R.O.; Gano, K.A.
1981-05-01
Various kinds of surface soil samples were collected and analyzed for Americium-241 ( 241 Am) to examine the feasibility of improving soil sample data for the Hanford Surface Environmental Surveillance Program. Results do not indicate that a major improvement would occur if procedures were changed from the current practices. Conclusions from this study are somewhat tempered by the very low levels of 241 Am ( 241 Am in soil crust (0 to 1.0 cm deep) was greater than the corresponding subsurface layer (1.0 to 2.5 cm deep), and the average concentration of 241 Am in some onsite samples collected near the PUREX facility was greater than comparable samples collected 60 km upwind at an offsite location
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
SHULTZ, M.V.
1999-01-01
Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
Tank 241-T-203, core 190 analytical results for the final report
International Nuclear Information System (INIS)
Steen, F.H.
1997-01-01
This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report
Alpha spectrum analysis of 241Am in the urine
International Nuclear Information System (INIS)
Qiu Yongmei; Yang Yong
2006-10-01
With 241 Am as indicator, americium in the urine was concentrated by the method of codeposition, then it was purified by the method of anion exchange, at last, the americium was electroplated. 241 Am in the urine was analysed by six channel low level alpha measuring instrument and Alpha Spectrometer. The results show that the recovering ratio is beyond 60% under the condition that the indicator added to the urine is at the level of mBq. So, 241 Am in the urine can be quantitatively analysed by this method, uncertainty of the result is under 40%, detection limit of the instrument is under 10 -4 Bq. (authors)
Tripodi, KEJ.; Podesta, F. E.
1997-03-01
Pyrphosphate-dependent phosphofructokinase (PFP) was purified to electrophoretic homogeneity from illuminated pineapple (Ananas comosus) leaves. The purified enzyme consists of a single subunit of 61.5 kD that is immunologically related to the potato tuber PFP [beta] subunit. The native form of PFP likely consists of a homodimer of 97.2 kD, as determined by gel filtration. PFP's glycolytic activity was strongly dependent on pH, displaying a maximum at pH 7.7 to 7.9. Gluconeogenic activity was relatively constant between pH 6.7 and 8.7. Activation by Fru-2,6-bisphosphate (Fru-2,6-P2) was dependent on assay pH. In the glycolytic direction, it activated about 10-fold at pH 6.7, but only 2-fold at pH 7.7. The gluconeogenic reaction was only weakly affected by Fru-2,6-P2. The true substrates for the PFP forward and reverse reactions were Fru-6-phosphate and Mg-pyrophosphate, and Fru-1,6-P2, orthophosphate, and Mg2+, respectively. The results suggest that pineapple PFP displays regulatory properties consistent with a pH-based regulation of its glycolytic activity, in which a decrease in cytosolic pH caused by nocturnal acidification during Crassulacean acid metabolism, which could curtail its activity, is compensated by a parallel increase in its sensitivity to Fru-2,6-P2. It is also evident that the [beta] subunit alone is sufficient to confer PFP with a high catalytic rate and the regulatory properties associated with activation by Fru-2,6-P2.
Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-07-30
This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Hanford Single-Shell Tank Leak Causes and Locations - 241-A Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-09-10
This document identifies 241-A Tank Farm (A Farm) leak causes and locations for the 100 series leaking tanks (241-A-104 and 241-A-105) identified in RPP-ENV-37956, Hanford A and AX Farm Leak Assessment Report. This document satisfies the A Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
20 CFR 404.241 - 1977 simplified old-start method.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false 1977 simplified old-start method. 404.241... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.241 1977 simplified old-start method. (a) Who is qualified. To qualify for the old...
Riser configuration, Tank 241-A-105, light duty utility arm
International Nuclear Information System (INIS)
Boucher, T.D.
1994-01-01
The light-duty utility arm (LDUA) is a seven-joint stainless steel robotic arm with a payload capacity of 75 lb. The robotic arm is deployed vertically with a maximum vertical reach of 63 ft. and a maximum horizontal reach of 13.5 ft. The functional requirements of the LDUA system are mapping and characterization of waste in Hanford single-shell tanks (SST) before and during waste retrieval. The LDUA system consists of a mobile deployment system (MDS), a vertical positioning mast (VPM), a tank riser interface confinement (TRIC), the LDUA, and a controller subsystem or support trailer. Currently, the system is in design and is subject to change; however, the LDUA or robotic arm will be deployed through a 12-in. riser above the tank dome. Field trips were performed to gather specifics for future deployment of the LDUA in Tank 241-A-105. The purpose of this report is to support two previous reports for the investigation of SSTs for deployment of the LDUA system. The first report identified the availability of risers while the second report identified the availability of Tanks 241-A-105, 241-A-S-109, 241-A-T-101, and 241-A-T-109 for deployment of the LDUA system. The second report also identified those 4- and 12-in. risers that could be used for deployment of the LDUA and camera system. This report addresses accessibility to the 241-A Tank Farm and the usability of the Tank 241-A-105 risers. The following information for assisting in the design and deployment of the LDUA will be discussed in this report: radiation survey; flange identification; high resolution video; computer simulated model; and field survey
Wilson, Mark A.; Amour, Courtney V. St.; Collins, Jennifer L.; Ringe, Dagmar; Petsko, Gregory A.
2004-01-01
The yeast gene YDR533C encodes a protein belonging to the DJ-1/ThiJ/PfpI superfamily. This family includes the human protein DJ-1, which is mutated in autosomal recessive early-onset Parkinson's disease. The function of DJ-1 and its yeast homologue YDR533Cp is unknown. We report here the crystal structure of YDR533Cp at 1.8-Å resolution. The structure indicates that the closest relative to YDR533Cp is the Escherichia coli heat shock protein Hsp31 (YedU), which has both chaperone and protease activity. As expected, the overall fold of the core domain of YDR533Cp is also similar to that of DJ-1 and the bacterial protease PfpI. YDR533Cp contains a possible catalytic triad analogous to that of Hsp31 and an additional domain that is present in Hsp31 but is not seen in DJ-1 and other members of the family. The cysteine in this triad (Cys-138) is oxidized in this crystal structure, similar to modifications seen in the corresponding cysteine in the crystal structure of DJ-1. YDR533Cp appears to be a dimer both in solution and the crystal, but this dimer is formed by a different interface than that found in Hsp31 or other members of the superfamily. PMID:14745011
241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-30
This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.
Doody, Michael A.; Wang, Dengjun; Bais, Harsh P.; Jin, Yan
2016-10-01
As silver nanoparticles (AgNPs) have become increasingly used in commercial antimicrobial agents and industrial and military products, concerns are increasing over their broad environmental and health impacts and risks because they are finding their way to the environment. This study was designed to quantify the antimicrobial activity of citrate-coated AgNPs (c-AgNPs; transmission electron microscope size of 44.9 ± 7.2 nm) to two species of bacteria, i.e., Gram-positive Bacillus subtilis and Gram-negative Escherichia coli, and toxicity to a major crop plant Zea mays and beneficial bacteria-inoculated plant (i.e., B. subtilis-inoculated Z. mays symbiont). Our results reveal that the exposure of c-AgNPs significantly inhibited bacteria growth and altered their growth kinetics. Z. mays experienced significant sublethal effects including reduced root length and biomass, and hyper-accumulation of Ag in roots. The beneficial interactions between B. subtilis and Z. mays were weakened as well because both species suffered sublethal effects. Potential mechanisms leading to the antimicrobial activity and toxicity of c-AgNPs to the bacteria, plant, and plant-bacteria symbiont examined in this study were discussed. Taken together, our findings advance the current knowledge of AgNPs antimicrobial property or toxicity to bacteria, crop plant, and beneficial plant-bacteria symbiotic interaction, which is a critical component for NPs environmental impact and risk assessment.
Vertical distribution of (241)Pu in the southern Baltic Sea sediments.
Strumińska-Parulska, Dagmara I
2014-12-15
The vertical distribution of plutonium (241)Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, (241)Pu/(239+240)Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of (241)Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of (241)Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident. Copyright © 2014 Elsevier Ltd. All rights reserved.
Comparison of effectiveness of four chelating agents in removing incorporated sup 241 Am
Energy Technology Data Exchange (ETDEWEB)
Mingyue, Lun; Yumin, Wang; Zhikang, Wei [Ministry of Nuclear Industry, Taiyuan, SX (China). Inst. of Radiation Protection; and others
1988-02-01
The effectiveness of four chelating agents (Ca-DTPA, Zn-DTPA, quinamic acid and H-73-10) in removing incorporated {sup 241}Am was studied on 200 rats. The results show that Ca-DTPA and Zn-DTPA are more effective than the others. They decreased the {sup 241}Am contents in the rat liver and skeleton down to only about 5 and 10 per cent of the control values, respectively. Quinamic acid has the same effectiveness in reducing the {sup 241}Am contents in the rat skeleton and liver as that of DTPA, but it leads to the cumulation of {sup 241}Am in the kidney, i. e., the {sup 241}Am content in the kidney is even higher than that in control rats. Although H-73-10 can remove {sup 241}Am from the rat organs, it is much less effective than DTPA.
Recovery of Americium-241 from lightning rod by the method of chemical treatment
International Nuclear Information System (INIS)
Cruz, W.H.
2013-01-01
About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)
Operational test report for the 241-A-701 air compressor upgrade
Energy Technology Data Exchange (ETDEWEB)
Meeuwsen, W.E.
1997-06-30
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.
Honeywell Modular Automation System Computer Software Documentation
International Nuclear Information System (INIS)
STUBBS, A.M.
2000-01-01
The purpose of this Computer Software Document (CSWD) is to provide configuration control of the Honeywell Modular Automation System (MAS) in use at the Plutonium Finishing Plant (PFP). This CSWD describes hardware and PFP developed software for control of stabilization furnaces. The Honeywell software can generate configuration reports for the developed control software. These reports are described in the following section and are attached as addendum's. This plan applies to PFP Engineering Manager, Thermal Stabilization Cognizant Engineers, and the Shift Technical Advisors responsible for the Honeywell MAS software/hardware and administration of the Honeywell System
48 CFR 52.241-1 - Electric Service Territory Compliance Representation.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Electric Service Territory Compliance Representation. 52.241-1 Section 52.241-1 Federal Acquisition Regulations System FEDERAL... utility franchises or service territories established pursuant to State statute, State regulation, or...
{sup 241}Pu concentrations in water, plankton and fish from the southern Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Struminska-Parulska, D.I.; Skwarzec, B. [Gdansk, Univ. (Poland). Facuty of Chemistry
2013-08-01
The aim of the work was to determine {sup 241}Pu activities in different components (water, plankton and fish) of the southern Baltic Sea ecosystem. Measurement of {sup 241}Pu in the samples was done indirectly by determining the increment in {sup 241}Am from the decay of the {beta}-emitting {sup 241}Pu in samples collected 10-15 years after the Chernobyl accident. Enhanced levels of {sup 241}Pu were observed in all analyzed Baltic samples. The highest {sup 241}Pu concentrations in fish were found in Perciformes: benthic round goby (0.863 {+-} 0.066 mBq/g ww) and pelagic perch (0.666 {+-} 0.001 mBq/g ww). Plutonium is also non-uniformly distributed in the organs and tissues of the analyzed fish; especially pelagic herring and cod as well as benthic flounder. Most of {sup 241}Pu in flounder, herring and cod is located in soft tissues, especially digestive organs (stomach, intestine, liver). The annual individual effective doses calculated on the basis of {sup 241}Pu concentrations in fish indicated that the impact of the consumption of {sup 241}Pu containing Baltic fish on the annual effective dose for a statistical inhabitant of Poland was very small. (orig.)
Operational test report for the 241-A-701 air compressor upgrade
International Nuclear Information System (INIS)
Meeuwsen, W.E.
1997-01-01
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
International Nuclear Information System (INIS)
Himes, D.A.
1998-01-01
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
Energy Technology Data Exchange (ETDEWEB)
Himes, D.A.
1998-08-11
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout
Energy Technology Data Exchange (ETDEWEB)
Ewalt, J.R.
1993-09-01
In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.
8 CFR 241.21 - Stay of deportation of excluded alien.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Stay of deportation of excluded alien. 241.21 Section 241.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings Commenced...
Estimation of cross talk between lungs and liver for 241Am using phoswich detector
International Nuclear Information System (INIS)
Mishra, Lokpati; Nadar, Minal Y.; Singh, I.S.; Sawant, P.D.
2018-01-01
241 Am is used as a tracer for in-vivo assessment of plutonium (Pu) in the lungs. Internal contamination of 241 Am is estimated by measuring its 59.5 keV photons then activity of Pu is estimated by applying Pu/ 241 Am ratio obtained from radiochemical analysis of fecal/workplace sample. According to ICRP systemic bio-kinetic model, for Type M compounds of 241 Am after 100 days post inhalation intake, 241 Am activity in liver exceeds 241 Am activity present in the lungs and goes on increasing even up to about ten years. In this work, cross talk (CT) between lungs and liver viz. CT (liver to lungs) and CT (lungs to liver) for the actinide monitoring system for 241 Am using realistic thorax Lawrence Livermore National Laboratory (LLNL) phantom were estimated. Also CT has been estimated using voxel phantom by carrying out Monte Carlo simulations in FLUKA code. This study will help in reporting the actual activity present in the individual organ (lungs, liver)
Xin, Z-J; Li, X-W; Bian, L; Sun, X-L
2017-02-01
Green leaf volatiles (GLVs) have been reported to play an important role in the host-locating behavior of several folivores that feed on angiosperms. However, next to nothing is known about how the green leafhopper, Empoasca vitis, chooses suitable host plants and whether it detects differing emission levels of GLV components among genetically different tea varieties. Here we found that the constitutive transcript level of the tea hydroperoxide lyase (HPL) gene CsiHPL1, and the amounts of (Z)-3-hexenyl acetate and of total GLV components are significantly higher in tea varieties that are susceptible to E. vitis (Enbiao (EB) and Banzhuyuan (BZY)) than in varieties that are resistant to E. vitis (Changxingzisun (CX) and Juyan (JY)). Moreover, the results of a Y-tube olfactometer bioassay and an oviposition preference assay suggest that (Z)-3-hexenyl acetate and (Z)-3-hexenol offer host and oviposition cues for E. vitis female adults. Taken together, the two GLV components, (Z)-3-hexenol and especially (Z)-3-hexenyl acetate, provide a plausible mechanism by which tea green leafhoppers distinguish among resistant and susceptible varieties. Future research should be carried out to obtain the threshold of the above indices and then assess their reasonableness. The development of practical detection indices would greatly improve our ability to screen and develop tea varieties that are resistant to E. vitis.
Operational experience with a seasonally operated full-scale membrane bioreactor plant
Czech Academy of Sciences Publication Activity Database
Gómez, M.; Dvořák, L.; Růžičková, I.; Holba, Marek; Wanner, J.
2012-01-01
Roč. 121, OCT 2012 (2012), s. 241-247 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : full-scale membrane bioreactor * soluble microbibal products * nutrient removal * fouling * microbiological effluent quality Subject RIV: EF - Botanics Impact factor: 4.750, year: 2012
Plutonium-241 processing: from impure oxide to high purity metal target disks
International Nuclear Information System (INIS)
Conner, W.V.; Baaso, D.L.
1975-01-01
The preparation of three plutonium-241 metal target disks, using a precision casting technique, is described. The disks were 0.625 inch in diameter and 0.125, 0.025, and 0.010 inch thick. All three disks were prepared simultaneously in a single casting. The variation in thickness of each disk was within +-1 percent of the disk's average thickness. The plutonium-241 was highly pure, and the finished disks contained a total of only 297 parts per million of detectable impurities. Purification of the plutonium oxide ( 241 PuO 2 ) and the conversion of the purified 241 PuO 2 to metal are also described. (U.S.)
Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102
International Nuclear Information System (INIS)
CONNER, J.M.
1999-01-01
High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)
Phenotypic, genetic and molecular characterization of a maize low phytic acid mutant (lpa241)
DEFF Research Database (Denmark)
Pilu, R.; Panzeri, D.; Gavazzi, G.
2003-01-01
-nutritional factor for animals, and isolation of maize low phytic acid (lpa) mutants provides a novel approach to study its biochemical pathway and to tackle the nutritional problems associated with it. Following chemical mutagenesis of pollen, we have isolated a viable recessive mutant named lpa 241 showing about...... 90% reduction of phytic acid and about a tenfold increase in seed-free phosphate content. Although germination rate was decreased by about 30% compared to wild-type, developement of mutant plants was apparentely unaffected. The results of the genetic, biochemical and molecular characterization...
Test report - 241-AN-274 Caustic Pump Control Building
International Nuclear Information System (INIS)
Paintner, G.P.
1995-05-01
This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met
Energy Technology Data Exchange (ETDEWEB)
RIECK, C.A.
1999-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability
International Nuclear Information System (INIS)
SINCLAIR, J.C.
1999-01-01
This document sets forth the plans, organization, and control systems for managing the PFP Stabilization and Deactivation Project, and includes the top level cost and schedule baselines. The project includes the stabilization of Pu-bearing materials, storage, packaging, and transport of these and other nuclear materials, surveillance and maintenance of facilities and systems relied upon for storage of the materials, and transition of the facilities in the PFP Complex
The uptake of radionuclides by plants
International Nuclear Information System (INIS)
Cawse, P.A.; Turner, G.S.
1982-02-01
A review of the literature, since 1970, on the research into the uptake of radionuclides by plants, with references to earlier soil and plant studies on the fate of nuclear weapons fallout. Experimental data on the uptake of plutonium isotopes, americium 241, cesium 137, radium 226, curium 244 and neptunium 237 and details of the chemical form of the radionuclide, soil type and plant growth period are tabulated. (U.K.)
Experimental verification for standard analysis procedure of 241Am in food
International Nuclear Information System (INIS)
Liu Qingfen; Zhu Hongda; Liu Shutian; Pan Jingshun; Yang Dating
2005-01-01
Objective: The briefly experimental verification for 'determination of 241 Am in food' has been described. Methods: The overall recovery, the MDL of method and decontamination experiment has been done by standard analysis procedure. Results: The overall recovery is 76.26 ± 4.1%. The MDL is 3.4 x 10 -5 Bq/g ash, decontamination factor is higher than 10 3 for Po, 10 2 for U, Th, Pu and 60 for 237 Np. Conclusion: The results showed that the overall recovery is quite high and reliable, the MDL of method is able to meet examining 241 Am limited values in foods. the obtained decontamination factors of recommended procedure can meet analysis of 241 Am in food examination. Venifying results of the procedure are satisfied by using 243 Am spike and 241 Am standard reference material. (authors)
International Nuclear Information System (INIS)
HERZOG, K.R.
1999-01-01
A review of the environmental, safety, and health vulnerabilities associated with the continued storage of PFP's inventory of plutonium bearing materials and other SNM. This report re-evaluates the five vulnerabilities identified in 1994 at the PFP that are associated with SNM storage. This new evaluation took a more detailed look and applied a risk ranking process to help focus remediation efforts
7 CFR 1951.241 - Special provision for interest rate change.
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Special provision for interest rate change. 1951.241... Community and Direct Business Programs Loans and Grants § 1951.241 Special provision for interest rate... interest rate charged by FmHA or its successor agency under Public Law 103-354 to water and waste disposal...
30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...
Ternary particles with extreme N/Z ratios from neutron-induced fission
International Nuclear Information System (INIS)
Koster, U.; Faust, H.; Friedrichs, T.; Oberstedt, S.; Fioni, G.; Grob, M.; Ahmad, I. J.; Devlin, M.; Heinz, A.; Kondev, F. G.; Lauritsen, T.; Sarantites, D. G.; Siem, S.; Sobotka, L. G.; Sonzogni, A.
2000-01-01
The existing ternary fission models can well reproduce the yields of the most abundant light charged particles. However, these models tend to significantly overestimate the yields of ternary particles with an extreme N/Z ratio: 3 He, 11 Li, 14 Be, etc. The experimental yields of these isotopes were investigated with the recoil separator LOHENGRIN down to a level of 10 -10 per fission. Results from the fissioning systems 233 U (n th , f), 235 U(n th ,f), 239 Pu(n th ,f) 241 Pu(n th ,f) and 245 Cm(n th ,f) are presented and the implications for the ternary fission models are discussed
International Nuclear Information System (INIS)
Estey, S.D.
1997-01-01
This calculation note analyzes headspace concentrations of hydrogen dependent upon assumed ventilation flow rates provided for tanks 241-C-106 and 241-AY-102. The analyses are based on measured or estimated steady state hydrogen release rates. Tank 241-C-106 is analyzed prior to sluicing; tank 241-AY-102 is analyzed both prior to and after completion of sluicing. Specific analyses, using both best estimated and bounding hydrogen generation rates, include the minimum primary ventilation flow rates required in the tanks to ensure that the steady state hydrogen concentration in the respective tank headspace does not exceed 25% and 100% of the LFL. The headspace hydrogen concentration as a function of time as well as the time required to reach 25% and 100% of LFL upon complete loss of active ventilation, starting from the steady state hydrogen concentration based on a 200 CFM minimum flow rate in tank 241-C-106 and a 100 CFM minimum flow rate in tank241-AY-102. The headspace hydrogen concentration as a function of thee following partial loss of active ventilation (i.e., step changes to l60, l20, 80, and 40 CFM ventilation flow rates) in tank 241-C-106, staffing from a 200 CFM flow rate and the corresponding steady state hydrogen concentration based on the 200 CFM flow rate. The headspace hydrogen concentration as a function of the following partial loss of active ventilation i.e., step changes to 80, 60, 40, and 20 CFM ventilation flow rates) in tank 241-AY-102, starting from a 100 CFM flow rate and the corresponding steady state hydrogen concentration based on the 100 CFM flow rate
Tank characterization report for single-shell tank 241-T-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In August 1992, Single-Shell Tank 241-T-104 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code (Ecology, 1991). This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. The purpose of this report is to describe and characterize the waste in Single-Shall Tank 241-T-104 (hereafter, Tank 241-T-104) based on information given from various sources. This report summarizes the available information regarding the waste in Tank 241-T-104, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Tank characterization report for double-shell Tank 241-AP-107
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
The purpose of this tank characterization report is to describe and characterize the waste in Double-Shell Tank 241-AP-107 based on information gathered from various sources. This report summarizes the available information regarding the waste in Tank 241-AP-107, and arranges it in a useful format for making management and technical decisions concerning this particular waste tank. In addition, conclusion and recommendations based on safety and further characterization needs are given. Specific objectives reached by the sampling and characterization of the waste in Tank 241-AP-107 are: Contribute toward the fulfillment of the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-44-05 concerning the characterization of Hanford Site high-level radioactive waste tanks; Complete safety screening of the contents of Tank 241-AP-107 to meet the characterization requirements of the Defense Nuclear Facilities Safety board (DNFSB) Recommendation 93-5; and Provide tank waste characterization to the Tank Waste Remediation System (TWRS) Program Elements in accordance with the TWRS Tank Waste Analysis Plan
Pu241 cross-sections below 1 keV
International Nuclear Information System (INIS)
Doherty, G.
1966-12-01
Early in 1965 a new data file (DFN 40) for Pu241 covering the energy range 10 - 4 eV to 15 MeV was prepared for the UKAEA Nuclear Data Library. The data above 1 keV are described by Douglas (AWRE 0-101/64) and the data below 1 keV are set out in this report. During the past year a number of additional measurements have been reported for Pu241 and a brief summary of these measurements and their implications for the data on the file are given. (author)
International Nuclear Information System (INIS)
VISWANATH, R.S.
1999-01-01
This data package presents sampling data and analytical results from the September 22 and 27, 1999, headspace vapor sampling of Hanford Site Tank 241-2-361 during sludge core removal. The Lockheed Martin Hanford Corporation (LMHC) sampling team collected the samples and Waste Management Laboratory (WML) analyzed the samples in accordance with the requirements specified in the 241-2361 Sludge Characterization Sampling and Analysis Plan, (SAP), HNF-4371/Rev. 1, (Babcock and Wilcox Hanford Corporation, 1999). Six SUMMA(trademark) canister samples were collected on each day (1 ambient field blank and 5 tank vapor samples collected when each core segment was removed). The samples were radiologically released on September 28 and October 4, 1999, and received at the laboratory on September 29 and October 6, 1999. Target analytes were not detected at concentrations greater than their notification limits as specified in the SAP. Analytical results for the target analytes and tentatively identified compounds (TICs) are presented in Section 2.2.2 starting on page 2B-7. Three compounds identified for analysis in the SAP were analyzed as TICs. The discussion of this modification is presented in Section 2.2.1.2
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Determination of plutonium 241 in solutions of nuclear wastes
International Nuclear Information System (INIS)
Raymond, A.; Bilcot, J.B.; Poletiko, C.
1990-09-01
Determination of plutonium 241 in nuclear wastes is important because of long period and high energy of some daughter products. In this report are presented two quantitative analysis methods using both scintillation techniques: A complete method, in any case, by selective extraction of plutonium on an anionic resin allowing simultaneous determination of Pu 241 and the sum of other plutonium isotopes; a simplified method when alpha activity is higher than beta/gamma activity by liquid extraction with TTA. These methods are applied for analysis of 4 waste types: cement encapsulated wastes, bitumen encapsulated wastes, incineration ashes, leaching of encapsulated incineration ashes. In these 4 examples, Pu 241 activity is equal or higher than the sum of alpha plutonium isotope activity. Separation efficiency, measured from Pu 239 or with Pu 236 as tracer, is between 90 and 99% [fr
Tank 241-C-106 in-tank imaging system operational test report
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106
Energy Technology Data Exchange (ETDEWEB)
DEXTER, M.L.
1999-11-15
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.
International Nuclear Information System (INIS)
DEXTER, M.L.
1999-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year
Tank 241-C-106 waste retrieval sluicing system process control plan
Energy Technology Data Exchange (ETDEWEB)
Carothers, K.G.
1998-07-25
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.
Tank 241-C-106 waste retrieval sluicing system process control plan
International Nuclear Information System (INIS)
Carothers, K.G.
1998-01-01
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity
Behavior of 241Am in fast reactor systems - a safeguards perspective
International Nuclear Information System (INIS)
Beddingfield, David H.; Lafleur, Adrienne M.
2009-01-01
Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.
8 CFR 241.24 - Notice to transportation line of alien's exclusion.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's exclusion. 241.24 Section 241.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings...
Potentiostatic electro-deposition of 241Am using room temperature ionic liquids
International Nuclear Information System (INIS)
Sankhe, R.H.; Mirashi, N.N.; Arijit Sengupta; Murali, M.S.
2015-01-01
An attempt was made for the potentiostatic electrodeposition of 241 Am using six different room temperature ionic liquids (RTILs). Effect of electrodeposition time on the % of electrodeposition of 241 Am, pH change of the solution and the temperature change of the systems were investigated. It was observed that for water immiscible RTILs, the least viscous RTIL gave the best yield (when mixed with iso-propanol), while for water miscible RTILs, reverse trend was observed (when mixed with water). Out of all water immiscible RTILs under consideration for the present case, the octyl-methyl-pyrrolidinium bis(trifluoromethylsulfonyl)imide (C 8 mpyNTf 2 ) in isopropanol was found to yield almost quantitative (99.6 %) electrodeposition of 241 Am within 45 min whereas the most effective system was found to be C 8 mimBr with ∼90 % of 241 Am deposited on the electrode for water miscible RTILs. To the best of our knowledge, this is the first approach ever been reported in the literature. (author)
Tank 241-A-105 evaporation estimate, 1970 through 1978
International Nuclear Information System (INIS)
Allen, G.K.
1991-09-01
Tank 241-A-105 was subjected to a severe steam explosion in January 1965 that caused the metal liner on the bottom to bulge upward approximately 8 feet above its concrete foundation. Shortly after this event, radiation was detected in drywells around the tank and it was declared a leaker. Sluicing operations to remove material from the tank began in August 1968 and continued through August 1970. After sluicing was completed, a significant amount of heat generating material still remained in the tank. To keep tank temperatures below operating limits, the water level in the tank was maintained at an approximate depth of 1.5 feet. This practice was continued until January 1979 when it was believed that the contents had decayed sufficiently to discontinue the water addition and put the tank on a portable exhauster system. Recent concern has focused on what portion of this cooling water added to Tank 241-A-105 actually evaporated and how much leaked into the soil during the nine year time period. This report presents the results of a study that estimates the amount of water evaporated from Tank 241-A-105 between 1970 and 1979. The problem was completed in two parts. The first part involved development of a three dimensional heat transfer model which was used to establish the tank heat load. The results of this model were validated against thermocouple data from Tank 241-A-105. The heat removed from the tank by the ventilation air was then used as input to a second computer code, which calculated the water evaporation. Based upon these two models, the amount of water evaporated from Tank 241-A-105, between 1970 and 1979, was between 378,000 and 410,000 gallons. 9 refs., 17 figs., 7 tabs
Czech Academy of Sciences Publication Activity Database
Catford, J.A.; Daehler, C. C.; Murphy, H.T.; Sheppard, A.W.; Hardesty, B.D.; Westcott, D.A.; Rejmánek, M.; Bellingham, P.J.; Pergl, Jan; Horovitz, C.C.; Hulme, P. E.
2012-01-01
Roč. 14, č. 3 (2012), s. 231-241 ISSN 1433-8319 R&D Projects: GA AV ČR IAA600050811 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : succession * invasions * community ecology Subject RIV: EF - Botanics Impact factor: 4.158, year: 2012
International Nuclear Information System (INIS)
Doody, Michael A.; Wang, Dengjun; Bais, Harsh P.; Jin, Yan
2016-01-01
As silver nanoparticles (AgNPs) have become increasingly used in commercial antimicrobial agents and industrial and military products, concerns are increasing over their broad environmental and health impacts and risks because they are finding their way to the environment. This study was designed to quantify the antimicrobial activity of citrate-coated AgNPs (c-AgNPs; transmission electron microscope size of 44.9 ± 7.2 nm) to two species of bacteria, i.e., Gram-positive Bacillus subtilis and Gram-negative Escherichia coli, and toxicity to a major crop plant Zea mays and beneficial bacteria-inoculated plant (i.e., B. subtilis-inoculated Z. mays symbiont). Our results reveal that the exposure of c-AgNPs significantly inhibited bacteria growth and altered their growth kinetics. Z. mays experienced significant sublethal effects including reduced root length and biomass, and hyper-accumulation of Ag in roots. The beneficial interactions between B. subtilis and Z. mays were weakened as well because both species suffered sublethal effects. Potential mechanisms leading to the antimicrobial activity and toxicity of c-AgNPs to the bacteria, plant, and plant–bacteria symbiont examined in this study were discussed. Taken together, our findings advance the current knowledge of AgNPs antimicrobial property or toxicity to bacteria, crop plant, and beneficial plant–bacteria symbiotic interaction, which is a critical component for NPs environmental impact and risk assessment.Graphical Abstract
Energy Technology Data Exchange (ETDEWEB)
Doody, Michael A.; Wang, Dengjun; Bais, Harsh P.; Jin, Yan, E-mail: yjin@udel.edu [University of Delaware, Department of Plant and Soil Sciences (United States)
2016-10-15
As silver nanoparticles (AgNPs) have become increasingly used in commercial antimicrobial agents and industrial and military products, concerns are increasing over their broad environmental and health impacts and risks because they are finding their way to the environment. This study was designed to quantify the antimicrobial activity of citrate-coated AgNPs (c-AgNPs; transmission electron microscope size of 44.9 ± 7.2 nm) to two species of bacteria, i.e., Gram-positive Bacillus subtilis and Gram-negative Escherichia coli, and toxicity to a major crop plant Zea mays and beneficial bacteria-inoculated plant (i.e., B. subtilis-inoculated Z. mays symbiont). Our results reveal that the exposure of c-AgNPs significantly inhibited bacteria growth and altered their growth kinetics. Z. mays experienced significant sublethal effects including reduced root length and biomass, and hyper-accumulation of Ag in roots. The beneficial interactions between B. subtilis and Z. mays were weakened as well because both species suffered sublethal effects. Potential mechanisms leading to the antimicrobial activity and toxicity of c-AgNPs to the bacteria, plant, and plant–bacteria symbiont examined in this study were discussed. Taken together, our findings advance the current knowledge of AgNPs antimicrobial property or toxicity to bacteria, crop plant, and beneficial plant–bacteria symbiotic interaction, which is a critical component for NPs environmental impact and risk assessment.Graphical Abstract.
Waste behavior analysis for tank 241-SY-103
International Nuclear Information System (INIS)
Wilkins, N.E.
1994-01-01
Tank 241-SY-103 is on the Flammable Gas Watch List. The waste in this tank behaves similarly to that in tank 241-Sy-101. Both show slurry growth and periodic surface level drops. However, the surface level drops are much smaller than those in tank 101-SY. A standard hydrogen monitoring system (SHMS) was recently installed in tank 103-SY, and waste auger samples were recently taken. This document covers the characterization results to date for the auger samples, and the behavior of the tank waste during both steady state periods and gas release events
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
Tank 241-AP-104 Grab Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L and H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104
Tank characterization report for double-shell tank 241-AP-105
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
Double-Shell Tank 241-AP-105 is a radioactive waste tank most recently sampled in March of 1993. Sampling and characterization of the waste in Tank 241-AP-105 contributes toward the fulfillment of Milestone M-44-05 of the Hanford Federal Facility Agreement and Consent Order (Ecology, EPA, and DOE, 1993). Characterization is also needed tot evaluate the waste's fitness for safe processing through an evaporator as part of an overall waste volume reduction program. Tank 241-AP-105, located in the 200 East Area AP Tank Farm, was constructed and went into service in 1986 as a dilute waste receiver tank; Tank 241AP-1 05 was considered as a candidate tank for the Grout Treatment Facility. With the cancellation of the Grout Program, the final disposal of the waste in will be as high- and low-level glass fractions. The tank has an operational capacity of 1,140,000 gallons, and currently contains 821,000 gallons of double-shell slurry feed. The waste is heterogeneous, although distinct layers do not exist. Waste has been removed periodically for processing and concentration through the 242-A Evaporator. The tank is not classified as a Watch List tank and is considered to be sound. There are no Unreviewed Safety Questions associated with Tank 241-AP-105 at this time. The waste in Tank 241-AP-105 exists as an aqueous solution of metallic salts and radionuclides, with limited amounts of organic complexants. The most prevalent soluble analytes include aluminum, potassium, sodium, hydroxide, carbonate, nitrate, and nitrite. The calculated pH is greater than the Resource Conservation and Recovery Act established limit of 12.5 for corrosivity. In addition, cadmium, chromium, and lead concentrations were found at levels greater than their regulatory thresholds. The major radionuclide constituent is 137 Cs, while the few organic complexants present include glycolate and oxalate. Approximately 60% of the waste by weight is water
Environmental impact of a teratogenic actinide: a case study of americium-241
Energy Technology Data Exchange (ETDEWEB)
Wang, J.; Yang, J.Y.
1985-10-16
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs.
Environmental impact of a teratogenic actinide: a case study of americium-241
International Nuclear Information System (INIS)
Wang, J.; Yang, J.Y.
1985-01-01
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs
Measurement of contamination by 241Am
International Nuclear Information System (INIS)
Hemmingsen, L.B.S.
1991-08-01
In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)
Tank 241-S-102, Core 232 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1998-11-04
This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
Test plan for tank 241-AN-104 dilution studies
International Nuclear Information System (INIS)
Herting, D.L.
1998-01-01
Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List
The effect of dilution on the gas retention behavior of Tank 241-SY- 103 waste
International Nuclear Information System (INIS)
Bredt, P.R.; Tingey, S.M.
1996-01-01
Twenty-five of the 177 underground waste storage tanks on the Hanford Site have been placed on the Flammable Gas watch list. These 25 tanks, containing high-level waste generated during plutonium and uranium processing, have been identified as potentially capable of accumulating flammable gases above the lower flammability limit (Babad et al. 1991). In the case of Tanks 241-SY-101 and 241-SY-103, it has been proposed that diluting the tank waste may mitigate this hazard (Hudson et al. 1995; Stewart et al. 1994). The effect of dilution on the ability of waste from Tank 241-SY-103 to accumulate gas was studied at Pacific Northwest National Laboratory. A similar study has been completed for waste from Tank 241-SY-101 (Bredt et al. 1995). Because of the additional waste-storage volume available in Tank 241-SY-103 and because the waste is assumed to be similar to that currently in Tank 241-SY-101, Tank 241-SY-103 became the target for a demonstration of passive mitigation through in-tank dilution. In 1994, plans for the in-tank dilution demonstration were deferred pending a decision on whether to pursue dilution as a mitigation strategy. However, because Tank 241-SY-103 is an early retrieval target, determination of how waste properties vary with dilution will still be required
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)
1978-01-01
The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.
Characterization of strong (241)Am sources.
Vesterlund, Anna; Chernikova, Dina; Cartemo, Petty; Axell, Kåre; Nordlund, Anders; Skarnemark, Gunnar; Ekberg, Christian; Ramebäck, Henrik
2015-05-01
Gamma ray spectra of strong (241)Am sources may reveal information about the source composition as there may be other radioactive nuclides such as progeny and radioactive impurities present. In this work the possibility to use gamma spectrometry to identify inherent signatures in (241)Am sources in order to differentiate sources from each other, is investigated. The studied signatures are age, i.e. time passed since last chemical separation, and presence of impurities. The spectra of some sources show a number of Doppler broadened peaks in the spectrum which indicate the presence of nuclear reactions on light elements within the sources. The results show that the investigated sources can be differentiated between by age and/or presence of impurities. These spectral features would be useful information in a national nuclear forensics library (NNFL) in cases when the visual information on the source, e.g. the source number, is unavailable. Copyright © 2015 Elsevier Ltd. All rights reserved.
Tank characterization report for single-shell tank 241-S-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In July and August 1992, Single-Shell Tank 241-S-104 was sampled as part of the overall characterization effort directed by the Hanford Federal Facility Agreement and Consent Order. Sampling was also performed to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also presents expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background historical and surveillance tank information. Finally, this report makes recommendations and conclusions regarding operational safety. The purpose of this report is to describe the characteristics the waste in Single-Shell Tank 241-S-104 (hereafter, Tank 241-S-104) based on information obtained from a variety of sources. This report summarizes the available information regarding the chemical and physical properties of the waste in Tank 241-S-104, and using the historical information to place the analytical data in context, arranges this information in a format useful for making management and technical decisions concerning waste tank safety and disposal issues. In addition, conclusions and recommendations are presented based on safety issues and further characterization needs
Tank 241-AP-104 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-11-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Double-Shell Tank (DST) 241-AP-104
Test plan for Tank 241-AW-101 solubility screening tests
International Nuclear Information System (INIS)
Person, J.C.
1998-01-01
Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan
Acceptance Test Report for the 241-AN-107 Enraf Advanced Technology Gauges
International Nuclear Information System (INIS)
Dowell, J.L.; Enderlin, V.R.
1995-06-01
This Acceptance Test Report covers the results of the execution of the Acceptance Test Procedure for the 241-AN-107 Enraf Advanced Technology Gauges. The test verified the proper operation of the gauges to measure waste density and level in the 241-AN-107 tank
Associated risk factors for chronic kidney disease of unknown etiologies in 241 patients.
Xing, Xuexue; Lu, Jing; Wang, Zheng
2015-04-01
Apart from the well-known etiologies, there are still a high proportion of patients with chronic kidney disease of unknown etiology (CKDu), which has rarely been reported on. In this study, we explored the potential associated risk factors for CKDu and identified those that occur in childhood. 700 patients with CKD we were selected randomly from 4 hospitals in Chengdu and 241 were screened for CKDu. The following clinical information was analyzed: demographic data, life style, personal and family history, nephrotoxic drugs, exposure to poison, allergies, and recurrent respiratory infections in childhood. Among 700 CKD patients, 34.43% (241/700) were CKDu. Of the 241 patients, there were 67.63% (163/241) with at least 1 associated risk factor and 56.44% (92/163) with more than 1. Patients with a personal history of an associated risk factor represented the largest proportion (31.95%, 77/241), while 28.63% (69/241) of the CKDu patients had risk factors appearing in childhood. Logistic regression analysis supported the results. The study demonstrated that most so-called CKDu patients do have an identifiable etiology, and that several associated risk factors contribute to it. Of all the risk factors, age >60 years, nephrotoxic drugs, exposure to poison, and alcohol consumption were the independent significant factors for CKDu. Furthermore, many risk factors that caused kidney injury started in childhood.
Operability test procedure for 241-U compressed air system and heat pump
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The supply piping to the 241-U Tank Farm is not included in the modification. Modifications to the 241-U-701 compressed air system include installation of a 15 HP Reciprocating Air Compressor, Ingersoll-Rand Model 10T3NLM-E15; an air dryer, Hankinson, Model DH-45; and miscellaneous system equipment and piping (valves, filters, etc.) to meet the design. A newly installed heat pump allows the compressor to operate within an enclosed relatively dust free atmosphere and keeps the compressor room within a standard acceptable temperature range, which makes possible efficient compressor operation, reduces maintenance, and maximizes compressor operating life. This document is an Operability Test Procedure (OTP) which will further verify (in addition to the Acceptance Test Procedure) that the 241-U-701 compressed air system and heat pump operate within their intended design parameters. The activities defined in this OTP will be performed to ensure the performance of the new compressed air system will be adequate, reliable and efficient. Completion of this OTP and sign off of the OTP Acceptance of Test Results is necessary for turnover of the compressed air system from Engineering to Operations
Bioleaching remediation of heavy metal-contaminated soils using Burkholderia sp. Z-90.
Yang, Zhihui; Zhang, Zhi; Chai, Liyuan; Wang, Yong; Liu, Yi; Xiao, Ruiyang
2016-01-15
Bioleaching is an environment-friendly and economical technology to remove heavy metals from contaminated soils. In this study, a biosurfactant-producing strain with capacity of alkaline production was isolated from cafeteria sewer sludge and its capability for removing Zn, Pb, Mn, Cd, Cu, and As was investigated. Phylogenetic analysis using 16S rDNA gene sequences confirmed that the strain belonged to Burkholderia sp. and named as Z-90. The biosurfactant was glycolipid confirmed by thin layer chromatography and Fourier-transform infrared spectroscopy. Z-90 broth was then used for bioleaching remediation of heavy metal-contaminated soils. The removal efficiency was 44.0% for Zn, 32.5% for Pb, 52.2% for Mn, 37.7% for Cd, 24.1% for Cu and 31.6% for As, respectively. Mn, Zn and Cd were more easily removed from soil than Cu, Pb and As, which was attributed to the presence of high acid-soluble fraction of Mn, Zn and Cd and high residual fraction of Cu, Pb and As. The heavy metal removal in soils was contributed to the adhesion of heavy metal-contaminated soil minerals with strain Z-90 and the formation of a metal complex with biosurfactant. Copyright © 2015 Elsevier B.V. All rights reserved.
Acceptance test report for the Tank 241-C-106 in-tank imaging system
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing
Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2013-01-01
This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-05-01
Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.
Status of tank 241-SY-101 data analyses
International Nuclear Information System (INIS)
Anantatmula, R.P.
1992-09-01
The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question
Plutonium Finishing Plant Transition Project mission analysis report
International Nuclear Information System (INIS)
Courson, D.B.
1994-01-01
This report defines the mission for the Plutonium Finishing Plant Transition Project (PFPTP) using a systems engineering approach. This mission analysis will be the basis for the functional analysis which will further define and break down the mission statement into all of the detailed functions required to accomplish the mission. The functional analysis is then used to develop requirements, allocate those requirements to functions, and eventually be used to design the system. This report: presents the problem which will be addressed, defines PFP Transition Project, defines the overall mission statement, describes the existing, initial conditions, defines the desired, final conditions, identifies the mission boundaries and external interfaces, identifies the resources required to carry out the mission, describes the uncertainties and risks, and discusses the measures which will be used to determine success
International Nuclear Information System (INIS)
Ovsiannikova, S.V.; Sokolik, G.A.; Kilchitskaya, S.L.; Eismont, E.A.; Zhukovich, N.V.; Kimlenko, I.M.
1998-01-01
The role of pore soil solutions in the migration of 137 Cs, 90 Sr, 239,240 Pu and 241 Am within soil-vegetative cover of natural ecosystems was examined. The soil solutions were found to play an important role in the redistribution of 137 Cs, 90 Sr, 239,240 Pu and 241 Am in the soil-plant systems. Obvious relationships between the distribution coefficients of radionuclides between solid and liquid phases (K d ) and the intensity of vertical migration of 137 Cs, 90 Sr, 239,240 Pu and 241 Am along the soil profiles and with intensity of their accumulation by grass vegetation of natural meadows have been obtained. It means that the distribution coefficient may be used as a criterion of the radionuclide mobility in the soil-plant system whatever its level of radioactive contamination is. The influence of the degree of soil moistening, the content of mobile radionuclide forms in the soils and some characteristics of pore soil solutions (pH, content of K + , Ca 2+ , NH 4 + , water soluble organic substances) on the concentration of radionuclide in the soil solutions and on the value of radionuclide distribution coefficient have been analysed. The results of investigation are of great importance in the evaluation of radioecological situation and in solution of problems of radioecological rehabilitation of the contaminated territories. The received data constitute a part of scientific basis for the development of a system of countermeasures to decrease the mobility and biological availability of radionuclides of high and very high radiotoxicity
Directory of Open Access Journals (Sweden)
Miguel Mariano Espitia Camacho
2006-06-01
Full Text Available El estudio tuvo como objetivos estimar la depresión por endogamia (DE y cuatro tipos de heterosis: promedio general (HP, promedio de progenitores (HM, heterobeltiosis (HB y útil (HU, en dos dialélos [uno entre cinco variedades (V y el otro entre cinco líneas endogamicas S1 (LS1, derivadas de éstas], para el rendimiento por planta (PFP, número de frutos por planta (NFP y peso promedio de fruto (PPF. Los 30 genotipos se evaluaron en el municipio de Candelaria (Valle del Cauca, Colombia, en un diseño de bloques completos al azar con cinco repeticiones. Se presentaron diferencias significativas (p 40 % y HU (>60 % en PFP.With the goal of estimating inbreeding depression (DE and the four types of heterosis: general average (HP, mean (HM, heterobeltiosis (HB and standard (HU, in two diallelic [one among five cross pollinated varieties (VAR and the other among five self-pollinated lines S1(LS1, derived from these], for yield/plant (PFP, number of fruits/plant (NFP and weight/fruit (PPF. The 30 genotypes were evaluated using a complete randomized design with five replicates in Candelaria (Valle del Cauca, Colombia . Significant differences (p 40 % and HU (>60 % in PFP.
In-vivo counting of 241Am in human lungs and tracheobronchial lymph nodes
International Nuclear Information System (INIS)
Northcutt, A.R.; Binney, S.E.; Palmer, H.E.
1988-01-01
A study was conducted of a human male who had inhaled a mixture of 241 Am and Pu. To distinguish 241 Am deposited in the subject's lungs from translocated activity deposited in the tracheobronchial lymph nodes (TBLN), two intrinsic Ge detectors were collimated with 0.3-cm Pb sheeting. A tissue-equivalent phantom containing either 22.9 kBq (620 nCi) of 241 Am in the lungs or a 81.4 kBq (2200 nCi) 241 Am point source in the TBLN was measured. Calibration curves observed from lateral differential scans on the phantom were compared to data obtained by the same detection system for a human male with a measured lung deposition of 89 Bq (2.4 nCi) of 241 Am. Comparison of the human data to the calibration curves indicated the activity was restricted primarily to the lungs. The calibration curves demonstrate that this method is useful in determining the distribution of inhaled radioactivity between the lungs and TBLN. The measured activity from the male subject generally supported the ICRP Publication 30 model translocation prediction for class Y compounds
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
International Nuclear Information System (INIS)
Hays, C.B.
1998-01-01
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
Energy Technology Data Exchange (ETDEWEB)
Hays, C.B.
1998-01-28
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
International Nuclear Information System (INIS)
THOMAS, R.J.
2000-01-01
This document specifies the critical characteristics for Commercial Grade Items (CGI) procured for use in the Plutonium Finishing Plant as required by HNF-PRO-268 and HNF-PRO-1819. These are the minimum specifications that the equipment must meet in order to properly perform its safety function. There may be several manufacturers or models that meet the critical characteristics of any one item
Final results of double-shell tank 241-AZ-101 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AZ-101. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AZ-101 primary tank wall and welds. The inspection found one reportable indication of thinning and no reportable pitting, corrosion, or cracking
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Analysis and characterization of double shell tank 241-AP-108
International Nuclear Information System (INIS)
Miller, G.L.
1994-01-01
This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank
Treatment of selected primary gynecologic and pelvic malignancies with 241Americium
International Nuclear Information System (INIS)
Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn
1995-01-01
Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were
Energy Technology Data Exchange (ETDEWEB)
Dvorska, L; Dulanska, S [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra jadrovej chemie, 84215 Bratislava (Slovakia)
2012-04-25
An important and fundamental fact in the operation of nuclear power plants is that there is no production of greenhouse gases and pollutant emissions especially nitrogen oxides NO{sub x}, carbon oxides CO and CO{sub 2}, sulfur dioxide and fly ash. Alpha radionuclides in fly ash from thermal power Novaky {sup 238}U, {sup 234}U, {sup 235}U, {sup 239,240} Pu, {sup 238}Pu and {sup 241}Am were separated on extraction-chromatographic sorbents TRU Resin and Resin UTEVA involved in the vacuum box in tandem. Samples for the measurement of alpha radionuclides were measured on a double-chamber 576A spectrometer with ULTRA Alpha Detector 600, EG and G ORTEC. There was not detected any increased activity value of uranium isotopes comparing the activity of {sup 238}U and {sup 234}U with the Slovakian Collection of Laws 345/2006. (authors)
International Nuclear Information System (INIS)
Horton, D.G.; Randall, R.R.
1998-09-01
This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ''Has the configuration of subsurface contamination changed since it was last measured?'' Previous borehole logging and laboratory analyses provide the baseline data to help answer this question
Ternary particles with extreme N/Z ratios from neutron-induced fission
Energy Technology Data Exchange (ETDEWEB)
Koster, U.; Faust, H.; Friedrichs, T.; Oberstedt, S.; Fioni, G.; Grob, M.; Ahmad, I. J.; Devlin, M.; Heinz, A.; Kondev, F. G.; Lauritsen, T.; Sarantites, D. G.; Siem, S.; Sobotka, L. G.; Sonzogni, A.
2000-05-16
The existing ternary fission models can well reproduce the yields of the most abundant light charged particles. However, these models tend to significantly overestimate the yields of ternary particles with an extreme N/Z ratio: {sup 3}He, {sup 11}Li, {sup 14}Be, etc. The experimental yields of these isotopes were investigated with the recoil separator LOHENGRIN down to a level of 10{sup {minus}10} per fission. Results from the fissioning systems {sup 233}U (n{sub th}, f), {sup 235}U(n{sub th},f), {sup 239}Pu(n{sub th},f) {sup 241}Pu(n{sub th},f) and {sup 245}Cm(n{sub th},f) are presented and the implications for the ternary fission models are discussed.
Brown, I R; Mansfield, J W; Taira, S; Roine, E; Romantschuk, M
2001-03-01
The Hrp pilus, composed of HrpA subunits, is an essential component of the type III secretion system in Pseudomonas syringae. We used electron microscopy (EM) and immunocytochemistry to examine production of the pilus in vitro from P. syringae pv. tomato strain DC3000 grown under hrp-inducing conditions on EM grids. Pili, when labeled with antibodies to HrpA, developed rapidly in a nonpolar manner shortly after the detection of the hrpA transcript and extended up to 5 microm into surrounding media. Structures at the base of the pilus were clearly differentiated from the basal bodies of flagella. The HrpZ protein, also secreted via the type III system, was found by immunogold labeling to be associated with the pilus in vitro. Accumulation and secretion of HrpA and HrpZ were also examined quantitatively after the inoculation of wild-type DC3000 and hrpA and hrpZ mutants into leaves of Arabidopsis thaliana. The functional pilus crossed the plant cell wall to generate tracks of immunogold labeling for HrpA and HrpZ. Mutants that produced HrpA but did not assemble pili were nonpathogenic, did not secrete HrpA protein, and were compromised for the accumulation of HrpZ. A model is proposed in which the rapidly elongating Hrp pilus acts as a moving conveyor, facilitating transfer of effector proteins from bacteria to the plant cytoplasm across the formidable barrier of the plant cell wall.
SLIGHTLY IRRADIATED FUEL (SIF) INTERIM DISPOSITION PROJECT
International Nuclear Information System (INIS)
Norton, S.H.
2010-01-01
CH2M HILL Plateau Remediation Company (CH2M HILL PRC) is proud to submit the Slightly Irradiated Fuel (SIF) Interim Disposition Project for consideration by the Project Management Institute as Project of the Year for 2010. The SIF Project was a set of six interrelated sub-projects that delivered unique stand-alone outcomes, which, when integrated, provided a comprehensive and compliant system for storing high risk special nuclear materials. The scope of the six sub-projects included the design, construction, testing, and turnover of the facilities and equipment, which would provide safe, secure, and compliant Special Nuclear Material (SNM) storage capabilities for the SIF material. The project encompassed a broad range of activities, including the following: Five buildings/structures removed, relocated, or built; Two buildings renovated; Structural barriers, fencing, and heavy gates installed; New roadways and parking lots built; Multiple detection and assessment systems installed; New and expanded communication systems developed; Multimedia recording devices added; and A new control room to monitor all materials and systems built. Project challenges were numerous and included the following: An aggressive 17-month schedule to support the high-profile Plutonium Finishing Plant (PFP) decommissioning; Company/contractor changeovers that affected each and every project team member; Project requirements that continually evolved during design and construction due to the performance- and outcome-based nature ofthe security objectives; and Restrictions imposed on all communications due to the sensitive nature of the projects In spite of the significant challenges, the project was delivered on schedule and $2 million under budget, which became a special source of pride that bonded the team. For years, the SIF had been stored at the central Hanford PFP. Because of the weapons-grade piutonium produced and stored there, the PFP had some of the tightest security on the Hanford
SLIGHTLY IRRADIATED FUEL (SIF) INTERIM DISPOSITION PROJECT
Energy Technology Data Exchange (ETDEWEB)
NORTON SH
2010-02-23
CH2M HILL Plateau Remediation Company (CH2M HILL PRC) is proud to submit the Slightly Irradiated Fuel (SIF) Interim Disposition Project for consideration by the Project Management Institute as Project of the Year for 2010. The SIF Project was a set of six interrelated sub-projects that delivered unique stand-alone outcomes, which, when integrated, provided a comprehensive and compliant system for storing high risk special nuclear materials. The scope of the six sub-projects included the design, construction, testing, and turnover of the facilities and equipment, which would provide safe, secure, and compliant Special Nuclear Material (SNM) storage capabilities for the SIF material. The project encompassed a broad range of activities, including the following: Five buildings/structures removed, relocated, or built; Two buildings renovated; Structural barriers, fencing, and heavy gates installed; New roadways and parking lots built; Multiple detection and assessment systems installed; New and expanded communication systems developed; Multimedia recording devices added; and A new control room to monitor all materials and systems built. Project challenges were numerous and included the following: An aggressive 17-month schedule to support the high-profile Plutonium Finishing Plant (PFP) decommissioning; Company/contractor changeovers that affected each and every project team member; Project requirements that continually evolved during design and construction due to the performance- and outcome-based nature ofthe security objectives; and Restrictions imposed on all communications due to the sensitive nature of the projects In spite of the significant challenges, the project was delivered on schedule and $2 million under budget, which became a special source of pride that bonded the team. For years, the SIF had been stored at the central Hanford PFP. Because of the weapons-grade piutonium produced and stored there, the PFP had some of the tightest security on the Hanford
Final report for tank 241-BX-109, push mode cores 84 and 85
International Nuclear Information System (INIS)
Schreiber, R.D.
1996-01-01
This document summarizes the sampling activities for tank 241-BX-109. This report contains tables of the analytical results on total organic compounds and total inorganic compounds in the radioactive wastes. Tank 241-BX-109 has not been on a Watch List
International Nuclear Information System (INIS)
Brown, G.N.; Bontha, J.R.; Carlson, C.D.
1995-09-01
Pacific Northwest Laboratory (PNL), in conjunction with the Process Chemistry and Statistics Section of Westinghouse Hanford Company (WHC), conducted this study as part of the Supernatant Treatment Development Task for the Initial Pretreatment Module (IPM) Applied Engineering Project. The study assesses the performance of the CS-100 ion exchange material for removing cesium from simulated and actual alkaline supernate from Hanford tanks 241-SY-101 and 241-SY-103. The objective of these experiments is to compare the cesium ion exchange loading and elution profiles of actual and simulated wastes. Specific experimental objectives include (1) demonstration of decontamination factors (DF) for cesium removal, 92) verification of simulant performance, (3) investigation of waste/exchanger chemistry, and (4) determination of the radionuclide content of the regenerated CS-100 resin prior to disposal
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
Final results of double-shell tank 241-AY-102 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AY-102. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AY-102 primary tank wall and welds. The inspection found some indication of insignificant general and local wall thinning with no cracks detected
Final results of double-shell tank 241-AN-105 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AN-105. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AN-105 primary tank wall primary knuckle, and secondary tank bottom. The inspection found some indication of general and local wall thinning with no cracks detected
Precipitation process of Z-phase in 9-12%CR steels
DEFF Research Database (Denmark)
Danielsen, Hilmar Kjartansson
2014-01-01
Precipitation of Z-phase, Cr(V,Nb)N, is known to negatively affect creep properties of 9-12%Cr steels for power plant applications as it dissolves finely distributed MX particles, (V,Nb)N, especially in high Cr steels. As the Z-phase precipitates slowly as large particles, this causes a net drop ...... and crystallographically into Z-phase CrTaN particles. Copyright © 2014 Electric Power Research Institute, Inc. Distributed by ASM International®. All rights reserved....
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-10-28
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-01-01
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy
Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations
Energy Technology Data Exchange (ETDEWEB)
Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-01-30
The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241
Strumińska-Parulska, Dagmara I; Skwarzec, Bogdan
2015-05-01
The paper presents unique data of plutonium (241)Pu study in seabirds from northern Eurasia, permanently or temporally living at the southern Baltic Sea coast. Together, ten marine birds species were examined, as follows: three species that permanently reside at the southern Baltic, four species of wintering birds, and three species of migrating birds; 366 samples were analyzed. The obtained results indicated plutonium was non-uniformly distributed in organs and tissues of analyzed seabirds. The highest (241)Pu content was found in the digestion organs and feathers, the lowest in muscles. Also, the internal radiation doses from (241)Pu were evaluated.
Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums
International Nuclear Information System (INIS)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi
2011-01-01
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
International Nuclear Information System (INIS)
Slutz, Stephen A.; Olson, Craig L.; Rochau, Gary E.; Dezon, Mark S.; Peterson, P.F.; Degroot, J.S.; Jensen, N.; Miller, G.
2000-01-01
The Z machine at Sandia National Laboratories (SNL) is the most powerful multi-module synchronized pulsed-power accelerator in the world. Rapid development of z-pinch loads on Z has led to outstanding progress in the last few years, resulting in radiative powers of up to 280 TW in 4 ns and a total radiated x-ray energy of 1.8 MJ. The present goal is to demonstrate single-shot, high-yield fusion capsules. Pulsed power is a robust and inexpensive technology, which should be well suited for Inertial Fusion Energy, but a rep-rated capability is needed. Recent developments have led to a viable conceptual approach for a rep-rated z-pinch power plant for IFE. This concept exploits the advantages of going to high yield (a few GJ) at low rep-rate (approximately 0.1 Hz), and using a Recyclable Transmission Line (RTL) to provide the necessary standoff between the fusion target and the power plant chamber. In this approach, a portion of the transmission line near the capsule is replaced after each shot. The RTL should be constructed of materials that can easily be separated from the liquid coolant stream and refabricated for a subsequent shots. One possibility is that most of the RTL is formed by casting FLiBe, a salt composed of fluorine, lithium, and beryllium, which is an attractive choice for the reactor coolant, with chemically compatible lead or tin on the surface to provide conductivity. The authors estimate that fusion yields greater than 1 GJ will be required for efficient generation of electricity. Calculations indicate that the first wall will have an acceptable lifetime with these high yields if blast mitigation techniques are used. Furthermore, yields above 5 GJ may allow the use of a compact blanket direct conversion scheme
Zhang, Lei; Li, Muhang; Li, Qiqi; Chen, Chaoqiong; Qu, Meng; Li, Mengyun; Wang, Yao; Shen, Xihui
2018-04-27
Efficient root colonization is a prerequisite for application of plant growth promoting (PGP) bacteria in improving health and yield of agricultural crops. We have recently identified an endophytic bacterium Pantoea alhagi LTYR-11Z with multiple PGP properties that effectively colonizes the root system of wheat and improves its growth and drought tolerance. To identify novel regulatory genes required for wheat colonization, we screened a LTYR-11Z transposon (Tn) insertion library and found cra to be a colonization-related gene. By using RNA-seq analysis, we found that transcriptional levels of an eps operon, the ydiV gene encoding an anti-FlhD 4 C 2 factor and the yedQ gene encoding an enzyme for synthesis of cyclic dimeric GMP (c-di-GMP) were significantly downregulated in the mutant Δ cra. Further studies demonstrated that Cra directly binds to the promoters of the eps operon, ydiV and yedQ and activates their expression, thus inhibiting motility and promoting exopolysaccharides (EPS) production and biofilm formation. Consistent with previous findings that Cra plays a role in transcriptional regulation in response to carbon source availability, the activating effects of Cra were much more pronounced when LTYR-11Z was grown within a gluconeogenic environment than when it was grown within a glycolytic environment. We further demonstrate that the ability of LTYR-11Z to colonize wheat roots is modulated by the availability of carbon sources. All together, these results uncover a novel strategy utilized by LTYR-11Z to achieve host colonization in response to carbon nutrition in the environment, in which Cra bridges a connection between carbon metabolism and colonization capacity of LTYR-11Z. IMPORTANCE Rapid and appropriate response to environmental signals is crucial for bacteria to adapt to competitive environments and to establish interactions with their hosts. Efficient colonization and persistence within the host is controlled by various regulatory factors that
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
International Nuclear Information System (INIS)
Wilson, T.R.; Hanson, C.
1994-01-01
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
Energy Technology Data Exchange (ETDEWEB)
Wilson, T.R.; Hanson, C.
1994-10-03
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.
Operational Test Report for the 241-AZ-101 Suspended Solids Profiler
International Nuclear Information System (INIS)
STENKAMP, D.M.
2000-01-01
This document comprises the Operational Test Report for the 241-AZ-101 Suspended Solids Profiler. This document presents the results of Operational Testing of the 241-AZ-101 Suspended Solids Profiler (SSP). Testing of the SSP was performed in accordance with OTP-260-005, ''SUSPENDED SOLIDS PROFILER OPERATIONAL TEST PROCEDURE''. The objective of the testing was to verify that all equipment and components functioned as designed, following construction completion and turnover to operations
Operational test procedure for Bldg 241-A-701 air compressor
International Nuclear Information System (INIS)
Desantis, G.N.
1995-01-01
This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators
Process Control Plan for Tank 241-SY-101 Surface Level Rise Remediation
International Nuclear Information System (INIS)
ESTEY, S.D.
1999-01-01
The tank 241-SY-101 transfer system was conceived and designed to address the immediate needs presented by rapidly changing waste conditions in tank 241-SY-101. Within the last year or so, the waste in this tank has exhibited unexpected behavior (Rassat et al. 1999) in the form of rapidly increasing crust growth. This growth has been brought about by a rapidly increasing rate of gas entrapment within the crust. It has been conceived that the lack of crust agitation beginning upon the advent of mixer pump operations may have set-up a more consolidated, gas impermeable barrier when compared to a crust regularly broken up by the prior buoyant displacement events within the tank. As a result, a series of level-growth remediation activities have been developed for tank 241-SY-101. The initial activities are also known as near-term crust mitigation. The first activity of near-term mitigation is to perform the small transfer of convective waste from tank 241-SY-101 into tank 241-SY-102. A 100 kgal transfer represents about a 10% volume reduction allowing a 10% water in-tank dilution. Current thinking holds that this should be enough to dissolve nitrite solids in the crust and perhaps largely eliminate gas retention problem in the crust (Raymond 1999). Additional mitigation activities are also planned on less constrained schedules. The net affect of the small transfer and follow-on mitigation activities for tank 241-SY-101 is strongly believed to be the remediation of tank 241-SY-101 as a flammable gas safety concern. The process for remediating the tank will require two or more transfer/dilution cycles. In-tank dilution will begin shortly after the initial transfer and the total dilution required to reach the final state is estimated to be between 250 to 400K gallons. The final state of the waste will not require any active measures to safely store the waste and operation of the mixer pump will no longer be necessary. The remediation activities are centered on a purpose
48 CFR 52.241-5 - Contractor's Facilities.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Facilities....241-5 Contractor's Facilities. As prescribed in 41.501(c)(4), insert a clause substantially the same as the following: Contractor's Facilities (FEB 1995) (a) The Contractor, at its expense, unless...
Nuclear design considerations for Z-IFE chambers
Energy Technology Data Exchange (ETDEWEB)
Meier, W.R. [Lawrence Livermore National Laboratory, P.O. Box 808, L-641, Livermore, CA 94551 (United States)]. E-mail: meier5@llnl.gov; Schmitt, R.C. [Bettis Atomic Power Laboratory, Pittsburgh, PA 15203 (United States); Abbott, R.P. [Lawrence Livermore National Laboratory, P.O. Box 808, L-641, Livermore, CA 94551 (United States); Latkowski, J.F. [Lawrence Livermore National Laboratory, P.O. Box 808, L-641, Livermore, CA 94551 (United States); Reyes, S. [Lawrence Livermore National Laboratory, P.O. Box 808, L-641, Livermore, CA 94551 (United States)
2006-02-15
Z-pinch driven IFE (Z-IFE) requires the design of a repetitive target insertion system that allows coupling of the pulsed power to the target with adequate standoff, and a chamber that can withstand blast and radiation effects from large yield targets. The present strategy for Z-IFE is to use high yield targets ({approx}2-3 GJ/shot), low repetition rate per chamber ({approx}0.1 Hz), and 10 chambers per power plant. In this study, we propose an alternative power plant configuration that uses very high yield targets (20 GJ/shot) in a single chamber operating at 0.1 Hz. A thick-liquid-wall chamber is proposed to absorb the target emission (X-rays, debris and neutrons) and mitigate the blast effects on the chamber wall. The target is attached to the end of a conical shaped recyclable transmission line (RTL) made from a solid coolant (e.g., frozen flibe), or a material that is easily separable from the coolant (e.g., steel). The RTL/target assembly is inserted through a single opening at the top of the chamber for each shot. This study looks at the RTL material choice from a safety and environmental point of view. Materials were assessed according to waste disposal rating (WDR) and contact dose rate (CDR). Neutronics calculations, using the TART2002 Monte Carlo code from Lawrence Livermore National Laboratory (LLNL), were performed for the RTL and Z-IFE chamber, and key results reported here.
Review of 241 Pu resonance parameters
International Nuclear Information System (INIS)
Derrien, H.
1981-10-01
The status of 241 Pu resonance parameters is reviewed. The most important recent results are compared in some energy ranges, both from single level and multilevel point of view. It appears that an accurate set of resonance parameters is not still obtained for a general description of the cross-sections in the resonance region. Some recommendations are given for further experiments or evaluations
Influence of organic fertilization on the sorption mechanisms of 241 Am in tropical soils
International Nuclear Information System (INIS)
Pereira, Tatiane Rocha
2009-01-01
In this work the mechanisms involved in the sorption of 241 Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m -2 and 4 kg m -2 ) were artificially contaminated by radioactive solution water, which contained 241 Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of 241 Am in radish's roots was measured. The main results show that 241 Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for 241 Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Spatial statistical analysis of contamination level of 241Am and 239Pu, Thule, North-West Greenland
Energy Technology Data Exchange (ETDEWEB)
Strodl Andersen, J. (JSA EnviroStat (Denmark))
2011-10-15
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241Am and 239,240Pu on land. Maximum observed level of 241Am is 2.8x105 Bq m-2. Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241Am is 1.9-104 Bq m-2. Prediction of the overall amount of 241Am and 239,240Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241Am is 45 GBq and the predicted total amount of 239,240Pu is 270 GBq. (Author)
24 CFR 241.865 - Election by the lender.
2010-04-01
... Without a HUD-Insured or HUD-Held Mortgage Rights and Duties of Lender Under the Contract of Insurance § 241.865 Election by the lender. Where a real estate mortgage, or other security instrument has been...
Tank 241-C-101 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-101
Tank 241-U-111 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-111
Tank 241-C-105 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-105
Tank 241-BY-106 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106
Tank 241-BX-104 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-BX-104
Tank 241-AP-107 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107
Tank 241-AX-104 tank characterization plan
International Nuclear Information System (INIS)
Sathyanarayana, P.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-104
Tank 241-AX-102 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-102
Tank 241-U-103 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-103
Tank 241-TX-118 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-118
Tank 241-T-111 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-111
Tank 241-TY-101 Tank Characterization Plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TY-101
Tank 241-T-107 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-107
Photon interaction studies using 241Am γ-rays
Indian Academy of Sciences (India)
rays from a 241Am source. These include attenuation studies as well as photoelectric absorption studies in various samples. The attenuation studies have been made using leaf and wood samples, samples like sand, sugar etc., which ...
International Nuclear Information System (INIS)
Rapko, Brian M.; Geeting, John GH; Sinkov, Sergei I.; Vienna, John D.
2006-01-01
This report describes work designed to evaluate the effectiveness of alkaline permanganate contacts at selectively removing chromium from the Hanford tank sludges 241-SY-102 and 241-SX-101. The key variables examined in this study, as compared to contact with the standard conditions of stoichiometric permanganate in 3 M hydroxide at elevated temperature, were: (a) excess permanganate and hydroxide at elevated temperature, (b) the separation of an elevated temperature 3 M hydroxide leach with either a room temperature permanganate contact or an elevated temperature permanganate contact at 0.25 M hydroxide. It was determined that sequential permanganate and caustic leaching can provide as effective removal of Cr as the combined high hydroxide permanganate contact at elevated temperature while minimizing concomitant Pu dissolution
Tank characterization report for double-shell tank 241-AP-101. Revision 1
International Nuclear Information System (INIS)
Conner, J.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes m support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for double-shell tank 241-AP-101. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-AP-101 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 provides the best-basis inventory estimate, and Section 4.0 makes recommendations about safety status and additional sampling needs. The appendixes contain supporting data and information. This report supported the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-05. The characterization information in this report originated from sample analyses and known historical sources. Appendix A provides historical information for tank 241-AP-101 including surveillance, information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a model based upon process knowledge. Appendix B summarizes recent sampling events and historical sampling information. Tank 241-AP-101 was grab sampled in November 1995, when the tank contained 2,790 kL (737 kgal) of waste. An addition1034al 1,438 kL (380 kgal) of waste was received from tank 241-AW-106 in transfers on March 1996 and January 1997. This waste was the product of the 242-A Evaporator Campaign 95-1. Characterization information for the additional 1,438 kL (380 kgal) was obtained using grab sampling data from tank 241-AW-106 and a slurry sample from the evaporator. Appendix C reports on the statistical analysis and numerical manipulation of data used in
Treatment of selected primary gynecologic and pelvic malignancies with {sup 241}Americium
Energy Technology Data Exchange (ETDEWEB)
Chung, Joyce Y; Peschel, Richard E; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E; Wilson, Lynn
1995-07-01
Purpose: To evaluate the efficacy of encapsulated {sup 241}Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated {sup 241}Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with {sup 241}Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of {sup 241}Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with {sup 241}Am. Median surface dose of {sup 241}Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S
2010-04-01
..., update, or cancel your registration? 1.241 Section 1.241 Food and Drugs FOOD AND DRUG ADMINISTRATION... Facilities Additional Provisions § 1.241 What are the consequences of failing to register, update, or cancel... to cancel its registration in accordance with the requirements of this subpart is a prohibited act...
Spatial statistical analysis of contamination level of 241Am and 239Pu Thule, North-West Greenland
International Nuclear Information System (INIS)
Strodl Andersen, J.
2011-10-01
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241 Am and 239,240 Pu on land. Maximum observed level of 241 Am is 2.8x10 5 Bq m -2 . Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241 Am is 1.9Oe10 4 Bq m -2 . Prediction of the overall amount of 241 Am and 239,240 Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241 Am is 45 GBq and the predicted total amount of 239,240 Pu is 270 GBq. (Author)
Tank 241-AZ-101 Mixer Pump Test Vapor Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of mixer pumps in tank 241-AZ-101. The primary purpose of the mixer pump test (MPT) is to demonstrate that the two 300 horsepower mixer pumps installed in tank 241-AZ-101 can mobilize the settled sludge so that it can be retrieved for treatment and vitrification. Sampling will be performed in accordance with Tank 241-AZ-101 Mixer Pump Test Data Quality Objective (Banning 1999) and Data Quality Objectives for Regulatory Requirements for Hazardous and Radioactive Air Emissions Sampling and Analysis (Mulkey 1999). The sampling will verify if current air emission estimates used in the permit application are correct and provide information for future air permit applications
Tank 241-TX-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-105 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Engineering test plan for Tank 241-SY-101 in situ viscometer
International Nuclear Information System (INIS)
Sobocinski, R.G.; Stokes, T.I.; Pearce, K.L.
1994-11-01
To obtain in situ measurements of the rheological properties within tank 241-SY-101, this document will implement the test strategy defined in PNLMIT-041994, acquisition and Reduction of Data Obtained in Tank SY-101 with the Ball Rheometer. Instructions for all sequences are defined within the procedure. All safety requirements as defined in LA-UR-92-3196, A Safety Assessment for Proposed Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-101-SY have been implemented into this procedure
Tank 241-BY-107 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issuesclose quotes. Tank 241-BY-107 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolutionclose quotes
Tank 241-BY-111 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-111 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-111 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in Program Plan for the Resolution of Tank Vapor Issues (Osborne and Huckaby 1994). Tank 241-C-108 was vapor sampled in accordance with Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution (Osborne et al., 1994)
Tank 241-TX-118 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-118 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-118 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-112 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-112 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-112 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-104 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-104 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-104 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-103 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-103 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-103 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-U-107 vapor sampling and analysis tank characterization report
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1995-05-31
Tank 241-U-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in {open_quotes}Program Plan for the Resolution of Tank Vapor Issues.{close_quotes} Tank 241-U-107 was vapor sampled in accordance with {open_quotes}Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.{close_quotes}
Determination of 241Pu in nuclear waste slurries: a comparative study using LSC and ICP-MS.
Jäggi, M; Röllin, S; Alvarado, J A Corcho; Eikenberg, J
2012-02-01
(241)Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the (241)Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for (241)Pu, the methods were further validated using the (241)Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. Copyright © 2011 Elsevier Ltd. All rights reserved.
Structural analysis and evaluation of the 241SY101 tank annulus heat-up
International Nuclear Information System (INIS)
Ziada, H.H.
1994-01-01
This document provides the structural analysis (static and thermal loads) of the 241SY101 tank to determine the maximum allowable temperature and rate of heating that could be applied to tank 241SY101 through annulus air heating without detrimental effects to the structural integrity of the concrete and steel liner of the tank
Operability Test Report for 241-U Compressed Air System and heat pump
International Nuclear Information System (INIS)
Rensink, G.E.
1995-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The system was upgraded. The operability test showed that the system operates within its intended design parameters. System performance was monitored, recorded, and used to identify areas of concern. Exceptions to the OTP and additional items for safe system performance were minimal and have been resolved; the air system is ready for Operation's use
8 CFR 241.14 - Continued detention of removable aliens on account of special circumstances.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continued detention of removable aliens on account of special circumstances. 241.14 Section 241.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing...
Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103
International Nuclear Information System (INIS)
Kos, S.E.
1995-12-01
Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked
The fast gamma spectrometric method of the Am-241 determination in Chernobyl restricted zone soils
International Nuclear Information System (INIS)
Gleisberg, B.; Lukachina, V.V.; Kirsenko, V.N.; Tepikin, V.E.; Rajevsky, V.S.; Libman, V.A.; Stoljarevsky, I.P.; Isajev, A.G.
1997-01-01
The known methods of the 241 Am contents determination in environmental objects, as a rule, is based on ion-chromatographic or extraction separation techniques. This approach reflects widespread opinion, that only the α-spectrometric analysis termination is suitable to ensure necessary sensitivity of the overall method of 241 Am actively determination. Really, the minimal detectable activity for such methods is about 0.05 Bq/kg (considering that Am is usually concentrated during separation procedure). However, because of α-spectrometry does not permit to separate the α-peaks of the 241 Am, and 238 Pu, but also in view of high requests to the α-spectrometric specimen purity, the multistage and laborious chemical procedures to separate 241 Am from plutonium radionuclides and other elements (with a thorough control of each separation stage) are needed
Tank 241-TX-105 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-105
Determination of {sup 241}Pu in nuclear waste slurries: A comparative study using LSC and ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Jaeggi, M., E-mail: maya.jaeggi@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland); Roellin, S., E-mail: Stefan.Roellin@babs.admin.ch [Federal Office for Civil Protection, SPIEZ Laboratory, CH-3700 Spiez (Switzerland); Corcho Alvarado, J.A., E-mail: Corcho-Alvarado@chuv.ch [Institute of Radiation Physics, University Hospital and University of Lausanne, Rue du Grand-Pre 1, 1007 Lausanne (Switzerland); Eikenberg, J., E-mail: jost.eikenberg@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland)
2012-02-15
{sup 241}Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the {sup 241}Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for {sup 241}Pu, the methods were further validated using the {sup 241}Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. - Highlights: Black-Right-Pointing-Pointer Good agreement between the {sup 241}Pu activity of 5 slurry samples, using 3 measurement techniques. Black-Right-Pointing-Pointer {sup 241}Pu information values of two IAEA samples agreed well for the 3 measurement techniques. Black-Right-Pointing-Pointer Low detection limits were achieved; 1.8 Bq/kg (Quantulus), 2 Bq/kg (ICP-MS) and 3.5 Bq/kg (TriCarb).
Organic Iodine Adsorption by AgZ under Prototypical Vessel Off-Gas Conditions
International Nuclear Information System (INIS)
Bruffey, Stephanie H.; Jubin, Robert Thomas; Jordan, J. A.
2016-01-01
U.S. regulations will require the removal of 129 I from the off-gas streams of any used nuclear fuel (UNF) reprocessing plant prior to discharge of the off-gas to the environment. Multiple off-gas streams within a UNF reprocessing plant combine prior to release, and each of these streams contains some amount of iodine. For an aqueous UNF reprocessing plant, these streams include the dissolver off-gas, the cell off-gas, the vessel off-gas (VOG), the waste off-gas and the shear off-gas. To achieve regulatory compliance, treatment of multiple off-gas streams within the plant must be performed. Preliminary studies have been completed on the adsorption of I 2 onto silver mordenite (AgZ) from prototypical VOG streams. The study reported that AgZ did adsorb I 2 from a prototypical VOG stream, but process upsets resulted in an uneven feed stream concentration. The experiments described in this document both improve the characterization of I 2 adsorption by AgZ from dilute gas streams and further extend it to include characterization of the adsorption of organic iodides (in the form of CH 3 I) onto AgZ under prototypical VOG conditions. The design of this extended duration testing was such that information about the rate of adsorption, the penetration of the iodine species, and the effect of sorbent aging on iodine removal in VOG conditions could be inferred.
Organic Iodine Adsorption by AgZ under Prototypical Vessel Off-Gas Conditions
Energy Technology Data Exchange (ETDEWEB)
Bruffey, Stephanie H. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jubin, Robert Thomas [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jordan, J. A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2016-09-30
U.S. regulations will require the removal of 129I from the off-gas streams of any used nuclear fuel (UNF) reprocessing plant prior to discharge of the off-gas to the environment. Multiple off-gas streams within a UNF reprocessing plant combine prior to release, and each of these streams contains some amount of iodine. For an aqueous UNF reprocessing plant, these streams include the dissolver off-gas, the cell off-gas, the vessel off-gas (VOG), the waste off-gas and the shear off-gas. To achieve regulatory compliance, treatment of multiple off-gas streams within the plant must be performed. Preliminary studies have been completed on the adsorption of I2 onto silver mordenite (AgZ) from prototypical VOG streams. The study reported that AgZ did adsorb I2 from a prototypical VOG stream, but process upsets resulted in an uneven feed stream concentration. The experiments described in this document both improve the characterization of I2 adsorption by AgZ from dilute gas streams and further extend it to include characterization of the adsorption of organic iodides (in the form of CH3I) onto AgZ under prototypical VOG conditions. The design of this extended duration testing was such that information about the rate of adsorption, the penetration of the iodine species, and the effect of sorbent aging on iodine removal in VOG conditions could be inferred.
Energy Technology Data Exchange (ETDEWEB)
Kozhakhanov, T.; Lukashenko, S. [Institute of radiation safety and ecology (Kazakhstan)
2014-07-01
Processes of radionuclides migration and transfer to agricultural plants are quite well developed worldwide, but the information on character of accumulation of {sup 241}Am and {sup 239+240}Pu transuranium radionuclides in agricultural plants is still fragmentary. Even in generalized materials of worldwide studies, IAEA guide, accumulation coefficient (AC) can have wide range of values (5-6 orders), no data exists on radionuclides' distribution in different organs of plants and they are given for joined groups of plants and types of soils. That is why the main aim of this work was to obtain basic quantitative parameters of radionuclides' migration in 'soil-plant' system, and firs of all- for transuranium elements.. In 2010 a series of experiments with agricultural plants was started at the territory of the former Semipalatinsk Test Site aimed to investigate entry of artificial radionuclides by crop products in natural climatic conditions. To conduct the experiment for study of coefficient of radionuclides' accumulation by agricultural corps, there was chosen a land spot at the STS territory, characterized by high concentration of radionuclides: {sup 241}Am - n*10{sup 4} Bq/kg, {sup 137}Cs - n*10{sup 3} Bq/kg, {sup 90}Sr - n*10{sup 3} Bq/kg and {sup 239+240}Pu- n*10{sup 5} Bq/kg. As objects of investigation, cultures, cultivated in Kazakhstan have been selected: wheat (Triticum vulgare), barley (Hordeum vulgare), oat (Avena sativa L.), water melon (Citrullus vulgaris), melon (Cucumis melo), potato (Solanum tuberosum), eggplant (Solanum melongena), pepper (Capsicum annuum), tomato (Solanum lycopersicum), sunflower (Helianthus cultus), onion (Allium cepa), carrot (Daucus carota), parsley(Petroselinum vulgare)and cabbage (Brassica oleracea). Investigated plants have been planted within the time limits, recommended for selected types of agricultural plants. Cropping system included simple agronomic and amelioration measures. Fertilizers were not
Proposed retention model for human inhalation exposure to 241AmO2
International Nuclear Information System (INIS)
Mewhinney, J.A.; Griffith, W.C.; Muggenburg, B.A.
1980-01-01
A dosimetry model based on a four-year study in Beagle dogs was developed to predict patterns of absorbed radiation doses for people exposed by inhalation to 241 AmO 2 . Following a single inhalation exposure to one of three sizes of monodisperse or a polydisperse aerosol of 241 AmO 2 , pairs of dogs were sacrificed at 8, 32, 64 and 256 days, and 2 and 4 years. For about 80% of the initial lung burden, the retention halftimes were 11, 18, 26 and 27 days for the 0.75, 1.5 and 3.0 μm aerodynamic diameter and the 1.8 μm activity median aerodynamic diameter aerosols, respectively. For the remaining 20% of the initial lung burden, the retention halftimes were between 200 to 300 days with no apparent particle size influence. Additional 241 Am metabolic studies reported in the literature using inhalation exposure or injection of the citrate complex were synthesized in the model as were eleven reported cases of human inhalation exposure. This model is compared to the ICRP II and TGLD lung models, both developed by analogy to Pu metabolism. The proposed model differs from these latter models in two important areas: (a) lung retention of 241 AmO 2 could not be adapted to the classifications used in these models, and (b) the fractional translocation from lung to other organs is 2 to 8 times larger. These factors considerably alter the predicted radiation dose distribution among organs and lead to the conclusion that derived radiation protection standards for 241 AmO 2 inhalation exposure should be modified. (author)
International Nuclear Information System (INIS)
Taya, A.
1986-03-01
The binding of Am-241 hydroxide polymers to the cell components of rat lung was investigated using differential centrifugation, density gradient centrifugation with different media, gel chromatography, free flow electrophoresis and electron microscopic autoradiography with Pu-241. The bovine alveolar macrophage cultures were introduced as an in vitro test system for Am-241 uptake. Form the biochemical and electron microscopic studies it can be concluded that Am-241 is taken up by pulmonary macrophages, where its first storage site is probably the lysosome. Then the Am-241 seems to be solubilized in the lysosomes and to be bound to the cytosolic ferritin of macrophages. Am-241 might be released from the cells and crosses the alveolar membranes as bound to transferrin or as low molecular weight form. (orig.) [de
Retention of 241Am and 239Pu in the rat as influenced by Triton WR 1339
International Nuclear Information System (INIS)
Gruner, R.; Siedel, A.
1976-01-01
A lysosomotropic agent, the non-ionic detergent Triton WR 1339 (a poly-oxyethylene ether of formaldehyde polymers of octylphenol) is known to be stored in rat liver lysosomes. The results of a study made to determine whether Triton WR 1339 exerts an influence on the metabolic fate of monomeric 239 Pu and 241 Am in the rat as well as on the removal of these nuclides by DTPA, since Triton WR 1339 and transuranic elements share the same deposition site, are reported. The influence of Triton WR 1339 on the 241 Am content (per cent of 241 Am dose) of rat organs (skeleton, liver, kidneys) at different times after Triton WR 1339 injection, the influence of the time of Triton WR 1339 injection on the 241 Am content (per cent of 241 Am dose) of the same rat organs, and the influence of Triton WR 1339 Zn-DTPA and the combination of them on the retention of monomeric 239 Pu in the same rat organs (per cent of 239 Pu dose), are shown in tabular form. The mechanism whereby Triton WR 1339 appears to shorten the biological half-life of 239 Pu and 241 Am in rat liver is discussed. (U.K.)
Z' boson mixings with Z-γ and charge assignments
International Nuclear Information System (INIS)
Zhang Ying; Wang Qing
2009-01-01
Based on the general description for Z'-Z-γ mixing as derived from the electroweak chiral Lagrangian, we characterize and classify the various new physics models involving the Z' boson that have appeared in the literature into five classes: 1. Models with minimal Z'-Z mass mixing; 2. Models with minimal Z'-Z kinetic mixing; 3. Models with general Z'-Z mixing; 4. Models with Z'-γ kinetic and Z'-Z mixing; and 5. Models with Stueckelberg-type mixing. The corresponding mixing matrices are explicitly evaluated for each of these classes. We constrain and classify the Z' boson charges with respect to quark-leptons by anomaly cancellation conditions.
The distribution of plutonium-241 in rodents
International Nuclear Information System (INIS)
Priest, N.D.
1977-01-01
Plutonium-241 citrate solution at pH 6.5 was injected intravenously or intraperitoneally into hamsters and rats at a dose of 50 MBq kg -1 (1.35 mCi kg -1 ). The animals were killed 1 day or 1 week later, and tissues were removed for autoradiography and radiochemical analysis. Plutonium-241 was distributed in rats in the same way as plutonium-239, and is a suitable isotope for high-resolution tissue-section autoradiography. Plutonium deposits in cells consisted of a nuclear and a cytoplasmic component. In the hamster kidney cells, the amount associated with the nucleus was about 55 per cent of the total cellular plutonium at 24 hours after injection. Six days later, it was only about 30 per cent. Plutonium deposits were also characterized in hepatocytes, in the interstitial cells of the testes, in the cells of ovarian follicles, in chondrocytes and in bone cells, including osteoblasts and osteocytes. In bone there appeared to be both an extracellular and intracellular deposit. No evidence was found of substantial incorporation of plutonium into the mineral phase of bone. (author)
Uran, Steinar; Landmark, Kristin; Normann, Per Trygve; Hals, Petter-Arnt; Toft, Kim Gunnar; Skotland, Tore
2005-09-15
Sonazoid is a new contrast agent for ultrasound imaging comprising an aqueous suspension of lipid-stabilised perfluorobutane (PFB) gas microbubbles. A respiration-metabolism chamber system was developed to collect exhaled air following intravenous administration of Sonazoid to rats. Analysis of PFB in the exhaled rat air was performed using a modified version of an earlier published method for blood samples, i.e. an automatic headspace gas chromatographic mass spectrometric (GC-MS) method using electron impact ionisation. The calibration standards were PFB diluted in air (2.5-1800 pg/ml). Perfluoropentane (PFP) was used as an internal standard and the MS detector was set to single ion monitoring of the base fragment ions of PFB (m/z 69 and 119) and PFP (m/z 69). The calibration curve, made by plotting the peak area ratios of PFB (m/z 69) to PFP (m/z 69) against the theoretical concentration of PFB, was fitted to a linear equation with weighting 1/y2 and found to be reproducible. The lower limit of quantification (LLOQ) was 2.5 pg PFB/ml. The between-day variation of the method was below 2.6% relative standard deviation (R.S.D.) and the within-day variation of the method was below 6.4% R.S.D. The accuracy of the method was evaluated and showed a relative error less than 5.2%. PFB was found to be stable for 14 days when stored in Tedlar sample bags at room temperature. An even lower detection limit may be obtained by using the more time-consuming process of solid-phase micro extraction; thus, by concentrating PFB on carboxen-PDMS fibres an LLOQ of 0.5 pg PFB/ml was obtained. When five rats were given an i.v. bolus injection of Sonazoid at a dose of 8 microl microbubbles/kg a mean recovery of 96% (range, 81-110%) was found during 24 h; more than 50% was exhaled during the first 30 min after injection.
Project Management Plan Solution Stabilization
International Nuclear Information System (INIS)
SATO, P.K.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Solutions Stabilization subproject. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Integrated Project Management Plan (IPMP) for the Plutonium Finishing Plant Stabilization and Deactivation Project, HNF-3617. This project plan is the top-level definitive project management document for the PFP Solution Stabilization subproject. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Solution Stabilization subproject. Any deviations to the document must be authorized through the appropriate change control process
Project Management Plan Solution Stabilization
Energy Technology Data Exchange (ETDEWEB)
SATO, P.K.
1999-08-31
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Solutions Stabilization subproject. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Integrated Project Management Plan (IPMP) for the Plutonium Finishing Plant Stabilization and Deactivation Project, HNF-3617. This project plan is the top-level definitive project management document for the PFP Solution Stabilization subproject. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Solution Stabilization subproject. Any deviations to the document must be authorized through the appropriate change control process.
Safety evaluation for packaging transportation of equipment for tank 241-C-106 waste sluicing system
International Nuclear Information System (INIS)
Calmus, D.B.
1994-01-01
A Waste Sluicing System (WSS) is scheduled for installation in nd waste storage tank 241-C-106 (106-C). The WSS will transfer high rating sludge from single shell tank 106-C to double shell waste tank 241-AY-102 (102-AY). Prior to installation of the WSS, a heel pump and a transfer pump will be removed from tank 106-C and an agitator pump will be removed from tank 102-AY. Special flexible receivers will be used to contain the pumps during removal from the tanks. After equipment removal, the flexible receivers will be placed in separate containers (packagings). The packaging and contents (packages) will be transferred from the Tank Farms to the Central Waste Complex (CWC) for interim storage and then to T Plant for evaluation and processing for final disposition. Two sizes of packagings will be provided for transferring the equipment from the Tank Farms to the interim storage facility. The packagings will be designated as the WSSP-1 and WSSP-2 packagings throughout the remainder of this Safety Evaluation for Packaging (SEP). The WSSP-1 packagings will transport the heel and transfer pumps from 106-C and the WSSP-2 packaging will transport the agitator pump from 102-AY. The WSSP-1 and WSSP-2 packagings are similar except for the length
Am-241 as a metabolic tracer for inhaled Pu nitrate in external chest counting
International Nuclear Information System (INIS)
Ishigure, Nobuhito; Nakano, Takashi; Enomoto, Hiroko
2000-01-01
The most difficult radionuclides to measure by extemal chest counting are the isotopes of plutonium (Pu). They are detected through weak emission of low energy L X-rays. The Pu treated in nuclear fuel cycle is usually accompanied with 241 Am produced from 241 Pu by β disintegration, which emits γ-rays of 60 keV with the emission rate of 0.36, being more penetrable than the L X-rays. The 241 Am could improve the detection limit of chest counting of Pu, if it being used as a metabolic tracer for Pu in lungs. It has already been shown that the 241 Am which would probably be embedded in a matrix of PuO 2 is cleared from the lungs at the same rate as the Pu for long time after intake (N. Ishigure, et al., Radiat, Prot. Dosim., 79, 133, 1998), which supports the validity of 241 Am as a tracer of inhaled Pu in external chest counting. In the present work another possible chemical form present in work places, Pu nitrate, has been investigated. The solution of Pu(NO 3 ) 4 was nebulized using a compressed-air operated nebulizer. The resultant droplets were passed through a tube with fresh air and conduced into a multi-port nose-only exposure chamber, which resulted in polydisperse aerosols of Pu(NO 3 ) 4 with 0.6 μm in AMAD. Young adult male Wistar rats, being 13 weeks old and weighing 230 g at the time of exposure were used. The exposed rats were periodically sacrificed and the radioactivity of 241 Am and 238/239/240 Pu in the autopsied lungs were measured by photon spectrometry with a NaI/CsI phoswich detector system. The activity ratio of 241 Am vs. Pu in lungs, 2.4% at the exposure, slowly decreased to 2.1% at 4 week and 2.0% at 24 weeks. However, from practical point of view, it could be concluded that 241 Am would be a valid metabolic tracer for inhaled Pu nitrate at least for half a year post inhalation, considering the detection limit for Pu in chest counting, which is much greater than the ALI of Pu and the large uncertainties due to the estimation of chest wall
Granulometric data 241-U tank farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
This report documents the quantitative analysis of disaggregated grains according to a grain size grouping scheme, termed herein granulometric analysis. The sediments analyzed were collected during the drilling of monitoring wells in the 241-U Tank Farm and were utilized to prepare a series of geologic maps and cross sections. The relative proportions of different sediment size fractions found in the sediments underlying the tank farm are important for the purposes of: (1) defining the relationships of various sediment types, (2) developing approximations of engineering and hydrological properties of sediments, and (3) determining sedimentary genesis. Approximately 790 sediment samples in the 241-U Tank Farm were analyzed for grain size with disaggregated intermediate diameters ranging from 64 to 0.063 millimeters. Size analysis was conducted utilizing a nest of nine screens with wire mesh size openings coinciding to the Wentworth-grade scale divisions. The granulometric data were input to a computer program (ROC) to categorize sediment samples into one of nineteen disaggregated sediment classes. Also included in ROC are calcium carbonate data which were determined by a semiquantitative carbon dioxide displacement method. A discussion of drilling and sampling methods, grain size nomenclature, sediment classification, sieving, calcium carbonate analysis, ROC computer program, and procedures is included to aid in understanding granulometric analysis. The background discussion is followed by the granulometric data from 241-U Tank Farm monitoring well sediment samples
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan
International Nuclear Information System (INIS)
RASMUSSEN, J.H.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102 required to satisfy the Data Quality Objectives For TWRS Privatization Phase I : Confirm Tank TIS An Appropriate Feed Source For High-Level Waste Feed Batch X(HLW DQO) (Nguyen 1999a), Data Quality Objectives For TWRS Privatization Phase 1: Confirm Tank TIS An Appropriate Feed Source For Low-Activity Waste Feed Batch X (LAW DQO) (Nguyen 1999b), Low Activity Waste and High Level Waste Feed Data Quality Objectives (L and H DQO) (Patello et al. 1999) and Characterization Data Needs for Development, Design, and Operation of Retrieval Equipment Developed through the Data Quality Objective Process (Equipment DQO) (Bloom 1996). The Tank Characterization Technical Sampling Basis document (Brown et al. 1998) indicates that these issues, except the Equipment DQO apply to tank 241-AZ-102 for this sampling event. The Equipment DQO is applied for shear strength measurements of the solids segments only. Poppiti (1999) requires additional americium-241 analyses of the sludge segments. Brown et al. (1998) also identify safety screening, regulatory issues and provision of samples to the Privatization Contractor(s) as applicable issues for this tank. However, these issues will not be addressed via this sampling event. Reynolds et al. (1999) concluded that information from previous sampling events was sufficient to satisfy the safety screening requirements for tank 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
International Nuclear Information System (INIS)
ANDREWS, J.E.
2000-01-01
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications
Un nouveau signalement de plante du Liban
Directory of Open Access Journals (Sweden)
Georges Tohmé
2016-12-01
Full Text Available Tohmé, G. and Tohmé, H. 2016. A new plant species in Lebanon. Lebanese Science Journal, 17(2: 240-241. In this note, the authors give a description of an Iris from Lebanon cited previously from Syria by Mouterde. They have named it, in 2014, I. persica tauri.
PFP MICON DCS computer software documentation
Energy Technology Data Exchange (ETDEWEB)
Silvan, G.R.
1996-03-26
This document contains the complete printout of the MICON A/S system configuration used in the Plutonium Finishing Plant. The document is divided into several volumes. Volume 1 covers the workstation display and configuration. All other volumes contain the controller configurations, or programs.
PFP MICON DCS computer software documentation
International Nuclear Information System (INIS)
Silvan, G.R.
1996-01-01
This document contains the complete printout of the MICON A/S system configuration used in the Plutonium Finishing Plant. The document is divided into several volumes. Volume 1 covers the workstation display and configuration. All other volumes contain the controller configurations, or programs
Tank 241-BY-110 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110
Tank 241-AN-102 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-AN-102
Tank 241-U-111 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-U-111
Tank 241-S-107 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-S-107
Tank 241-B-106 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-B-106
Tank 241-SY-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-SY-103
Radiation protection data sheets for the use of Americium 241 in unsealed sources
International Nuclear Information System (INIS)
Anon.
1993-01-01
This radiation protection data sheet is intended for supervisors and staff in the different medical, hospital, pharmaceutical, university and industrial laboratories and departments where Americium 241 is handled, and also for all those involved in risk prevention in this field. It provides essential data on radiation protection measures during the use of Americium 241 in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography
Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.
2007-09-13
As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
International Nuclear Information System (INIS)
Rapko, Brian M.; Vienna, John D.
2002-01-01
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
Energy Technology Data Exchange (ETDEWEB)
Rapko, Brian M.; Vienna, John D.
2002-09-09
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30.
An assessment of the dilution required to mitigate Hanford tank 241-SY-101
International Nuclear Information System (INIS)
Hudson, J.D.; Bredt, P.R.; Felmy, A.R.; Stewart, C.W.; Tingey, J.M.; Trent, D.S.; Barney, G.S.; Herting, D.L.; Larrick, A.P.; Reynolds, D.A.
1995-02-01
A group of experts from PNL and WHC convened November 2 and 3, 1994, to screen the current state of knowledge about dilution and reach a consensus on the minimum dilution ratio that will achieve passive mitigation of Tank 241-SY-101 wastes and the dilution ratio that would satisfy the given cross-site transfer criteria with reasonable assurance. The panel evaluated the effects of dilution on the parameters important in gas generation, retention, and release and reached the following conclusions, which are deduced from the existing body of data, experience, and analyses: (1) Dissolution of solids is the single most important aspect of mitigation by dilution. We are confident that diluting until nitrates, nitrites, and aluminum salts are dissolved will mitigate Hanford flammable gas tanks; (2) Sufficient solids dissolution can be achieved in Tank 241-SY-101 at a dilution ratio of 1:1, which will result in a average specific gravity of approximately 1.35. It is likely that a 0.5:1 dilution will also mitigate 241-SY-101, but the current uncertainty is too high to recommend this dilution ratio; (3) The recommended dilution requires a diluent with at least 2 molar free hydroxide, because aluminum probably precipitates at lower hydroxide concentrations. The transfer criteria for Tank 241-SY-101 waste were also evaluated. These criteria have been specified as solids content ≤30% (volume), viscosity ≤30% cP and density <1.5 g/mL. (1) Solids content is the limiting criterion if it is defined as volume fraction of settled solids. A 1:1 dilution will satisfy this criterion at nominal premixing conditions in Tank 241-SY-101; however, analysis of Window E core samples suggests that up to 1.5:1 might be required. If the solids content is interpreted simply as solids volume fraction no further dilution is necessary, because Tank 241-SY-101 waste (excluding the crust) is already below 30%; (2) Bulk density is the next limiting criterion and is met at 0.4:1 dilution
XRCC3 Thr241Met Polymorphism is not Associated with Lung Cancer Risk in a Romanian Population.
Catana, Andreea; Pop, Monica; Marginean, Dragos Horea; Blaga, Ioana Cristina; Porojan, Mihai Dumitru; Popp, Radu Anghel; Pop, Ioan Victor
2016-01-01
Deoxyribonucleic Acid (DNA) repair mechanisms play a critical role in protecting the cellular genome against carcinogens. X-ray cross-complementing gene 3 (XRCC3) is involved in DNA repair and therefore certain genetic polymorphisms that occur in DNA repair genes may affect the ability to repair DNA defects and may represent a risk factor in carcinogenesis. The purpose of our study was to investigate the association between XRCC3 gene substitution of Threonine with Methionine in codon 241 of XRCC3 gene (Thr241Met) polymorphism and the risk of lung cancer, in a Romanian population. We recruited 93 healthy controls and 85 patients with lung cancer, all smokers. Thr241Met, XRCC3 gene genotyping was determined by multiplex Polymerase Chain Reaction-Restriction Fragment Length Polymorphism (PCR-RFLP). Statistical analysis (OR, recessive model), did not revealed an increased risk for lung cancer, for the variant 241Met allele and Thr241Met genotypes (p=0.138, OR=0.634, CI=0.348-1.157; p=0.023, OR=0.257, CI=0.085-6.824). Also, there were no positive statistical associations between Thr241Met polymorphism of XRCC3 gene, gender, tobacco and various histopathological tumor type of lung cancer. In conclusion, the results of the study suggest that the XRCC3 gene Thr241Met polymorphism is not associated with an increased risk for the development of lung cancer in this Romanian group.
International Nuclear Information System (INIS)
Nisbet, A.F.; Shaw, S.; Salbu, B.
1993-01-01
The feasibility of using hollow fibre ultrafiltration to determine the molecular size distribution of radionuclides in soil solution was investigated. The physical and chemical composition of soil plays a vital role in determining radionuclide uptake by plant roots. Soil solution samples were extracted from loam, peat and sand soils that had been artificially contaminated with 137 Cs, 90 Sr, 239 Pu and 241 Am six years previously as part of a five-year lysimeter study on radionuclide uptake to crops. Ultrafiltration of soil solution was performed using hollow fibre cartridges with a nominal molecular weight cut off of 3 and 10 kD. The association of 137 Cs, 90 Sr, 239 Pu and 241 Am with different molecular size fractions of the soil solution is discussed in terms of radionuclide bioavailability to cabbage grown in the same three soils. 137 Cs and 90 Sr were present in low molecular weight forms and as such were mobile in soil and potentially available for uptake by the cabbage. In contrast, a large proportion (61-87%) of the 239 Pu and 241 Am were associated with colloidal and high molecular weight material and therefore less available for uptake by plant roots. The contribution from low molecular weight species of 239 Pu and 241 Am to the total activity in soil solution decreased in the order loam ≥ peat ≥ sand. Association of radionuclides with low molecular weight species of less than 3 kD did not, however, automatically imply availability to plants. (author)
39 CFR 241.3 - Discontinuance of post offices.
2010-07-01
... CLASSIFICATION, AND DISCONTINUANCE § 241.3 Discontinuance of post offices. (a) Introduction—(1) Coverage. This... justify in sufficient detail to Postal Service management and affected customers the proposed service... inspection during normal business hours at each post office where the Final Determination is posted for 30...
Inhalation toxicology of 241Am(NO3)3
International Nuclear Information System (INIS)
Ballou, J.E.; Gies, R.A.; Beasley, A.H.
1980-01-01
Inhaled 241 Am(NO 3 ) 3 was rapidly cleared from the lung (90% in 30 days) and translocated principally to skeleton. Although the estimated radiation dose to lung was twofold greater than the bone dose, the principal treatment-related lesion appeared to be osteosarcoma of the skeleton
Double-Shell Tank Visual Inspection Changes Resulting from the Tank 241-AY-102 Primary Tank Leak
International Nuclear Information System (INIS)
Girardot, Crystal L.; Washenfelder, Dennis J.; Johnson, Jeremy M.; Engeman, Jason K.
2013-01-01
As part of the Double-Shell Tank (DST) Integrity Program, remote visual inspections are utilized to perform qualitative in-service inspections of the DSTs in order to provide a general overview of the condition of the tanks. During routine visual inspections of tank 241-AY-102 (AY-102) in August 2012, anomalies were identified on the annulus floor which resulted in further evaluations. In October 2012, Washington River Protection Solutions, LLC determined that the primary tank of AY-102 was leaking. Following identification of the tank AY-102 probable leak cause, evaluations considered the adequacy of the existing annulus inspection frequency with respect to the circumstances of the tank AY-102 1eak and the advancing age of the DST structures. The evaluations concluded that the interval between annulus inspections should be shortened for all DSTs, and each annulus inspection should cover > 95 percent of annulus floor area, and the portion of the primary tank (i.e., dome, sidewall, lower knuckle, and insulating refractory) that is visible from the annulus inspection risers. In March 2013, enhanced visual inspections were performed for the six oldest tanks: 241-AY-101, 241-AZ-101,241-AZ-102, 241-SY-101, 241-SY-102, and 241-SY-103, and no evidence of leakage from the primary tank were observed. Prior to October 2012, the approach for conducting visual examinations of DSTs was to perform a video examination of each tank's interior and annulus regions approximately every five years (not to exceed seven years between inspections). Also, the annulus inspection only covered about 42 percent of the annulus floor
Tank characterization report for single-shell tank 241-B-104
International Nuclear Information System (INIS)
Field, J.G.
1996-01-01
This document summarizes information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-104. Sampling and analyses meet safety screening and historical data quality objectives. This report supports the requirements of Tri-party Agreement Milestone M-44-09. his characterization report summoned the available information on the historical uses and the current status of single-shell tank 241-B-104, and presents the analytical results of the June 1995 sampling and analysis effort. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-44-09 (Ecology et al. 1994). Tank 241-B-104 is a single-shell underground waste storage tank located in the 200 East Area B Tank Farm on the Hanford Site. It is the first tank in a three-tank cascade series. The tank went into service in August 1946 with a transfer of second-cycle decontamination waste generated from the bismuth phosphate process. The tank continued to receive this waste type until the third quarter of 1950, when it began receiving first-cycle decontamination waste also produced during the bismuth phosphate process. Following this, the tank received evaporator bottoms sludge from the 242-B Evaporator and waste generated from the flushing of transfer lines. A description and the status of tank 241-B-104 are sum in Table ES-1 and Figure ES-1. The tank has an operating capacity of 2,010 kL (530 kgal), and presently contains 1,400 kL (371 kgal) of waste. The total amount is composed of 4 kL (1 kgal) of supernatant, 260 kL (69 kgal) of saltcake, and 1,140 kL (301 kgal) of sludge (Hanlon 1995). Current surveillance data and observations appear to support these results
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
Energy Technology Data Exchange (ETDEWEB)
ANDREWS, J.E.
2000-01-27
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications.
Liver cancer induction by 241Am and thorotrast in deer mice and grasshopper mice
International Nuclear Information System (INIS)
Taylor, G.N.; Mays, C.W.; Lloyd, R.D.; Jones, C.W.; Rojas, J.; Wrenn, M.E.; Ayoroa, G.; Kaul, A.; Riedel, W.
1986-01-01
The carcinogenicity of 241 Am, relative to thorotrast, has been determined in two species of mice: the grasshopper mouse (Onychomys leucogaster) and the deer mouse (Peromyscus maniculatus). These species were used since both have high uptakes of Pu and Am and, unlike conventional mice and rats, both retain relatively high concentrations of plutonium and americium in their livers. The study indicated that the liver carcinogenicity of comparable rad doses of 241 Am or thorotrast is approximately equal. The toxicity ratio ( 241 Am/thorotrast) for liver cancer induction approximated 1.2 with a range of about 0.6 to 1.6. This suggested that nonradiation factors of thorotrast were not significant in liver tumor induction. (orig.)
Effect of alcohol on internally deposited Am-241 in the baboon: a pilot study
International Nuclear Information System (INIS)
Cohen, N.; Antonelli, R.; LoSasso, T.
1977-01-01
The efficacy of ethyl alcohol in enhancing the excretion of Am-241 from the baboon has been tested. Alcohol enhances Am-241 excretion via the fecal route by a factor of about 2.5. However, there is a corresponding increase in fecal volume, and no significant change in the concentration of the nuclide in the feces. Other cathartics tested caused increased fecal volumes with no change in amount of activity excreted leading to a decreased concentration of the nuclide in the feces. Alcohol is not as effective as DTPA in removing Am-241 from the body. Preliminary results suggest that alcohol has little or no enhancement effect on the decorporation capability of DTPA
Operability test procedure [Tank] 241-SY-101 equipment removal system
International Nuclear Information System (INIS)
Mast, J.C.
1994-01-01
The 241-SY-101 equipment removal system (ERS) consists of components, equipment, instrumentation and procedures that will provide the means to disconnect, retrieve, contain, load and transport the Mitigation Pump Assembly (MPA) from waste Tank 241-SY-101 to the Central Waste Complex (CWC). The Operability Test Procedure (OTP) will test the interfaces between ERS components and will rehearse the procedure for MPA removal and transportation to the extent they can be mocked-up at the CTF (Cold Test Facility). At the conclusion of the OTP, the ERS components and equipment will be removed from the CTF, entered into the Component Based Recall System (CBRS), and stored until needed for actual MPA removal and transportation
30 CFR 241.72 - How will the Office of Hearings and Appeals conduct the hearing on the record?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will the Office of Hearings and Appeals conduct the hearing on the record? 241.72 Section 241.72 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PENALTIES Penalties for Federal and Indian Oil and Gas Leases General Provisions § 241.72 How...
Differential deposition of H2A.Z in rice seedling tissue during the day-night cycle.
Zhang, Kang; Xu, Wenying; Wang, Chunchao; Yi, Xin; Su, Zhen
2017-03-04
Chromatin structure has an important role in modulating gene expression. The incorporation of histone variants into the nucleosome leads to important changes in the chromatin structure. The histone variant H2A.Z is highly conserved between different species of fungi, animals, and plants. However, dynamic changes to H2A.Z in rice have not been reported during the day-night cycle. In this study, we generated genome wide maps of H2A.Z for day and night time in harvested seedling tissues by combining chromatin immunoprecipitation and high-throughput sequencing. The analysis results for the H2A.Z data sets detected 7099 genes with higher depositions of H2A.Z in seedling tissues harvested at night compared with seedling tissues harvested during the day, whereas 4597 genes had higher H2A.Z depositions in seedlings harvested during the day. The gene expression profiles data suggested that H2A.Z probably negatively regulated gene expression during the day-night cycle and was involved in many important biologic processes. In general, our results indicated that H2A.Z may play an important role in plant responses to the diurnal oscillation process.
36 CFR 241.2 - Cooperation in wildlife management.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.2 Cooperation in wildlife management. The Chief of the... which national forests or portions thereof may be devoted to wildlife protection in combination with...
24 CFR 241.555 - Security instrument and lien.
2010-04-01
... that a default under the first mortgage is a default under the supplementary loan security instrument... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security instrument and lien. 241... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The readiness of the upgraded 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mixer pump and instrumentation in tank 241-SY-101 was evaluated by the performance of OTP-440-001. Results of the OTP are reported here
Acceptance Test Report for 241-U compressed air system
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027
241-SY-101 multi-functional instrument tree acceptance for beneficial use (ABU)
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This document formally demonstrates that the ABU process for the 241-SY-101 risers 17B and 17C Multi-functional Instrument Trees (MIT's) has been properly completed in accordance with the approved ABU checklists. For each item required on the ABU Checklist, a bibliography of the documentation prepared and released to satisfy the requirements is provided. Release of this documentation signifies that the tank farm Operations, Engineering, and Maintenance organizations have accepted responsibility for the MIT'S in 241-SY-101 Risers 17B and 17C
Characterisation of a protection level Am-241 calibration source
Bass, G. A.; Rossiter, M. J.; Williams, T. T.
1992-11-01
The various measurements involved in the commissioning process of an Am-241 radioactive source and transport mechanisms to be used for protection level calibration work are detailed. The source and its handling mechanisms are described and measurements to characterize the resultant gamma ray beam are described. For the beam measurements, the inverse square law is investigated and beam uniformity is assessed. A trial calibration of ionization chambers is described. The Am-241 irradiation facility is concluded to be suitable for calibrating secondary standards as part of the calibration service offered for protection level instruments. The umbra part of beam is acceptably uniform for a range of chambers and the measurements obtained were predictable and consistent. This quality will be added to the range of qualities offered as part of the protection level secondary standard calibration service.
36 CFR 241.1 - Cooperation in wildlife protection.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.1 Cooperation in wildlife protection. (a) Officials of the... and regulations for the protection of wildlife. (b) Officials of the Forest Service who have been, or...
27 CFR 24.241 - Decolorizing juice or wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Decolorizing juice or wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.241 Decolorizing juice or wine. (a) Conditions and limitations. If the proprietor wishes to use activated carbon or other...
International Nuclear Information System (INIS)
Tingey, Joel M.; Jones, Susan A.
2005-01-01
Eighteen plutonium oxide samples originating from the Plutonium Finishing Plant (PFP) on the Hanford Site were analyzed to provide additional data on the suitability of PFP thermally stabilized plutonium oxides and Rocky Flats oxides as alternate feedstock to the Mixed Oxide Fuel Fabrication Facility (MFFF). Radiochemical and chemical analyses were performed on fusions, acid leaches, and water leaches of these 18 samples. The results from these destructive analyses were compared with nondestructive analyses (NDA) performed at PFP and the acceptance criteria for the alternate feedstock. The plutonium oxide materials considered as alternate feedstock at Hanford originated from several different sources including Rocky Flats oxide, scrap from the Remote Mechanical C-Line (RMC) and the Plutonium Reclamation Facility (PRF), and materials from other plutonium conversion processes at Hanford. These materials were received at PFP as metals, oxides, and solutions. All of the material considered as alternate feedstock was converted to PuO2 and thermally stabilized by heating the PuO2 powder at 950 C in an oxidizing environment. The two samples from solutions were converted to PuO2 by precipitation with Mg(OH)2. The 18 plutonium oxide samples were grouped into four categories based on their origin. The Rocky Flats oxide was divided into two categories, low- and high-chloride Rocky Flats oxides. The other two categories were PRF/RMC scrap oxides, which included scrap from both process lines and oxides produced from solutions. The two solution samples came from samples that were being tested at Pacific Northwest National Laboratory because all of the plutonium oxide from solutions at PFP had already been processed and placed in 3013 containers. These samples originated at the PFP and are from plutonium nitrate product and double-pass filtrate solutions after they had been thermally stabilized. The other 16 samples originated from thermal stabilization batches before canning at
Engineering evaluation of alternatives: Managing the assumed leak from single-shell Tank 241-T-101
International Nuclear Information System (INIS)
Brevick, C.H.; Jenkins, C.
1996-02-01
At mid-year 1992, the liquid level gage for Tank 241-T-101 indicated that 6,000 to 9,000 gal had leaked. Because of the liquid level anomaly, Tank 241-T-101 was declared an assumed leaker on October 4, 1992. SSTs liquid level gages have been historically unreliable. False readings can occur because of instrument failures, floating salt cake, and salt encrustation. Gages frequently self-correct and tanks show no indication of leak. Tank levels cannot be visually inspected and verified because of high radiation fields. The gage in Tank 241-T-101 has largely corrected itself since the mid-year 1992 reading. Therefore, doubt exists that a leak has occurred, or that the magnitude of the leak poses any immediate environmental threat. While reluctance exists to use valuable DST space unnecessarily, there is a large safety and economic incentive to prevent or mitigate release of tank liquid waste into the surrounding environment. During the assessment of the significance of the Tank 241-T-101 liquid level gage readings, Washington State Department of Ecology determined that Westinghouse Hanford Company was not in compliance with regulatory requirements, and directed transfer of the Tank 241-T-101 liquid contents into a DST. Meanwhile, DOE directed WHC to examine reasonable alternatives/options for safe interim management of Tank 241-T-101 wastes before taking action. The five alternatives that could be used to manage waste from a leaking SST are: (1) No-Action, (2) In-Tank Stabilization, (3) External Tank Stabilization, (4) Liquid Retrieval, and (5) Total Retrieval. The findings of these examinations are reported in this study
Compilation of PRF Canyon Floor Pan Sample Analysis Results
Energy Technology Data Exchange (ETDEWEB)
Pool, Karl N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Minette, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wahl, Jon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Greenwood, Lawrence R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coffey, Deborah S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McNamara, Bruce K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bryan, Samuel A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Scheele, Randall D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Delegard, Calvin H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Soderquist, Chuck Z. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fiskum, Sandra K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Brown, Garrett N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clark, Richard A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-06-30
common anions, gamma spectrometry, metals, corrosivity, organics and alpha spectrometry (note: alpha spectrometry was cancelled during the performance of this work with concurrence from CHPRC). Results may help elucidate the components that led to the unexpected reaction in the canyon as well as inform the radiological and hazardous characteristics. The specific anions, gamma emitters, organics and metals requested by CHPRC are provided in the analytical reports sections. The individual analyses were conducted under the Plutonium Finishing Plant (PFP) Floor Pan Evaluation Project Quality Assurance Project Plan (PFP Floor Pan Evaluation QAPP, Revision 0.) developed by PNNL specifically for this project. The final reports for each analysis set are included in this compilation of the results. Each package was reviewed under the PFP Floor Pan Evaluation Project Quality Assurance Project Plan so no additional reviews were conducted in this compilation task. The Gas Generation Rates in Appendix G were conducted under the PNNL “How Do I…” quality assurance program and were NOT conducted under the Plutonium Finishing Plant (PFP) Floor Pan Evaluation Project Quality Assurance Project Plan (PFP Floor Pan Evaluation QAPP, Revision 0.).
International Nuclear Information System (INIS)
Godoy, J.M.; Schuettelkopf, H.; Pimpl, M.
1983-04-01
A procedure was developed to measure Pu-241 by liquid scintillation counting. Sample preparation was performed by electroplating of plutonium on stainless steel planchets. To correct the selfabsorption, the linear dependence of counting efficiency in the liquid scintillation counter from the resolution in the alpha spectrometer was used. Pu-238, Pu-239+240 and Pu-241 were measured in the liquid effluents of the Karlsruhe Nuclear Research Center (KfK). The concentrations in monthly mixed samples ranged from 0.07 until 46 nCi Pu-238/m 3 , from 0.13 until 2.1 nCi Pu-239+240/m 3 and from 25 until 190 nCi Pu-241/m 3 . Between 5.4% and 41% of the plutonium content of the KfK waste water are released to the River Old Rhine. The values for the activity ratio Pu-238/Pu-239+240 are between 0.39 and 1.1 and for Pu-241/Pu-239+240 are between 11 and 300. The mean value for Pu-241/Pu-239+240 is 61. The dose exposure of the environmental population of the Karlsruhe Nuclear Research Center caused by released Pu-241 is negligible low. (orig./HP) [de
Greater Focus Needed on Alien Plant Impacts in Protected Areas
Czech Academy of Sciences Publication Activity Database
Hulme, P. E.; Pyšek, Petr; Pergl, Jan; Jarošík, Vojtěch; Schaffner, U.; Vila, M.
2014-01-01
Roč. 7, č. 5 (2014), s. 459-466 ISSN 1755-263X R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : plant invasions * impact * protected areas Subject RIV: EF - Botanics Impact factor: 7.241, year: 2014
241Am induced thyroid lesions in the beagle: interim observations
International Nuclear Information System (INIS)
Taylor, G.N.; Zizumbo, I.; Angus, W.; Jones, A.; Elliot, D.
1976-01-01
Injected doses of 2.88, 0.91 or 0.296 μCi 241 Am/kg in young adult beagles produced morphological changes in the thyroid gland and produce lower concentrations of thyroxin in the sera. Interstitial fibrosis without functional impairment was induced by the 0.099 μCi 241 Am/kg dose level. Clinical symptoms of hypothyroidism were not observed, even in those dogs with the most extreme thyroid lesions. The changes were characterized by a decrease in thyroid weight, interfollicular fibrosis, loss of colloid, loss of follicular epithelium, and hypertrophy and hyperplasia of the residual epithelium. Thus far, thyroid tumors have not been observed, however, a significant percentage of the animals in the lower dose levels are still living